messages
listlengths
1
1
ground_truth
stringlengths
1.53k
24.1k
dataset
stringclasses
1 value
source_datasets
listlengths
1
1
individual_ground_truths
listlengths
15
15
individual_questions
listlengths
15
15
num_questions
int64
15
15
question_indices
listlengths
15
15
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which sport is supervised in Scotland by the Camanachd Association?\nQuestion 2: Benjamin Briggs was captain of which famous ship?\nQuestion 3: Which Liverpool film maker made 'Of Time And The City' and 'Deep Blue Sea'?\nQuestion 4: In which constellation is the bright star Deneb?\nQuestion 5: Which 1985 agreement between many EC states led to the removal of border controls between those countries?\nQuestion 6: The President of which African country resigned in February 2011 after widespread protests calling for his departure?\nQuestion 7: What is the largest gulf in the world?\nQuestion 8: Detective Jane Rizzoli and Doctor Maura Isles work for the Police Department in which city in US author Tess Gerritsen’s crime novels?\nQuestion 9: Tracey Thorn was the lead singer in which English pop duo?\nQuestion 10: In Greek mythology who was the mother of Achilles?\nQuestion 11: In which city are the headquarters of the European Central Bank?\nQuestion 12: Who is the only artist to have a top 40 hit with 'Mustang Sally' in the UK when it reached number 28 in 1966?\nQuestion 13: Which King of England was the son of Henry II and father of Henry III?\nQuestion 14: \"The Hector Berlioz opera \"\"Les Troyens\"\" is based on a poem written by whom?\"\nQuestion 15: In which English county is the resort of Skegness?", "role": "user" } ]
["[\"Shinty\", \"Camanachd\", \"SHINTY\", \"Caman\"]", "[\"Marie C\\u00e9leste\", \"Amazon (brigantine)\", \"Mary Celeste\", \"The Mary Celeste\", \"Mary Celest\", \"Mary Celeste in popular culture\", \"Marie Celeste\"]", "[\"Terence Davis\", \"TERENCE DAVIES\", \"Terence Davies\"]", "[\"Cygnus\", \"Signus\", \"Cygnus (disambiguation)\"]", "[\"Schengen\", \"Schenigen\", \"Schengen (disambiguation)\", \"Schenghen\", \"Shengen\"]", "[\"EGY\", \"Arab Republic of Egypt\", \"A .R . EGYPT\", \"The Arab Republic of Egypt\", \"Eygpt\", \"Etymology of Egypt\", \"\\u0645\\u0635\\u0631\", \"Kemmet\", \"Gift of the Nile\", \"Arab Republic Of Egypt\", \"Names of Egypt\", \"Mi\\u1e63r\", \"A .R . Egypt\", \"Eytp\", \"National identity of Egyptians\", \"Jumhuriyat Misr al'Arabiyah\", \"Eypt\", \"Egyptian Republic\", \"Ejipt\", \"Name of Egypt\", \"Egipto\", \"Kimet\", \"\\u062c\\u0645\\u0647\\u0648\\u0631\\u064a\\u0651\\u0629 \\u0645\\u0635\\u0631\\u0627\\u0644\\u0639\\u0631\\u0628\\u064a\\u0651\\u0629\", \"Egypte\", \"Egypt (name)\", \"Egypt\", \"\\u062c\\u0645\\u0647\\u0648\\u0631\\u064a\\u0629 \\u0645\\u0635\\u0631\\u0627\\u0644\\u0639\\u0631\\u0628\\u064a\\u0629\", \"A.R. Egypt\", \"Republic of Eygpt\", \"\\u00c9gypte\", \"Second Egyptian Republic\", \"Egipt\", \"ISO 3166-1:EG\", \"Egypt info\"]", "[\"Mexico, Gulf of\", \"Gulph of Mexico\", \"Pollution in the Gulf of Mexico\", \"Gulf of M\\u00e9xico\", \"Pollution of the Gulf of Mexico\", \"Mexican Gulf\", \"Gulf of Florida\", \"Mexican gulf\", \"The Gulf of Mexico\", \"The Gulf of mexico\", \"Gulf Of Mexico\", \"Golfo de Mexico\", \"Gulf of mexico\", \"Golfo de M\\u00e9xico\", \"Gulf of Mexico\", \"Mexico Gulf\"]", "[\"City of Boston\", \"Boston,MA\", \"Economy of Boston\", \"Boston, Massachussets\", \"Boston's\", \"Boston, ma\", \"Boston, Massachusets\", \"Boston Massachusetts\", \"Boston, United States\", \"Wahstoron\\u00f2n:ke\", \"Boston, Massachusetts, USA\", \"Boston Mass\", \"Boston, Massachessets\", \"Boston, Massachussetts\", \"Boston, Massachusetts, US\", \"Bosotn\", \"The weather in Boston\", \"Boston,Massachusetts\", \"Boston, Mass\", \"Boston, Massachusettes\", \"Boston, Massachussettes\", \"Boston, Massachusetts\", \"The hub of the universe\", \"Boston mass\", \"Boston massachusetts\", \"Boston Weather\", \"Beantown\", \"BOSTON\", \"Bofton\", \"Boston, USA\", \"Boston, mass\", \"Education in Boston\", \"Boston ma\", \"Boston, MA\", \"Boston, US\", \"Boston (Mass.)\", \"Boston MA\", \"Demographics of Boston\", \"Geography of Boston\", \"Religion in Boston\", \"Boston (MA)\", \"Capital of Massachusetts\", \"Puritan City\", \"Boston, Massachusetts, United States of America\", \"Politics of Boston\", \"Boston\", \"Boston, Mass.\", \"The Hub of the Universe\", \"Boston, Massachusetts, United States\", \"Bean Town\", \"Bawstun\", \"UN/LOCODE:USBOS\", \"Massachusetts/Boston\"]", "[\"Everything but the girl\", \"Everything but the Girl\", \"EBTG\", \"Everything But the Girl\", \"Everything But The Girl\"]", "[\"Thetis\", \"Peleus and Thetis\", \"\\u0398\\u03ad\\u03c4\\u03b9\\u03c2\", \"Hetis\", \"THETIS\", \"Thetys\"]", "[\"Frankfort-on-the-Main\", \"Frankfurt am Main, Germany\", \"UN/LOCODE:DEFRA\", \"Frankfort-on-the-Maine\", \"Frankfort on Main\", \"Frankfurt-on-the-Main\", \"Frankfort/Main\", \"Franckford\", \"Frankfurt am Main (Germany)\", \"Frankfurt-Am-Main, Germany\", \"Frankfort On Main\", \"Frankfurt a.M.\", \"Frankfurt (Main)\", \"Franfurt\", \"Frankfurt, Main\", \"Frankfurt am Main, Hesse\", \"Frankfurt-Am-Main\", \"Frankfurt-on-Main\", \"Frankfurt (state)\", \"Frankfort-am-Main\", \"Frankfurt, Hesse\", \"Frankfurt am Main\", \"Frankfurt\\u2013am-Main\", \"Frankfort-on-Main\", \"Mainhattan\", \"Frankfurt, Germany\", \"Frankfurt-am-Main\", \"Frankfurt\", \"Frankfurt/Main\", \"Frankfurt on Main\", \"FRANKFURT\", \"Frankfurt am main\", \"Frankfurt on the Main\", \"Frankfort on the Main\"]", "[\"Wilson Picket\", \"Wilson Pickett\", \"Wilson pickett\"]", "[\"John (disambiguation)\", \"John (European rulers)\", \"%22John%22\", \"John (bishop)\", \"John (song)\", \"John\"]", "[\"Virgil in his Basket\", \"Virgil in his basket\", \"Publius Virgilius Maro\", \"Publius Vergilus Maro\", \"Swan of Mantua\", \"Vergilius\", \"Virgilian\", \"Virgil\", \"Pheryllt\", \"VIRGIL\", \"Publius Vergilius Maro\", \"Maro Virgilius\", \"Mantuan Swan\", \"Vergil\", \"Virgilius\"]", "[\"The Lincolnshire\", \"LINCOLNSHIRE\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Shinty\", \"Camanachd\", \"SHINTY\", \"Caman\"]", "[\"Marie C\\u00e9leste\", \"Amazon (brigantine)\", \"Mary Celeste\", \"The Mary Celeste\", \"Mary Celest\", \"Mary Celeste in popular culture\", \"Marie Celeste\"]", "[\"Terence Davis\", \"TERENCE DAVIES\", \"Terence Davies\"]", "[\"Cygnus\", \"Signus\", \"Cygnus (disambiguation)\"]", "[\"Schengen\", \"Schenigen\", \"Schengen (disambiguation)\", \"Schenghen\", \"Shengen\"]", "[\"EGY\", \"Arab Republic of Egypt\", \"A .R . EGYPT\", \"The Arab Republic of Egypt\", \"Eygpt\", \"Etymology of Egypt\", \"\\u0645\\u0635\\u0631\", \"Kemmet\", \"Gift of the Nile\", \"Arab Republic Of Egypt\", \"Names of Egypt\", \"Mi\\u1e63r\", \"A .R . Egypt\", \"Eytp\", \"National identity of Egyptians\", \"Jumhuriyat Misr al'Arabiyah\", \"Eypt\", \"Egyptian Republic\", \"Ejipt\", \"Name of Egypt\", \"Egipto\", \"Kimet\", \"\\u062c\\u0645\\u0647\\u0648\\u0631\\u064a\\u0651\\u0629 \\u0645\\u0635\\u0631\\u0627\\u0644\\u0639\\u0631\\u0628\\u064a\\u0651\\u0629\", \"Egypte\", \"Egypt (name)\", \"Egypt\", \"\\u062c\\u0645\\u0647\\u0648\\u0631\\u064a\\u0629 \\u0645\\u0635\\u0631\\u0627\\u0644\\u0639\\u0631\\u0628\\u064a\\u0629\", \"A.R. Egypt\", \"Republic of Eygpt\", \"\\u00c9gypte\", \"Second Egyptian Republic\", \"Egipt\", \"ISO 3166-1:EG\", \"Egypt info\"]", "[\"Mexico, Gulf of\", \"Gulph of Mexico\", \"Pollution in the Gulf of Mexico\", \"Gulf of M\\u00e9xico\", \"Pollution of the Gulf of Mexico\", \"Mexican Gulf\", \"Gulf of Florida\", \"Mexican gulf\", \"The Gulf of Mexico\", \"The Gulf of mexico\", \"Gulf Of Mexico\", \"Golfo de Mexico\", \"Gulf of mexico\", \"Golfo de M\\u00e9xico\", \"Gulf of Mexico\", \"Mexico Gulf\"]", "[\"City of Boston\", \"Boston,MA\", \"Economy of Boston\", \"Boston, Massachussets\", \"Boston's\", \"Boston, ma\", \"Boston, Massachusets\", \"Boston Massachusetts\", \"Boston, United States\", \"Wahstoron\\u00f2n:ke\", \"Boston, Massachusetts, USA\", \"Boston Mass\", \"Boston, Massachessets\", \"Boston, Massachussetts\", \"Boston, Massachusetts, US\", \"Bosotn\", \"The weather in Boston\", \"Boston,Massachusetts\", \"Boston, Mass\", \"Boston, Massachusettes\", \"Boston, Massachussettes\", \"Boston, Massachusetts\", \"The hub of the universe\", \"Boston mass\", \"Boston massachusetts\", \"Boston Weather\", \"Beantown\", \"BOSTON\", \"Bofton\", \"Boston, USA\", \"Boston, mass\", \"Education in Boston\", \"Boston ma\", \"Boston, MA\", \"Boston, US\", \"Boston (Mass.)\", \"Boston MA\", \"Demographics of Boston\", \"Geography of Boston\", \"Religion in Boston\", \"Boston (MA)\", \"Capital of Massachusetts\", \"Puritan City\", \"Boston, Massachusetts, United States of America\", \"Politics of Boston\", \"Boston\", \"Boston, Mass.\", \"The Hub of the Universe\", \"Boston, Massachusetts, United States\", \"Bean Town\", \"Bawstun\", \"UN/LOCODE:USBOS\", \"Massachusetts/Boston\"]", "[\"Everything but the girl\", \"Everything but the Girl\", \"EBTG\", \"Everything But the Girl\", \"Everything But The Girl\"]", "[\"Thetis\", \"Peleus and Thetis\", \"\\u0398\\u03ad\\u03c4\\u03b9\\u03c2\", \"Hetis\", \"THETIS\", \"Thetys\"]", "[\"Frankfort-on-the-Main\", \"Frankfurt am Main, Germany\", \"UN/LOCODE:DEFRA\", \"Frankfort-on-the-Maine\", \"Frankfort on Main\", \"Frankfurt-on-the-Main\", \"Frankfort/Main\", \"Franckford\", \"Frankfurt am Main (Germany)\", \"Frankfurt-Am-Main, Germany\", \"Frankfort On Main\", \"Frankfurt a.M.\", \"Frankfurt (Main)\", \"Franfurt\", \"Frankfurt, Main\", \"Frankfurt am Main, Hesse\", \"Frankfurt-Am-Main\", \"Frankfurt-on-Main\", \"Frankfurt (state)\", \"Frankfort-am-Main\", \"Frankfurt, Hesse\", \"Frankfurt am Main\", \"Frankfurt\\u2013am-Main\", \"Frankfort-on-Main\", \"Mainhattan\", \"Frankfurt, Germany\", \"Frankfurt-am-Main\", \"Frankfurt\", \"Frankfurt/Main\", \"Frankfurt on Main\", \"FRANKFURT\", \"Frankfurt am main\", \"Frankfurt on the Main\", \"Frankfort on the Main\"]", "[\"Wilson Picket\", \"Wilson Pickett\", \"Wilson pickett\"]", "[\"John (disambiguation)\", \"John (European rulers)\", \"%22John%22\", \"John (bishop)\", \"John (song)\", \"John\"]", "[\"Virgil in his Basket\", \"Virgil in his basket\", \"Publius Virgilius Maro\", \"Publius Vergilus Maro\", \"Swan of Mantua\", \"Vergilius\", \"Virgilian\", \"Virgil\", \"Pheryllt\", \"VIRGIL\", \"Publius Vergilius Maro\", \"Maro Virgilius\", \"Mantuan Swan\", \"Vergil\", \"Virgilius\"]", "[\"The Lincolnshire\", \"LINCOLNSHIRE\"]" ]
[ "Which sport is supervised in Scotland by the Camanachd Association?", "Benjamin Briggs was captain of which famous ship?", "Which Liverpool film maker made 'Of Time And The City' and 'Deep Blue Sea'?", "In which constellation is the bright star Deneb?", "Which 1985 agreement between many EC states led to the removal of border controls between those countries?", "The President of which African country resigned in February 2011 after widespread protests calling for his departure?", "What is the largest gulf in the world?", "Detective Jane Rizzoli and Doctor Maura Isles work for the Police Department in which city in US author Tess Gerritsen’s crime novels?", "Tracey Thorn was the lead singer in which English pop duo?", "In Greek mythology who was the mother of Achilles?", "In which city are the headquarters of the European Central Bank?", "Who is the only artist to have a top 40 hit with 'Mustang Sally' in the UK when it reached number 28 in 1966?", "Which King of England was the son of Henry II and father of Henry III?", "\"The Hector Berlioz opera \"\"Les Troyens\"\" is based on a poem written by whom?\"", "In which English county is the resort of Skegness?" ]
15
[ 70995, 70996, 70997, 70998, 70999, 71000, 71001, 71002, 71003, 71004, 71005, 71006, 71007, 71008, 71009 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Acetylsalicylic acid is a commonly taken drug, what is its usual name?\nQuestion 2: Which world figure is married to quantum chemist Joachim Sauer?\nQuestion 3: Retinol is another name for which vitamin?\nQuestion 4: Which Spanish city houses 'La Mezquita', and was the capital of Muslim Spain from 756 until its capture in 1236?\nQuestion 5: Which tree is also known as the Trembling Poplar?\nQuestion 6: Which charity has been supported by the comedy called The Secret Policeman's Balls?\nQuestion 7: A stonemason commonly refers to unmetamorphosed limestone as what, whose name derives from Greek 'shining stone'?\nQuestion 8: Which London thoroughfare runs between Hyde Park Corner and Marble Arch?\nQuestion 9: The 'Derwent Valley Mills' is a World Heritage Site, in which English county?\nQuestion 10: \"Identify the number one hit from its opening line, \"\"When you're weary, feeling small\"\"?\"\nQuestion 11: Who succeeded Henry Cooper as British Heavyweight Boxing Champion?\nQuestion 12: Which great modernist architect designed the Seagram Building in New York in collaboration with Philip Johnson?\nQuestion 13: \"Which Irish comedian had the catchphrase \"\"and there's more\"\"?\"\nQuestion 14: Before Red Nose Day there were two comic relief records. What was the first one called and who was it by?\nQuestion 15: Which bargain retail chain of shops was started in 1990 by David Dodd and Stephen Smith", "role": "user" } ]
["[\"Idragin\", \"Aspalon\", \"Baby aspirin\", \"Acetisal\", \"Aspirin\", \"Dolopirin\", \"Aspirine\", \"Junior aspirin\", \"Salacetin\", \"Acylpyrin\", \"8-Hour Bayer\", \"Rheumintabletten\", \"ATCvet code QB01AC06\", \"Acetylsalicylic Acid\", \"Contrheuma retard\", \"Saletin\", \"Endydol\", \"Asparin\", \"Extren\", \"Premaspin\", \"ZORprin\", \"Aspirdrops\", \"Bi-prin\", \"Novid\", \"Caprin\", \"Enterophen\", \"Dolean pH 8\", \"Magnyl\", \"Enterosarein\", \"Acetyl salicylic acid\", \"A.S.A. Empirin\", \"Solfrin\", \"Aceticyl\", \"Ecolen\", \"Rhodine\", \"Nu-seals\", \"Cemirit\", \"Yasta\", \"Entericin\", \"Salcetogen\", \"ATC code B01AC06\", \"Aspec\", \"Acetosal\", \"Asp\\u00e9gic\", \"Claradin\", \"Spira-Dine\", \"Genacote\", \"Triple-sal\", \"Acetonyl\", \"81mg\", \"Kardegic\", \"Colfarit\", \"2-Ethanoylbenzenecarboxylic acid\", \"Measurin\", \"Solprin\", \"Ecotrin\", \"Entrophen\", \"Temperal\", \"Acetylsalicyclic acid\", \"Bialpirina\", \"Rhonal\", \"Low dose aspirin\", \"Polopiryna\", \"Acetylsalicylic\", \"Fasprin\", \"8-hour Bayer\", \"Asteric\", \"Myoprin\", \"Asagran\", \"2-acetyloxybenzoic acid\", \"Acimetten\", \"Persistin\", \"Micristin\", \"Acisal\", \"Tasprin\", \"ATCvet code QN02BA01\", \"Nu-seals aspirin\", \"Bialpirinia\", \"Solprin acid\", \"Asatard\", \"Neuronika\", \"Levius\", \"Easprin\", \"ATCvet code QA01AD05\", \"Acetophen\", \"Solpyron\", \"Delgesic\", \"Ascoden-30\", \"ATC code A01AD05\", \"Acetosalin\", \"Bufferin\", \"Monoacetic acid ester of salicylic acid\", \"Acesal\", \"Adiro\", \"Aspirin allergy\", \"Benaspir\", \"Enterosarine\", \"Triaminicin\", \"Globentyl\", \"Halfprin\", \"Supac\", \"Sedergine\", \"Trombyl\", \"Empirin\", \"Calcium acetylsalicylate\", \"Acetylosalicylic acid\", \"Acetylsal\", \"Acetylsalicylic acid\", \"Acetylin\", \"Pirseal\", \"Acetylsalicylate\", \"Pharmacin\", \"ATC code N02BA01\", \"Acetyl salicilic acid\", \"Decaten\", \"Acenterine\", \"Clariprin\", \"Aspirin synthesis\"]", "[\"Chancellor Merkel\", \"Dr. Angela Dorothea Merkel\", \"Angela Dorothea Kasner\", \"Dorothea Kasner\", \"Ulrich Merkel\", \"Angela Kasner\", \"Angela Dorothea Merkel\", \"Angela Merkl\", \"Angela Teflon Merkel\", \"Merckel\", \"Angela Merkel\", \"Angie Merkel\", \"Merkel\", \"Angela Merkell\"]", "[\"Vi-Alpha\", \"Axerol\", \"Hi-A-Vita\", \"A-Sol\", \"Vitamin A supplementation\", \"Aquasol A Parenteral\", \"Sehkraft A\", \"Alcovit A\", \"Veroftal\", \"Lard Factor\", \"Vitavel A\", \"Myvpack\", \"Testavol\", \"Aquasynth\", \"Vaflol\", \"Asterol\", \"Anatola A\", \"A-Vi-Pel\", \"Biosterol\", \"Anatola\", \"A-Mulsal\", \"Agiolan\", \"List of foods containing Vitamin A\", \"M.V.C. 9+3\", \"Avitol\", \"Vio-A\", \"Solu-A\", \"Apostavit\", \"A-Vitan\", \"Axerophthol\", \"Bentavit A\", \"Atav\", \"Oleovitamin A\", \"Agoncal\", \"Cylasphere\", \"Vitpex\", \"TROL\", \"Mvc Plus\", \"Atars\", \"Alphasterol\", \"Apexol\", \"Thalasphere\", \"Nio-A-Let\", \"Vogan-nu\", \"Anti-Infective vitamin\", \"Dohyfral A\", \"M.V.I.-12\", \"Ro-a-vit\", \"Zineb 80\", \"Avibon\", \"Disatabs Tabs\", \"Retrovitamin A\", \"Ophthalamin\", \"Vi-a\", \"Vogan-Neu\", \"Del-VI-A\", \"Zinosan N\", \"Testavol S\", \"Super A\", \"Vitamin A\", \"Vi-Dom-A\", \"Vafol\", \"Epiteliol\", \"Vitamin a\", \"Plivit A\", \"Homagenets Aoral\", \"Dofsol\", \"Chocola A\", \"Homagenets aorl\", \"Prepalin\"]", "[\"C\\u00f3rdoba (disambiguation)\", \"C\\u00f3rdoba, Mexico\", \"Cordoba\", \"C\\u00f3rdoba, Mexico (disambiguation)\", \"C\\u00f3rdoba, Colombia\", \"C\\u00f3rdoba (Colombia)\", \"C\\u00f3rdoba, Colombia (disambiguation)\", \"Cordoba, Mexico\", \"Cordoba, Colombia\", \"Cordoba (disambiguation)\", \"CORDOBA\", \"City of C\\u00f3rdoba\", \"C\\u00f3rdoba\", \"Corduba\"]", "[\"ASPEN\", \"American Society for Parenteral and Enteral Nutrition (A.S.P.E.N.)\", \"A.S.P.E.N.\", \"American Society of Parenteral and Enteral Nutrition\", \"American Society for Parenteral and Enteral Nutrition\", \"THE ASPEN\"]", "[\"Protect the Human\", \"Amnesty International UK\", \"Appeal for Amnesty, 1961\", \"International Amnesty\", \"International Secretariat of Amnesty International\", \"Appeal for Amnesty\", \"Amnesty international\", \"Amnesty.org\", \"Amnesty International\"]", "[\"Emperador Dark Marble\", \"Onion-stones\", \"Cipolin\", \"Marble (rock)\", \"White marble\", \"Onion-stone\", \"Coral Red Marble\", \"Wood Vein Marble\", \"Orange Marble\", \"Marbly\", \"Onion stones\", \"Onionstone\", \"Lucullan\", \"Brown Marble\", \"Marble\", \"Onion stone\", \"Marbliness\", \"Marble stone\", \"Onionstones\", \"Nero Marquina\", \"Tiger Skin Marble\", \"Lucullite\"]", "[\"A4202 road\", \"A4202\", \"PARK LANE\", \"Park Lane, Mayfair\", \"A4202 road (Great Britain)\", \"Park Lane\", \"Park Lane (road)\", \"Park Lane, London\"]", "[\"Derbys\", \"DERBYSHIRE\", \"County of Derby\", \"Derbyshire, England\", \"North Derbyshire\", \"Derbyshire\"]", "[\"Bridge Over Troubled Waters\", \"Bridge over Troubled Waters\", \"A Bridge over Troubled Water\", \"Bridge over troubled water\", \"Song for the asking\", \"Bridge over Troubled Water\", \"Why Don't You Write Me\", \"Bridge Over Troubled Water\", \"Bridge Over Troubled Water (album)\", \"'BRIDGE OVER TROUBLED WATERS'\"]", "[\"Joe Bugner\", \"Bugner\"]", "[\"Miesian\", \"LUDWIG MIES VAN DER ROHE\", \"Mies van der Rohe\", \"Ludwig Mies van der Rohe\", \"Ludwig Mies Van Der Rohe\", \"Mies Van der Rohe\", \"Van der Rohe\", \"Mies van de Rohe\", \"Van der rohe\", \"Mies Van De Rohe\", \"Maria Ludwig Michael Mies\", \"Mies Van Der Rohe\", \"Ludwig Mies Van der Rohe\", \"Mies van der rohe\"]", "[\"JIMMY CRICKET\", \"Jimmy Cricket\"]", "[\"Living Doll by Cliff Richard and The Young Ones\"]", "[\"Poundland\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Idragin\", \"Aspalon\", \"Baby aspirin\", \"Acetisal\", \"Aspirin\", \"Dolopirin\", \"Aspirine\", \"Junior aspirin\", \"Salacetin\", \"Acylpyrin\", \"8-Hour Bayer\", \"Rheumintabletten\", \"ATCvet code QB01AC06\", \"Acetylsalicylic Acid\", \"Contrheuma retard\", \"Saletin\", \"Endydol\", \"Asparin\", \"Extren\", \"Premaspin\", \"ZORprin\", \"Aspirdrops\", \"Bi-prin\", \"Novid\", \"Caprin\", \"Enterophen\", \"Dolean pH 8\", \"Magnyl\", \"Enterosarein\", \"Acetyl salicylic acid\", \"A.S.A. Empirin\", \"Solfrin\", \"Aceticyl\", \"Ecolen\", \"Rhodine\", \"Nu-seals\", \"Cemirit\", \"Yasta\", \"Entericin\", \"Salcetogen\", \"ATC code B01AC06\", \"Aspec\", \"Acetosal\", \"Asp\\u00e9gic\", \"Claradin\", \"Spira-Dine\", \"Genacote\", \"Triple-sal\", \"Acetonyl\", \"81mg\", \"Kardegic\", \"Colfarit\", \"2-Ethanoylbenzenecarboxylic acid\", \"Measurin\", \"Solprin\", \"Ecotrin\", \"Entrophen\", \"Temperal\", \"Acetylsalicyclic acid\", \"Bialpirina\", \"Rhonal\", \"Low dose aspirin\", \"Polopiryna\", \"Acetylsalicylic\", \"Fasprin\", \"8-hour Bayer\", \"Asteric\", \"Myoprin\", \"Asagran\", \"2-acetyloxybenzoic acid\", \"Acimetten\", \"Persistin\", \"Micristin\", \"Acisal\", \"Tasprin\", \"ATCvet code QN02BA01\", \"Nu-seals aspirin\", \"Bialpirinia\", \"Solprin acid\", \"Asatard\", \"Neuronika\", \"Levius\", \"Easprin\", \"ATCvet code QA01AD05\", \"Acetophen\", \"Solpyron\", \"Delgesic\", \"Ascoden-30\", \"ATC code A01AD05\", \"Acetosalin\", \"Bufferin\", \"Monoacetic acid ester of salicylic acid\", \"Acesal\", \"Adiro\", \"Aspirin allergy\", \"Benaspir\", \"Enterosarine\", \"Triaminicin\", \"Globentyl\", \"Halfprin\", \"Supac\", \"Sedergine\", \"Trombyl\", \"Empirin\", \"Calcium acetylsalicylate\", \"Acetylosalicylic acid\", \"Acetylsal\", \"Acetylsalicylic acid\", \"Acetylin\", \"Pirseal\", \"Acetylsalicylate\", \"Pharmacin\", \"ATC code N02BA01\", \"Acetyl salicilic acid\", \"Decaten\", \"Acenterine\", \"Clariprin\", \"Aspirin synthesis\"]", "[\"Chancellor Merkel\", \"Dr. Angela Dorothea Merkel\", \"Angela Dorothea Kasner\", \"Dorothea Kasner\", \"Ulrich Merkel\", \"Angela Kasner\", \"Angela Dorothea Merkel\", \"Angela Merkl\", \"Angela Teflon Merkel\", \"Merckel\", \"Angela Merkel\", \"Angie Merkel\", \"Merkel\", \"Angela Merkell\"]", "[\"Vi-Alpha\", \"Axerol\", \"Hi-A-Vita\", \"A-Sol\", \"Vitamin A supplementation\", \"Aquasol A Parenteral\", \"Sehkraft A\", \"Alcovit A\", \"Veroftal\", \"Lard Factor\", \"Vitavel A\", \"Myvpack\", \"Testavol\", \"Aquasynth\", \"Vaflol\", \"Asterol\", \"Anatola A\", \"A-Vi-Pel\", \"Biosterol\", \"Anatola\", \"A-Mulsal\", \"Agiolan\", \"List of foods containing Vitamin A\", \"M.V.C. 9+3\", \"Avitol\", \"Vio-A\", \"Solu-A\", \"Apostavit\", \"A-Vitan\", \"Axerophthol\", \"Bentavit A\", \"Atav\", \"Oleovitamin A\", \"Agoncal\", \"Cylasphere\", \"Vitpex\", \"TROL\", \"Mvc Plus\", \"Atars\", \"Alphasterol\", \"Apexol\", \"Thalasphere\", \"Nio-A-Let\", \"Vogan-nu\", \"Anti-Infective vitamin\", \"Dohyfral A\", \"M.V.I.-12\", \"Ro-a-vit\", \"Zineb 80\", \"Avibon\", \"Disatabs Tabs\", \"Retrovitamin A\", \"Ophthalamin\", \"Vi-a\", \"Vogan-Neu\", \"Del-VI-A\", \"Zinosan N\", \"Testavol S\", \"Super A\", \"Vitamin A\", \"Vi-Dom-A\", \"Vafol\", \"Epiteliol\", \"Vitamin a\", \"Plivit A\", \"Homagenets Aoral\", \"Dofsol\", \"Chocola A\", \"Homagenets aorl\", \"Prepalin\"]", "[\"C\\u00f3rdoba (disambiguation)\", \"C\\u00f3rdoba, Mexico\", \"Cordoba\", \"C\\u00f3rdoba, Mexico (disambiguation)\", \"C\\u00f3rdoba, Colombia\", \"C\\u00f3rdoba (Colombia)\", \"C\\u00f3rdoba, Colombia (disambiguation)\", \"Cordoba, Mexico\", \"Cordoba, Colombia\", \"Cordoba (disambiguation)\", \"CORDOBA\", \"City of C\\u00f3rdoba\", \"C\\u00f3rdoba\", \"Corduba\"]", "[\"ASPEN\", \"American Society for Parenteral and Enteral Nutrition (A.S.P.E.N.)\", \"A.S.P.E.N.\", \"American Society of Parenteral and Enteral Nutrition\", \"American Society for Parenteral and Enteral Nutrition\", \"THE ASPEN\"]", "[\"Protect the Human\", \"Amnesty International UK\", \"Appeal for Amnesty, 1961\", \"International Amnesty\", \"International Secretariat of Amnesty International\", \"Appeal for Amnesty\", \"Amnesty international\", \"Amnesty.org\", \"Amnesty International\"]", "[\"Emperador Dark Marble\", \"Onion-stones\", \"Cipolin\", \"Marble (rock)\", \"White marble\", \"Onion-stone\", \"Coral Red Marble\", \"Wood Vein Marble\", \"Orange Marble\", \"Marbly\", \"Onion stones\", \"Onionstone\", \"Lucullan\", \"Brown Marble\", \"Marble\", \"Onion stone\", \"Marbliness\", \"Marble stone\", \"Onionstones\", \"Nero Marquina\", \"Tiger Skin Marble\", \"Lucullite\"]", "[\"A4202 road\", \"A4202\", \"PARK LANE\", \"Park Lane, Mayfair\", \"A4202 road (Great Britain)\", \"Park Lane\", \"Park Lane (road)\", \"Park Lane, London\"]", "[\"Derbys\", \"DERBYSHIRE\", \"County of Derby\", \"Derbyshire, England\", \"North Derbyshire\", \"Derbyshire\"]", "[\"Bridge Over Troubled Waters\", \"Bridge over Troubled Waters\", \"A Bridge over Troubled Water\", \"Bridge over troubled water\", \"Song for the asking\", \"Bridge over Troubled Water\", \"Why Don't You Write Me\", \"Bridge Over Troubled Water\", \"Bridge Over Troubled Water (album)\", \"'BRIDGE OVER TROUBLED WATERS'\"]", "[\"Joe Bugner\", \"Bugner\"]", "[\"Miesian\", \"LUDWIG MIES VAN DER ROHE\", \"Mies van der Rohe\", \"Ludwig Mies van der Rohe\", \"Ludwig Mies Van Der Rohe\", \"Mies Van der Rohe\", \"Van der Rohe\", \"Mies van de Rohe\", \"Van der rohe\", \"Mies Van De Rohe\", \"Maria Ludwig Michael Mies\", \"Mies Van Der Rohe\", \"Ludwig Mies Van der Rohe\", \"Mies van der rohe\"]", "[\"JIMMY CRICKET\", \"Jimmy Cricket\"]", "[\"Living Doll by Cliff Richard and The Young Ones\"]", "[\"Poundland\"]" ]
[ "Acetylsalicylic acid is a commonly taken drug, what is its usual name?", "Which world figure is married to quantum chemist Joachim Sauer?", "Retinol is another name for which vitamin?", "Which Spanish city houses 'La Mezquita', and was the capital of Muslim Spain from 756 until its capture in 1236?", "Which tree is also known as the Trembling Poplar?", "Which charity has been supported by the comedy called The Secret Policeman's Balls?", "A stonemason commonly refers to unmetamorphosed limestone as what, whose name derives from Greek 'shining stone'?", "Which London thoroughfare runs between Hyde Park Corner and Marble Arch?", "The 'Derwent Valley Mills' is a World Heritage Site, in which English county?", "\"Identify the number one hit from its opening line, \"\"When you're weary, feeling small\"\"?\"", "Who succeeded Henry Cooper as British Heavyweight Boxing Champion?", "Which great modernist architect designed the Seagram Building in New York in collaboration with Philip Johnson?", "\"Which Irish comedian had the catchphrase \"\"and there's more\"\"?\"", "Before Red Nose Day there were two comic relief records. What was the first one called and who was it by?", "Which bargain retail chain of shops was started in 1990 by David Dodd and Stephen Smith" ]
15
[ 65820, 65821, 65822, 65823, 65824, 65825, 65826, 65827, 65828, 65829, 65830, 65831, 65832, 65833, 65834 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Who's missing: Jason, Mary Ellen, Erin, Ben, Jim-Bob, Elizabeth\nQuestion 2: The Mills bomb, developed in Birmingham in 1915, and produced in numbers exceeding 70 million since then, is more commonly known by what term?\nQuestion 3: ‘International ‘what’ is the official colour of the paint on the Golden Gate Bridge in California?\nQuestion 4: By population, what is the second largest city in Belgium?\nQuestion 5: By what name is the building 30 St Mary Axe in the City of London colloquially known?\nQuestion 6: Which traditional English county was historically divided into 'Rapes'?\nQuestion 7: Who wrote the 19th Century novel ‘Little Women’?\nQuestion 8: What colour is the dye made from woad?\nQuestion 9: In what type of aircraft did Alcock and Brown make the first non-stop transatlantic crossing?\nQuestion 10: Which company devised a walking robot called Asimo?\nQuestion 11: Visage is French for which part of the body?\nQuestion 12: The Order of the White Lion is an honour bestowed in which East European country?\nQuestion 13: Which North American State has the nickname The Peach State ?\nQuestion 14: In Hinduism what name is given to the festival of Colour or Colours?\nQuestion 15: In what country did papyrus originate?", "role": "user" } ]
["[\"Johnboy\", \"John-Boy\"]", "[\"Hand grenades\", \"Flying squirrel grenade\", \"Concussion grenade\", \"Sting grenade\", \"Incendiary grenade\", \"Concussion Grenade\", \"Frag Grenade\", \"Nade\", \"Gas grenade\", \"Grenade, France\", \"HE Grenade\", \"F-1 Antipersonnel Grenade\", \"Stiel Grenade\", \"Hand grenade\", \"Concussion Grenades\", \"Flaming grenade\", \"Impact detonation grenade\", \"Stinger grenade\", \"Grenado\", \"Hand grenads\", \"Grenade\", \"Hand-grenade throwing\", \"Stick grenade\", \"Fragmentation Grenade\", \"Hand Grenade\", \"Light bomb\", \"Bomba a Mano\", \"Handgrenade\", \"Hand gernade\", \"Grenades\", \"Fragmentation Grenades\", \"Stingball grenade\", \"Hand-grenade\"]", "[\"Orange (album)\", \"Orangeishness\", \"Orange (film)\", \"Orangishness\", \"Orangeishly\", \"Orangishly\", \"Orange\", \"Oranfe\", \"Orange (disambiguation)\"]", "[\"Antverpia\", \"Antwerpt\", \"Anvers\", \"Antwerpen\", \"ANTWERP\", \"UN/LOCODE:BEANR\", \"Antwerp\", \"Antwerp (city)\", \"Antwerp, Belgium\", \"Antwerpen (city)\", \"Antwerpish\", \"History of Antwerp\", \"Anversa\", \"Antverpian\", \"Anvers (city)\"]", "[\"30 St Mary Axe\", \"Crystal Phallus\", \"30 Saint Mary Axe\", \"The Swiss Re Tower\", \"Erotic Gherkin\", \"30 St. Mary Axe\", \"The Swiss Re Building\", \"Egg Building\", \"Swiss Re Tower\", \"Erotic gherkin\", \"The Gherkin (London)\", \"Towering Innuendo\", \"Swiss Re Building\", \"The Gherkin\", \"Gherkin (building)\", \"London gherkin\", \"Foster's Tower\"]", "[\"Sussex County Council\", \"Sussex, UK\", \"County of Sussex\", \"Sussex\", \"Sussex coast\", \"Sussex, England\", \"SUSSEX\", \"Sussex Coast\", \"East Sussex and West Sussex\", \"South Saxon\"]", "[\"Louisa Mary Alcott\", \"Louise Alcott\", \"Louisa Mae Alcott\", \"Luisa May Alcott\", \"L. M. Alcott\", \"Alcott, Louisa M\", \"Louisa May Alcott\", \"Louisa Alcott\", \"A. M. Barnard\", \"Alcott, Louisa May\", \"Louisa M. Alcott\", \"Louisa M Alcott\", \"L.M. Alcott\"]", "[\"Blue\", \"Rgb(0, 0, 255)\", \"Orphan blue\", \"Slate Blue (color)\", \"Bluishness\", \"Dark Blue (color)\", \"Pale Blue\", \"Blue in human culture\", \"Blue (color)\", \"Police car blue\", \"Blue (Colour)\", \"Blueishness\", \"List of terms associated with the color blue\", \"Caspian blue\", \"Blue (colour)\", \"Light-blue\", \"Bluest\", \"Bluish\", \"Bluishly\", \"(0, 0, 255)\", \"Blueishly\", \"Bluer\", \"Blae\", \"Blueness\"]", "[\"Vickers Vimy Commercial\", \"VICKERS VIMY\", \"A.N.F. 'Express Les Mureaux'\", \"Vickers FB.27 Vimy\", \"Vickers Vimy Ambulance\", \"Vickers F.B.27 Vimy\", \"Vickers Vimy\", \"Vickers Commercial\"]", "[\"Honda Technologies\", \"HONDA\", \"Honda atv\", \"Honda Motor Company, Limited\", \"Honda Clio\", \"Honda Soltec\", \"Honda (automobile)\", \"Honda Outboard\", \"Honda Motor Co.\", \"Honda Motor Company Limited\", \"Honda Corporation\", \"Honda Verno\", \"Honda\", \"Honda Group\", \"Honda motorcycle\", \"\\u672c\\u7530\", \"Soltec\", \"Honda Motor Co., Ltd.\", \"Hero honda passion plus\", \"Cbr 150\", \"Honda Motor Company Inc.\", \"Honda motorcycles\", \"Honda Motor Company\", \"Honda Motor Co. Ltd.\", \"Honda 300ex\", \"Honda CL145\", \"Honda Motorcycles\", \"Honda Primo\", \"Honda Motor Manufacturing\", \"Honda Werther\", \"Honda Motor\"]", "[\"Human Face\", \"Face\", \"Facial feature\", \"Faces\", \"Human faces\", \"Human face\"]", "[\"4esko\", \"Cesk\\u00e1 republika\", \"Czech Republic\", \"Tjech republic\", \"Republique Tcheque\", \"Czech Republik\", \"Cesk\\u00e1 Republika\", \"Czeck Republic\", \"ISO 3166-1:CZ\", \"The Czech Republic\", \"CZR\", \"R\\u00e9publique Tch\\u00e8que\", \"\\u010cesko\", \"Administrative divisions of the Czech Republic\", \"Czecho Republic\", \"Winnerland\", \"CZECH REPUBLIC\", \"Protestantism in the Czech Republic\", \"Tschechien\", \"Check Republic\", \"Czechia\", \"Czech Republci\", \"Etymology of the Czech Republic\", \"Cesko\", \"\\u010cesk\\u00e1 republika\", \"\\u010ce\\u0161ka\", \"Cech Republic\", \"Ceska Republic\", \"Czech Rep\", \"The Czeck Republic\", \"Ceska\", \"Ceska republika\", \"Chez republic\", \"Czec Republic\", \"Climate of the Czech Republic\", \"Csehorszag\", \"Tcheque Republique\", \"Republica Checa\", \"\\u010cesk\\u00e1 Republika\", \"Cehia\", \"Czech Rep.\", \"Czech republic\", \"Czechi\", \"Tcheque Republic\", \"Ceska Republika\", \"Tjech Republic\", \"\\u010cR\", \"Csehorsz\\u00e1g\", \"Rep\\u00fablica Checa\", \"Subdivisions of the Czech Republic\", \"Bohemia-Moravia\"]", "[\"Western Georgia\", \"Georgia (song)\", \"Georgia\", \"Georgia (Disambiguation)\", \"Georgia (film)\", \"Georgia (State)\", \"Geordia\", \"GEORGIA\", \"Georgia (disambiguation)\", \"Georgia (state)\", \"Goergia\"]", "[\"Holika dahan\", \"Rangapanchami\", \"Holli\", \"Phagwa\", \"Rangpanchami\", \"Dola Yatra\", \"Indian holi\", \"Pagwa (festival)\", \"Festival of Colors\", \"Dolyatra\", \"Holi-Phagwa\", \"Uthasini\", \"\\u0939\\u094b\\u0932\\u0940\", \"Holi\", \"Holi festival\", \"Hoolee\", \"Holi fire\", \"Festival of Colours\", \"Holi Festival\", \"Hindu Festival of Colors\", \"Basanta Utsab\", \"Phagwah\", \"Basanta Utsav\", \"Basanta-Utsab\"]", "[\"EGY\", \"Arab Republic of Egypt\", \"A .R . EGYPT\", \"The Arab Republic of Egypt\", \"Eygpt\", \"Etymology of Egypt\", \"\\u0645\\u0635\\u0631\", \"Kemmet\", \"Gift of the Nile\", \"Arab Republic Of Egypt\", \"Names of Egypt\", \"Mi\\u1e63r\", \"A .R . Egypt\", \"Eytp\", \"National identity of Egyptians\", \"Jumhuriyat Misr al'Arabiyah\", \"Eypt\", \"Egyptian Republic\", \"Ejipt\", \"Name of Egypt\", \"Egipto\", \"Kimet\", \"\\u062c\\u0645\\u0647\\u0648\\u0631\\u064a\\u0651\\u0629 \\u0645\\u0635\\u0631\\u0627\\u0644\\u0639\\u0631\\u0628\\u064a\\u0651\\u0629\", \"Egypte\", \"Egypt (name)\", \"Egypt\", \"\\u062c\\u0645\\u0647\\u0648\\u0631\\u064a\\u0629 \\u0645\\u0635\\u0631\\u0627\\u0644\\u0639\\u0631\\u0628\\u064a\\u0629\", \"A.R. Egypt\", \"Republic of Eygpt\", \"\\u00c9gypte\", \"Second Egyptian Republic\", \"Egipt\", \"ISO 3166-1:EG\", \"Egypt info\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Johnboy\", \"John-Boy\"]", "[\"Hand grenades\", \"Flying squirrel grenade\", \"Concussion grenade\", \"Sting grenade\", \"Incendiary grenade\", \"Concussion Grenade\", \"Frag Grenade\", \"Nade\", \"Gas grenade\", \"Grenade, France\", \"HE Grenade\", \"F-1 Antipersonnel Grenade\", \"Stiel Grenade\", \"Hand grenade\", \"Concussion Grenades\", \"Flaming grenade\", \"Impact detonation grenade\", \"Stinger grenade\", \"Grenado\", \"Hand grenads\", \"Grenade\", \"Hand-grenade throwing\", \"Stick grenade\", \"Fragmentation Grenade\", \"Hand Grenade\", \"Light bomb\", \"Bomba a Mano\", \"Handgrenade\", \"Hand gernade\", \"Grenades\", \"Fragmentation Grenades\", \"Stingball grenade\", \"Hand-grenade\"]", "[\"Orange (album)\", \"Orangeishness\", \"Orange (film)\", \"Orangishness\", \"Orangeishly\", \"Orangishly\", \"Orange\", \"Oranfe\", \"Orange (disambiguation)\"]", "[\"Antverpia\", \"Antwerpt\", \"Anvers\", \"Antwerpen\", \"ANTWERP\", \"UN/LOCODE:BEANR\", \"Antwerp\", \"Antwerp (city)\", \"Antwerp, Belgium\", \"Antwerpen (city)\", \"Antwerpish\", \"History of Antwerp\", \"Anversa\", \"Antverpian\", \"Anvers (city)\"]", "[\"30 St Mary Axe\", \"Crystal Phallus\", \"30 Saint Mary Axe\", \"The Swiss Re Tower\", \"Erotic Gherkin\", \"30 St. Mary Axe\", \"The Swiss Re Building\", \"Egg Building\", \"Swiss Re Tower\", \"Erotic gherkin\", \"The Gherkin (London)\", \"Towering Innuendo\", \"Swiss Re Building\", \"The Gherkin\", \"Gherkin (building)\", \"London gherkin\", \"Foster's Tower\"]", "[\"Sussex County Council\", \"Sussex, UK\", \"County of Sussex\", \"Sussex\", \"Sussex coast\", \"Sussex, England\", \"SUSSEX\", \"Sussex Coast\", \"East Sussex and West Sussex\", \"South Saxon\"]", "[\"Louisa Mary Alcott\", \"Louise Alcott\", \"Louisa Mae Alcott\", \"Luisa May Alcott\", \"L. M. Alcott\", \"Alcott, Louisa M\", \"Louisa May Alcott\", \"Louisa Alcott\", \"A. M. Barnard\", \"Alcott, Louisa May\", \"Louisa M. Alcott\", \"Louisa M Alcott\", \"L.M. Alcott\"]", "[\"Blue\", \"Rgb(0, 0, 255)\", \"Orphan blue\", \"Slate Blue (color)\", \"Bluishness\", \"Dark Blue (color)\", \"Pale Blue\", \"Blue in human culture\", \"Blue (color)\", \"Police car blue\", \"Blue (Colour)\", \"Blueishness\", \"List of terms associated with the color blue\", \"Caspian blue\", \"Blue (colour)\", \"Light-blue\", \"Bluest\", \"Bluish\", \"Bluishly\", \"(0, 0, 255)\", \"Blueishly\", \"Bluer\", \"Blae\", \"Blueness\"]", "[\"Vickers Vimy Commercial\", \"VICKERS VIMY\", \"A.N.F. 'Express Les Mureaux'\", \"Vickers FB.27 Vimy\", \"Vickers Vimy Ambulance\", \"Vickers F.B.27 Vimy\", \"Vickers Vimy\", \"Vickers Commercial\"]", "[\"Honda Technologies\", \"HONDA\", \"Honda atv\", \"Honda Motor Company, Limited\", \"Honda Clio\", \"Honda Soltec\", \"Honda (automobile)\", \"Honda Outboard\", \"Honda Motor Co.\", \"Honda Motor Company Limited\", \"Honda Corporation\", \"Honda Verno\", \"Honda\", \"Honda Group\", \"Honda motorcycle\", \"\\u672c\\u7530\", \"Soltec\", \"Honda Motor Co., Ltd.\", \"Hero honda passion plus\", \"Cbr 150\", \"Honda Motor Company Inc.\", \"Honda motorcycles\", \"Honda Motor Company\", \"Honda Motor Co. Ltd.\", \"Honda 300ex\", \"Honda CL145\", \"Honda Motorcycles\", \"Honda Primo\", \"Honda Motor Manufacturing\", \"Honda Werther\", \"Honda Motor\"]", "[\"Human Face\", \"Face\", \"Facial feature\", \"Faces\", \"Human faces\", \"Human face\"]", "[\"4esko\", \"Cesk\\u00e1 republika\", \"Czech Republic\", \"Tjech republic\", \"Republique Tcheque\", \"Czech Republik\", \"Cesk\\u00e1 Republika\", \"Czeck Republic\", \"ISO 3166-1:CZ\", \"The Czech Republic\", \"CZR\", \"R\\u00e9publique Tch\\u00e8que\", \"\\u010cesko\", \"Administrative divisions of the Czech Republic\", \"Czecho Republic\", \"Winnerland\", \"CZECH REPUBLIC\", \"Protestantism in the Czech Republic\", \"Tschechien\", \"Check Republic\", \"Czechia\", \"Czech Republci\", \"Etymology of the Czech Republic\", \"Cesko\", \"\\u010cesk\\u00e1 republika\", \"\\u010ce\\u0161ka\", \"Cech Republic\", \"Ceska Republic\", \"Czech Rep\", \"The Czeck Republic\", \"Ceska\", \"Ceska republika\", \"Chez republic\", \"Czec Republic\", \"Climate of the Czech Republic\", \"Csehorszag\", \"Tcheque Republique\", \"Republica Checa\", \"\\u010cesk\\u00e1 Republika\", \"Cehia\", \"Czech Rep.\", \"Czech republic\", \"Czechi\", \"Tcheque Republic\", \"Ceska Republika\", \"Tjech Republic\", \"\\u010cR\", \"Csehorsz\\u00e1g\", \"Rep\\u00fablica Checa\", \"Subdivisions of the Czech Republic\", \"Bohemia-Moravia\"]", "[\"Western Georgia\", \"Georgia (song)\", \"Georgia\", \"Georgia (Disambiguation)\", \"Georgia (film)\", \"Georgia (State)\", \"Geordia\", \"GEORGIA\", \"Georgia (disambiguation)\", \"Georgia (state)\", \"Goergia\"]", "[\"Holika dahan\", \"Rangapanchami\", \"Holli\", \"Phagwa\", \"Rangpanchami\", \"Dola Yatra\", \"Indian holi\", \"Pagwa (festival)\", \"Festival of Colors\", \"Dolyatra\", \"Holi-Phagwa\", \"Uthasini\", \"\\u0939\\u094b\\u0932\\u0940\", \"Holi\", \"Holi festival\", \"Hoolee\", \"Holi fire\", \"Festival of Colours\", \"Holi Festival\", \"Hindu Festival of Colors\", \"Basanta Utsab\", \"Phagwah\", \"Basanta Utsav\", \"Basanta-Utsab\"]", "[\"EGY\", \"Arab Republic of Egypt\", \"A .R . EGYPT\", \"The Arab Republic of Egypt\", \"Eygpt\", \"Etymology of Egypt\", \"\\u0645\\u0635\\u0631\", \"Kemmet\", \"Gift of the Nile\", \"Arab Republic Of Egypt\", \"Names of Egypt\", \"Mi\\u1e63r\", \"A .R . Egypt\", \"Eytp\", \"National identity of Egyptians\", \"Jumhuriyat Misr al'Arabiyah\", \"Eypt\", \"Egyptian Republic\", \"Ejipt\", \"Name of Egypt\", \"Egipto\", \"Kimet\", \"\\u062c\\u0645\\u0647\\u0648\\u0631\\u064a\\u0651\\u0629 \\u0645\\u0635\\u0631\\u0627\\u0644\\u0639\\u0631\\u0628\\u064a\\u0651\\u0629\", \"Egypte\", \"Egypt (name)\", \"Egypt\", \"\\u062c\\u0645\\u0647\\u0648\\u0631\\u064a\\u0629 \\u0645\\u0635\\u0631\\u0627\\u0644\\u0639\\u0631\\u0628\\u064a\\u0629\", \"A.R. Egypt\", \"Republic of Eygpt\", \"\\u00c9gypte\", \"Second Egyptian Republic\", \"Egipt\", \"ISO 3166-1:EG\", \"Egypt info\"]" ]
[ "Who's missing: Jason, Mary Ellen, Erin, Ben, Jim-Bob, Elizabeth", "The Mills bomb, developed in Birmingham in 1915, and produced in numbers exceeding 70 million since then, is more commonly known by what term?", "‘International ‘what’ is the official colour of the paint on the Golden Gate Bridge in California?", "By population, what is the second largest city in Belgium?", "By what name is the building 30 St Mary Axe in the City of London colloquially known?", "Which traditional English county was historically divided into 'Rapes'?", "Who wrote the 19th Century novel ‘Little Women’?", "What colour is the dye made from woad?", "In what type of aircraft did Alcock and Brown make the first non-stop transatlantic crossing?", "Which company devised a walking robot called Asimo?", "Visage is French for which part of the body?", "The Order of the White Lion is an honour bestowed in which East European country?", "Which North American State has the nickname The Peach State ?", "In Hinduism what name is given to the festival of Colour or Colours?", "In what country did papyrus originate?" ]
15
[ 74115, 74116, 74117, 74118, 74119, 74120, 74121, 74122, 74123, 74124, 74125, 74126, 74127, 74128, 74129 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: A project led by broadcaster NHK and Tobu Railway Co, which city's 'Skytree' opened as the world's tallest self-supporting tower and 2nd largest building in 2012?\nQuestion 2: Alnwick Castle, Northumberland UK, featured in a popular movie franchise as which institution?\nQuestion 3: Extraversion/introversion, Conscientiousness, Agreeableness, Neuroticism, and Openness to experience and are the 'Big Five' dimensions of what popular acronymically-named personality analysis theory?\nQuestion 4: What does the prefix 'cry' mean in words such as cryogenics?\nQuestion 5: Which instrument did Glen Miller play?\nQuestion 6: What does a mahout keep or ride?\nQuestion 7: When was critical illness, or trauma, insurance first launched?\nQuestion 8: Who won Best Actress Oscar for the film “The Coalminer’s Daughter “ ?\nQuestion 9: What is the medical name for German measles?\nQuestion 10: Which part of a church building, situated near the altar, is reserved for the clergy and choir, and is typically separated from the nave by steps or a screen?\nQuestion 11: Archery was included in the Olympic Games in 1900, 1904, 1908, and 1920, and every time since 1972. Which country has won the most gold medals?\nQuestion 12: What is the name of Captain Jack Aubrey’s ship in the 2003 film ‘Master and Commander: the Far Side of the World’?\nQuestion 13: Who was manager of Melchester Rovers when Roy Race joined the club?\nQuestion 14: Who was the first Republican to be President of the USA?\nQuestion 15: Which hugely popular actor was born on Christmas day 1899?", "role": "user" } ]
["[\"\\u6771\\u4eac\\u90fd\", \"Economy of Tokyo\", \"Demographics of Tokyo\", \"\\u6771\\u4eac\", \"T\\u00f5ky\\u00f5\", \"Oyata\", \"UN/LOCODE:JPTYO\", \"Toukyo\", \"T\\u014dky\\u014d, Japan\", \"T\\u014dkyo\", \"JP-13\", \"T\\u014dky\\u014d Met.\", \"Tokyo Metropolitan Prefecture\", \"To-kyo\", \"Tokio Metropolis\", \"T\\u00f4ki\\u00f4\", \"Oyata, Tokyo\", \"Tohkyoh\", \"Economy of tokyo\", \"Toukyou-to\", \"T\\u00f3kio\", \"Tokyo\", \"Toky\", \"To Kyo\", \"T\\u014dky\\u014d Prefecture\", \"T\\u014dky\\u014d-to\", \"Tokyo (Japan)\", \"T\\u014dky\\u014d, JP-13\", \"T\\u00f4ky\\u00f4 Prefecture\", \"T\\u00f4ky\\u00f4, Japan\", \"D\\u014dngj\\u012bng (Japan)\", \"Outlying islands of Tokyo\", \"Toukyou\", \"Toyko, Japan\", \"TOKYO\", \"T\\u014dkei\", \"Tokyo Met.\", \"T\\u00f4ky\\u00f4\", \"Tokeo\", \"Tokei\", \"Tokyo-To\", \"Tokyo Plain\", \"Kudanzaka\", \"Toukiou\", \"Tokyo, Tokyo\", \"To kyo\", \"Tookioo\", \"Metropolitan Tokyo\", \"Tokyo, Japan\", \"ToKyo\", \"Toquio\", \"Toyko\", \"Tookyoo\", \"To-Kyo\", \"Tokyoh\", \"T\\u014dky\\u014d Metropolis\", \"Tokyo Administrative District\", \"T\\u00f5ki\\u00f5\", \"Tokyo in pop culture\", \"Tokyo,Japan\", \"Tokyo City and Prefecture\", \"T\\u014dky\\u014d\", \"Tokyoto\"]", "[\"The Chamber of Secrets\", \"Hogwarts quidditch teams\", \"N.E.W.T.\", \"Hogwarts School of Witchcraft and Wizardry\", \"Hogwart's House System\", \"Hogwarts House Points\", \"Hogwart's School of Witchcraft And Wizardry\", \"The Hogwarts Express\", \"Hogwarts School\", \"NEWTS\", \"Howgarts\", \"O.W.L.\", \"Hogwarts School of Witchcraft and Wizardery\", \"Chamber of the Silent\", \"Hogwarts School for Witchcraft and Wizardry\", \"Hogwarts Castle\", \"Ravenclaw\", \"Chamber of Secrets\", \"Gryffindor\", \"Hufflepuff\", \"Locations in Hogwarts\", \"Founders of Hogwarts\", \"O.W.L.s\", \"Hogwarts\", \"NEWT\", \"Hogwarts layout\", \"Chamber of secrets\", \"Hogwarts houses\", \"Battle of hogwarts\", \"Griphindor\", \"Slitherin\", \"Ordinary Wizarding Levels\", \"Hogwarts school\", \"Owlery\", \"Hogwarts High School\", \"Ordinary Wizarding Level\", \"Hogwarts School Of Witchcraft And Wizardry\", \"Nastily Exhausting Wizarding Test\", \"The chamber of secrets\", \"Rowana ravenclaw\", \"Hogwarts Floor Directory\", \"Hogwarts Houses\", \"Hogwards\", \"List of Hogwarts Quidditch Teams\", \"Hogwarts Express\", \"Griffindor\", \"Hogwart's\", \"Room of Requirement\", \"Slytherin\", \"Hogwarts castle\"]", "[\"Big Five personality traits\", \"Five factor model\", \"\\u2018Five Factor\\u2019 personality test\", \"OCEAN model\", \"Big Five Personality Traits\", \"Five Factor Personality Test\", \"Five factor inventory\", \"Big Five model of personality\", \"Big Five personality\", \"OCEAN\", \"Big Five factors\", \"The Big Five personality traits\", \"Big Five Inventory\", \"OCEAN model of personality\", \"Big Five test\", \"Big five personality traits\", \"Big Five personality factors\", \"Five Factor Model\", \"%22Big Five%22 factors\", \"Big Five model\"]", "[\"Coolth\", \"Cold\", \"Algid\", \"Low environmental temperature\", \"Coldest\"]", "[\"Harmonic glissando\", \"Zugposaune\", \"Trombone (instrument)\", \"Inverted glissando\", \"False glissando\", \"Trombone slide\", \"Trombones\", \"Trombonist\", \"Trombone position\", \"Trombone smear\", \"Slide trombone\", \"Posaune\", \"Trombone\", \"Broken glissando\", \"Slide position\", \"Valve trombonist\", \"The Trombone\", \"Tromboner\"]", "[\"Elephant (disambiguation)\", \"The Elephant\", \"Elephant (film)\", \"An elephant\", \"Elephant (song)\", \"L'Elephant\"]", "[\"1983\", \"one thousand, nine hundred and eighty-three\"]", "[\"Mary Elizabeth Spacek\", \"Sissy Spacek\"]", "[\"Rubella\", \"Epidemic roseola\", \"Three-day measles\", \"Rose measles\", \"German Measles\", \"\\u05d0\\u05d3\\u05de\\u05ea\", \"Rubella, congenital syndrome\", \"German measles virus\", \"Rose-rash\", \"Liberty measles\", \"German measles\"]", "[\"THE CHANCEL\", \"Chancels\", \"Chancel arch\", \"Presbytery (architecture)\", \"Chancel\"]", "[\"Nam Chosun\", \"Korea, Republic Of\", \"So. Korea\", \"ISO 3166-1:KR\", \"R.O.K.\", \"Korea, Republic of\", \"Korea, South\", \"Daehan Minguk\", \"Republic Of Korea\", \"S. Korea\", \"R. Korea\", \"South Kroea\", \"South korea\", \"Republican Korea\", \"Korea (R.O.K.)\", \"The republic of korea\", \"Korea South\", \"ROK\", \"Daehanminkook\", \"\\ub0a8\\ud55c\", \"South Korea/Economy\", \"Daehanmingook\", \"Korea (South)\", \"Korea Republic\", \"SKorea\", \"S Korea\", \"\\u97d3\\u570b\", \"South-korea\", \"Republican Corea\", \"Republic of KOREA\", \"Corea Republic\", \"Daehanminkuk\", \"Korea (Republic of)\", \"Republic of korea\", \"Korea (ROK)\", \"South Koreans\", \"Free Korea\", \"Daehanminguk\", \"\\ub300\\ud55c\\ubbfc\\uad6d\", \"South Corea\", \"Modern Corea\", \"South corea\", \"Taehan-min'guk\", \"S.Korea\", \"\\u5927\\u97d3\\u6c11\\u570b\", \"South-Korea\", \"Republic of Corea\", \"S. Koreans\", \"S. Korean\", \"South Korean\", \"Korea (Seoul)\", \"Namjoseon\", \"Republic of Korea\", \"Korea, S\", \"Korean Republic\", \"Republic of South Korea\", \"South Korea\", \"\\ud55c\\uad6d\", \"Corean Republic\"]", "[\"HMS Surprize\", \"Surprise (ship)\", \"Hms Surprise\", \"HMS Surprise\", \"HMS Surprise (Ship)\", \"HMS Surprise (ship)\"]", "[\"Meredith Lovechild\", \"Chris Jacobs (Family Affairs)\", \"Siobhan Langley\", \"Sami Shafiq\", \"Cat Webb\", \"Max Derwin\", \"Ania Williams\", \"Declan Byrne\", \"Geri Evans\", \"Adam Sheldrake\", \"Hector Price\", \"Max Lawson\", \"Elsa Gates\", \"Amir Sadati\", \"Denise Boulter\", \"Clive Starr\", \"Barbara Fletcher\", \"Annie Hart\", \"Myra Costello\", \"Johnny Palmer (Family Affairs)\", \"Melanie Farmer\", \"Joan Shackleford\", \"Liam Trip\", \"Diane Short\", \"Daniel Renshaw\", \"Eve O'Brien\", \"Linda Renshaw\", \"Jude Davenport\", \"Anne Gregory\", \"Vince Farmer\", \"Pamela Hargreaves\", \"Caleb Andrews\", \"Fern Farmer\", \"Chrissy Costello\", \"List of Family Affairs characters\", \"Dusty McHugh\", \"Gemma Craig\", \"Babs Woods\", \"Jack Gates\", \"Dudley Starr\", \"Sally Hart\", \"Lucy Day\", \"Susie Ross\", \"Pete Callan\", \"Jamie Hart (Family Affairs)\", \"Rosa Marshall\", \"Holly Hart\", \"Maria Simons\", \"Jessica Davenport (Family Affairs)\", \"Tanya Ayuba\", \"Chloe Costello\", \"Ginny Davenport\", \"George Fitzgerald (Family Affairs)\", \"Gavin Arnold\", \"Anna Gregory\", \"Melanie Hart\", \"Hester Randall\", \"Kelly Hurst\", \"Duncan Hart\", \"Darren Scott (Family Affairs)\", \"Alex Renshaw\", \"Gabby Johnson\", \"Graham Harker\", \"Pearl McHugh\", \"Coral Wilding\", \"Arlo Dean\", \"Chris Hart (Family Affairs)\", \"Ziggy Pascal\", \"Angus Hart\", \"Sharon Ingram\", \"Robert Davenport (Family Affairs)\", \"George Shackleford\", \"Sam Hart\", \"Ben Galloway\", \"Brendan Boulter\", \"Claire Toomey\", \"Gabriel Drummond\", \"Sean Steel\", \"Cheryl Barker (Family Affairs)\", \"Siobhan Jones\", \"Tom Shackleford\"]", "[\"Abaraham lincoln\", \"Abe licnoln\", \"President Lincoln\", \"Abe Lincon\", \"A Lincoln\", \"Lincoln (president)\", \"President Abraham\", \"President Abraham Lincoln\", \"Abraham (president)\", \"The Rail Splitter\", \"Abe Lincoln\", \"Honest Abe\", \"Lincoln's cabinet\", \"Lincoln, Abraham\", \"Abraham Lincon\", \"Abraham Lincoln\", \"Abraham Lincoln and the American Civil War\", \"Great Emancipator\", \"Aberham lincoln\", \"Abraham Lincoln (president)\", \"Lincolnian\", \"President Abe Lincoln\", \"Honest Abe Lincoln\", \"Abraham lincoln\", \"A. Lincoln\", \"Presedent Lincon\", \"Abrahm Lincoln\", \"Abraham Lincoln's Life\", \"Abe lincolin\", \"Abaham lincoln\", \"The Great Emancipator\", \"16th President of the United States\"]", "[\"Humphrey boggart\", \"Stephen Bogart\", \"Humphrey bogart\", \"Humphry Bogart\", \"Humphrey DeForest Bogart\", \"Tennis anyone\", \"Bogart\", \"Humphrey Bogart\", \"Humprey Bogart\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"\\u6771\\u4eac\\u90fd\", \"Economy of Tokyo\", \"Demographics of Tokyo\", \"\\u6771\\u4eac\", \"T\\u00f5ky\\u00f5\", \"Oyata\", \"UN/LOCODE:JPTYO\", \"Toukyo\", \"T\\u014dky\\u014d, Japan\", \"T\\u014dkyo\", \"JP-13\", \"T\\u014dky\\u014d Met.\", \"Tokyo Metropolitan Prefecture\", \"To-kyo\", \"Tokio Metropolis\", \"T\\u00f4ki\\u00f4\", \"Oyata, Tokyo\", \"Tohkyoh\", \"Economy of tokyo\", \"Toukyou-to\", \"T\\u00f3kio\", \"Tokyo\", \"Toky\", \"To Kyo\", \"T\\u014dky\\u014d Prefecture\", \"T\\u014dky\\u014d-to\", \"Tokyo (Japan)\", \"T\\u014dky\\u014d, JP-13\", \"T\\u00f4ky\\u00f4 Prefecture\", \"T\\u00f4ky\\u00f4, Japan\", \"D\\u014dngj\\u012bng (Japan)\", \"Outlying islands of Tokyo\", \"Toukyou\", \"Toyko, Japan\", \"TOKYO\", \"T\\u014dkei\", \"Tokyo Met.\", \"T\\u00f4ky\\u00f4\", \"Tokeo\", \"Tokei\", \"Tokyo-To\", \"Tokyo Plain\", \"Kudanzaka\", \"Toukiou\", \"Tokyo, Tokyo\", \"To kyo\", \"Tookioo\", \"Metropolitan Tokyo\", \"Tokyo, Japan\", \"ToKyo\", \"Toquio\", \"Toyko\", \"Tookyoo\", \"To-Kyo\", \"Tokyoh\", \"T\\u014dky\\u014d Metropolis\", \"Tokyo Administrative District\", \"T\\u00f5ki\\u00f5\", \"Tokyo in pop culture\", \"Tokyo,Japan\", \"Tokyo City and Prefecture\", \"T\\u014dky\\u014d\", \"Tokyoto\"]", "[\"The Chamber of Secrets\", \"Hogwarts quidditch teams\", \"N.E.W.T.\", \"Hogwarts School of Witchcraft and Wizardry\", \"Hogwart's House System\", \"Hogwarts House Points\", \"Hogwart's School of Witchcraft And Wizardry\", \"The Hogwarts Express\", \"Hogwarts School\", \"NEWTS\", \"Howgarts\", \"O.W.L.\", \"Hogwarts School of Witchcraft and Wizardery\", \"Chamber of the Silent\", \"Hogwarts School for Witchcraft and Wizardry\", \"Hogwarts Castle\", \"Ravenclaw\", \"Chamber of Secrets\", \"Gryffindor\", \"Hufflepuff\", \"Locations in Hogwarts\", \"Founders of Hogwarts\", \"O.W.L.s\", \"Hogwarts\", \"NEWT\", \"Hogwarts layout\", \"Chamber of secrets\", \"Hogwarts houses\", \"Battle of hogwarts\", \"Griphindor\", \"Slitherin\", \"Ordinary Wizarding Levels\", \"Hogwarts school\", \"Owlery\", \"Hogwarts High School\", \"Ordinary Wizarding Level\", \"Hogwarts School Of Witchcraft And Wizardry\", \"Nastily Exhausting Wizarding Test\", \"The chamber of secrets\", \"Rowana ravenclaw\", \"Hogwarts Floor Directory\", \"Hogwarts Houses\", \"Hogwards\", \"List of Hogwarts Quidditch Teams\", \"Hogwarts Express\", \"Griffindor\", \"Hogwart's\", \"Room of Requirement\", \"Slytherin\", \"Hogwarts castle\"]", "[\"Big Five personality traits\", \"Five factor model\", \"\\u2018Five Factor\\u2019 personality test\", \"OCEAN model\", \"Big Five Personality Traits\", \"Five Factor Personality Test\", \"Five factor inventory\", \"Big Five model of personality\", \"Big Five personality\", \"OCEAN\", \"Big Five factors\", \"The Big Five personality traits\", \"Big Five Inventory\", \"OCEAN model of personality\", \"Big Five test\", \"Big five personality traits\", \"Big Five personality factors\", \"Five Factor Model\", \"%22Big Five%22 factors\", \"Big Five model\"]", "[\"Coolth\", \"Cold\", \"Algid\", \"Low environmental temperature\", \"Coldest\"]", "[\"Harmonic glissando\", \"Zugposaune\", \"Trombone (instrument)\", \"Inverted glissando\", \"False glissando\", \"Trombone slide\", \"Trombones\", \"Trombonist\", \"Trombone position\", \"Trombone smear\", \"Slide trombone\", \"Posaune\", \"Trombone\", \"Broken glissando\", \"Slide position\", \"Valve trombonist\", \"The Trombone\", \"Tromboner\"]", "[\"Elephant (disambiguation)\", \"The Elephant\", \"Elephant (film)\", \"An elephant\", \"Elephant (song)\", \"L'Elephant\"]", "[\"1983\", \"one thousand, nine hundred and eighty-three\"]", "[\"Mary Elizabeth Spacek\", \"Sissy Spacek\"]", "[\"Rubella\", \"Epidemic roseola\", \"Three-day measles\", \"Rose measles\", \"German Measles\", \"\\u05d0\\u05d3\\u05de\\u05ea\", \"Rubella, congenital syndrome\", \"German measles virus\", \"Rose-rash\", \"Liberty measles\", \"German measles\"]", "[\"THE CHANCEL\", \"Chancels\", \"Chancel arch\", \"Presbytery (architecture)\", \"Chancel\"]", "[\"Nam Chosun\", \"Korea, Republic Of\", \"So. Korea\", \"ISO 3166-1:KR\", \"R.O.K.\", \"Korea, Republic of\", \"Korea, South\", \"Daehan Minguk\", \"Republic Of Korea\", \"S. Korea\", \"R. Korea\", \"South Kroea\", \"South korea\", \"Republican Korea\", \"Korea (R.O.K.)\", \"The republic of korea\", \"Korea South\", \"ROK\", \"Daehanminkook\", \"\\ub0a8\\ud55c\", \"South Korea/Economy\", \"Daehanmingook\", \"Korea (South)\", \"Korea Republic\", \"SKorea\", \"S Korea\", \"\\u97d3\\u570b\", \"South-korea\", \"Republican Corea\", \"Republic of KOREA\", \"Corea Republic\", \"Daehanminkuk\", \"Korea (Republic of)\", \"Republic of korea\", \"Korea (ROK)\", \"South Koreans\", \"Free Korea\", \"Daehanminguk\", \"\\ub300\\ud55c\\ubbfc\\uad6d\", \"South Corea\", \"Modern Corea\", \"South corea\", \"Taehan-min'guk\", \"S.Korea\", \"\\u5927\\u97d3\\u6c11\\u570b\", \"South-Korea\", \"Republic of Corea\", \"S. Koreans\", \"S. Korean\", \"South Korean\", \"Korea (Seoul)\", \"Namjoseon\", \"Republic of Korea\", \"Korea, S\", \"Korean Republic\", \"Republic of South Korea\", \"South Korea\", \"\\ud55c\\uad6d\", \"Corean Republic\"]", "[\"HMS Surprize\", \"Surprise (ship)\", \"Hms Surprise\", \"HMS Surprise\", \"HMS Surprise (Ship)\", \"HMS Surprise (ship)\"]", "[\"Meredith Lovechild\", \"Chris Jacobs (Family Affairs)\", \"Siobhan Langley\", \"Sami Shafiq\", \"Cat Webb\", \"Max Derwin\", \"Ania Williams\", \"Declan Byrne\", \"Geri Evans\", \"Adam Sheldrake\", \"Hector Price\", \"Max Lawson\", \"Elsa Gates\", \"Amir Sadati\", \"Denise Boulter\", \"Clive Starr\", \"Barbara Fletcher\", \"Annie Hart\", \"Myra Costello\", \"Johnny Palmer (Family Affairs)\", \"Melanie Farmer\", \"Joan Shackleford\", \"Liam Trip\", \"Diane Short\", \"Daniel Renshaw\", \"Eve O'Brien\", \"Linda Renshaw\", \"Jude Davenport\", \"Anne Gregory\", \"Vince Farmer\", \"Pamela Hargreaves\", \"Caleb Andrews\", \"Fern Farmer\", \"Chrissy Costello\", \"List of Family Affairs characters\", \"Dusty McHugh\", \"Gemma Craig\", \"Babs Woods\", \"Jack Gates\", \"Dudley Starr\", \"Sally Hart\", \"Lucy Day\", \"Susie Ross\", \"Pete Callan\", \"Jamie Hart (Family Affairs)\", \"Rosa Marshall\", \"Holly Hart\", \"Maria Simons\", \"Jessica Davenport (Family Affairs)\", \"Tanya Ayuba\", \"Chloe Costello\", \"Ginny Davenport\", \"George Fitzgerald (Family Affairs)\", \"Gavin Arnold\", \"Anna Gregory\", \"Melanie Hart\", \"Hester Randall\", \"Kelly Hurst\", \"Duncan Hart\", \"Darren Scott (Family Affairs)\", \"Alex Renshaw\", \"Gabby Johnson\", \"Graham Harker\", \"Pearl McHugh\", \"Coral Wilding\", \"Arlo Dean\", \"Chris Hart (Family Affairs)\", \"Ziggy Pascal\", \"Angus Hart\", \"Sharon Ingram\", \"Robert Davenport (Family Affairs)\", \"George Shackleford\", \"Sam Hart\", \"Ben Galloway\", \"Brendan Boulter\", \"Claire Toomey\", \"Gabriel Drummond\", \"Sean Steel\", \"Cheryl Barker (Family Affairs)\", \"Siobhan Jones\", \"Tom Shackleford\"]", "[\"Abaraham lincoln\", \"Abe licnoln\", \"President Lincoln\", \"Abe Lincon\", \"A Lincoln\", \"Lincoln (president)\", \"President Abraham\", \"President Abraham Lincoln\", \"Abraham (president)\", \"The Rail Splitter\", \"Abe Lincoln\", \"Honest Abe\", \"Lincoln's cabinet\", \"Lincoln, Abraham\", \"Abraham Lincon\", \"Abraham Lincoln\", \"Abraham Lincoln and the American Civil War\", \"Great Emancipator\", \"Aberham lincoln\", \"Abraham Lincoln (president)\", \"Lincolnian\", \"President Abe Lincoln\", \"Honest Abe Lincoln\", \"Abraham lincoln\", \"A. Lincoln\", \"Presedent Lincon\", \"Abrahm Lincoln\", \"Abraham Lincoln's Life\", \"Abe lincolin\", \"Abaham lincoln\", \"The Great Emancipator\", \"16th President of the United States\"]", "[\"Humphrey boggart\", \"Stephen Bogart\", \"Humphrey bogart\", \"Humphry Bogart\", \"Humphrey DeForest Bogart\", \"Tennis anyone\", \"Bogart\", \"Humphrey Bogart\", \"Humprey Bogart\"]" ]
[ "A project led by broadcaster NHK and Tobu Railway Co, which city's 'Skytree' opened as the world's tallest self-supporting tower and 2nd largest building in 2012?", "Alnwick Castle, Northumberland UK, featured in a popular movie franchise as which institution?", "Extraversion/introversion, Conscientiousness, Agreeableness, Neuroticism, and Openness to experience and are the 'Big Five' dimensions of what popular acronymically-named personality analysis theory?", "What does the prefix 'cry' mean in words such as cryogenics?", "Which instrument did Glen Miller play?", "What does a mahout keep or ride?", "When was critical illness, or trauma, insurance first launched?", "Who won Best Actress Oscar for the film “The Coalminer’s Daughter “ ?", "What is the medical name for German measles?", "Which part of a church building, situated near the altar, is reserved for the clergy and choir, and is typically separated from the nave by steps or a screen?", "Archery was included in the Olympic Games in 1900, 1904, 1908, and 1920, and every time since 1972. Which country has won the most gold medals?", "What is the name of Captain Jack Aubrey’s ship in the 2003 film ‘Master and Commander: the Far Side of the World’?", "Who was manager of Melchester Rovers when Roy Race joined the club?", "Who was the first Republican to be President of the USA?", "Which hugely popular actor was born on Christmas day 1899?" ]
15
[ 129900, 129901, 129902, 129903, 129904, 129905, 129906, 129907, 129908, 129909, 129910, 129911, 129912, 129913, 129914 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What do Australian aborigines call Ayers Rock?\nQuestion 2: Which deposed king of England died in Pontefract Castle in 1400?\nQuestion 3: A ‘Singing Hinny’ is what type of foodstuff’?\nQuestion 4: Which flightless marine birds of the southern hemisphere live in rookeries?\nQuestion 5: 'Steerpike', 'Doctor Alfred Prunesquallor' and 'Fuschia Groan' are characters created by which author?\nQuestion 6: Who owned the fictional plantation of Tara?\nQuestion 7: Which chemical element, listed as number 77 in the periodic table takes its name from the Latin for the rainbow?\nQuestion 8: What world leader had a prominent birthmark on his head?\nQuestion 9: \"What city is nicknamed \"\"Sin City\"\"?\"\nQuestion 10: The Real Estate investments of which US President were investigated in the ‘Whitewater Scandal’?\nQuestion 11: Whose single 'Evergreen' was the best-selling record in the UK in the decade to December 31st 2009?\nQuestion 12: In what city did Barack Obama formally accept the Democratic nomination for the US presidential election?\nQuestion 13: Adam Levine is the lead singer of which US pop rock band?\nQuestion 14: Which English author’s novels are set in the imaginary county of Barsetshire?\nQuestion 15: What gets whiter the dirtier it gets?", "role": "user" } ]
["[\"Uluru rock\", \"Ulu\\u1e5fu\", \"Airs Rock\", \"Ayer's rock\", \"Air's Rock\", \"Uluru, Australia\", \"Airs rock\", \"Uluru National Park\", \"Uluru / Ayers Rock\", \"Ayer's Rock\", \"Ayers Rock / Uluru\", \"Uluru\", \"Ayers rock\", \"Ayers Rock\", \"Urulu\", \"Uluru (central Australia)\", \"Ayres Rock\", \"Ayers Rock, Australia\", \"Ayers Rock (Uluru)\", \"Oolooroo\", \"Ularu\"]", "[\"RICHARD the SECOND\", \"Richard the Second\", \"Richard The Second\"]", "[\"Cakes\", \"Cake\", \"Orange cake\", \"Caramel cake\", \"Cake bread\", \"Slice of cake\", \"Good cake\", \"Gateau\", \"Queen Elizabeth cake\", \"Milk cake\", \"Queen Elisabeth cake\", \"Cake slice\", \"G\\u00e2teau\", \"White cake\", \"Milk Cake\", \"Cake mix\", \"Orange Cake\"]", "[\"Penquins\", \"Ptilopteri\", \"Sphenisciformes\", \"Penguine\", \"\\ud83d\\udc27\", \"Sphenisiformes\", \"Spheniscinae\", \"Pengiuns\", \"Behavior patterns of adult penguins\", \"Penguines\", \"Spheniscid\\u00e6\", \"Spheniscidae\", \"Penguins\", \"Speniscidiformes\", \"A penguin\", \"Penquin\", \"Penguin eggs\", \"Impennes\", \"Isabelline penguin\", \"Penguin\"]", "[\"Peakean\", \"Mervyn Peake\", \"Mervyn L. Peake\", \"MERVYN PEAKE\"]", "[\"Scarlett Ohara\", \"Scarlett O'hara\", \"Scarlet O'Hara\", \"Scarlett o'hara\", \"Scarlett O Hara\", \"Scarlett O'Harra\", \"Scarlett O'Hara\", \"Scarlett o'Hara\"]", "[\"Iridium satellites\", \"Iridium constellation\", \"Iridium streak\", \"IRIDIUM\", \"Iridium satellite constellation\", \"Iridium 25\", \"Iridium 95\", \"Iridium NEXT\", \"Iridium (satellite)\"]", "[\"M. Gorbachev\", \"Gorbacheu\", \"Gorbachev\", \"Gorba\\u010d\\u00ebv\", \"Gorbachoff\", \"Mihail Gorbacev\", \"Mikhail S. Gorbachev\", \"New thinking\", \"Michail Gorbatschow\", \"Gorbachav\", \"Mihail Sergeevic Gorbacev\", \"Gorbachevian\", \"M Gorbachev\", \"Mihail Gorbachev\", \"Gorbacev\", \"Mihail Gorba\\u010d\\u00ebv\", \"Mikhael Gorbachev\", \"Mikael Gorbachev\", \"Mikhail Gorbachev\", \"January Proposal\", \"Irina Mihailovna Virganskaya\", \"Gorbatsiov\", \"Mihail Gorbaciov\", \"Mihail Gorbachyov\", \"Michail Gorbatsjov\", \"\\u041c\\u0438\\u0445\\u0430\\u0438\\u043b \\u0421\\u0435\\u0440\\u0433\\u0435\\u0435\\u0432\\u0438\\u0447 \\u0413\\u043e\\u0440\\u0431\\u0430\\u0447\\u0451\\u0432\", \"Mikhail Sergeyevich Gorbachev\", \"Mikhail Gorba\\u010d\\u00ebv\", \"Irina Virganskaya\", \"Gorbatsof\", \"Mikhail Sergeyevich Gorbachov\", \"Gorbatschow\", \"Michael Gorbachev\", \"Mihail Sergeevi\\u010d Gorba\\u010d\\u00ebv\", \"Mihail Sergejevic Gorbacev\", \"Mikhail Gorbechev\", \"Gorbachyov\", \"Gorbachof\", \"Mihail Sergejevi\\u010d Gorba\\u010d\\u00ebv\", \"\\u041c\\u0438\\u0445\\u0430\\u0438\\u043b \\u0413\\u043e\\u0440\\u0431\\u0430\\u0447\\u0451\\u0432\", \"New Thinking\", \"Mikhail Gorbachyov\", \"Mikhail Gorbachov\", \"Gorbachov\", \"Mikhail Sergeyevich Gorbachyov\"]", "[\"Las Vegas City Council\", \"Las Vegas, NV\", \"Las Vegas\", \"City of Las Vegas\", \"Las Vegas (NV)\", \"Las Vegas/Climate\", \"Las vegas\", \"UN/LOCODE:USLAS\", \"Las Vegas NV\", \"LasVegas\", \"Vegas\", \"Las Vegas, Nevada\", \"Las vegas, nv\", \"LV, NV\", \"The City of Las Vegas\", \"Las vagas\"]", "[\"US President Bill Clinton\", \"Buddy (Clinton's dog)\", \"William Jefferson Blythe III\", \"President Bill Clinton\", \"Bill Clinton's Post Presidency\", \"Bill Blythe IV\", \"42nd President of the United States\", \"Clintonesque\", \"Klin-ton\", \"Willy Clinton\", \"Bill Klinton\", \"William Jefferson Blythe IV\", \"Bill Clinton%5C\", \"Bill clinton\", \"Clinton, Bill\", \"The MTV President\", \"Bill Clinton's sex scandals\", \"William Jefferson Clinton\", \"William Blythe III\", \"Billy Clinton\", \"William clinton\", \"MTV president\", \"Bill Jefferson Clinton\", \"BillClinton\", \"William J. Blythe III\", \"President Clinton\", \"William J Clinton\", \"Virginia Clinton Kelly\", \"Bubba Clinton\", \"Bill Clinton\", \"Bull Clinton\", \"WilliamJeffersonClinton\", \"William J. Blythe\", \"William Clinton\", \"MTV President\", \"Billl Clinton\", \"Billll Clinton\", \"Bill J. Clinton\", \"Virginia Clinton\", \"William J. Clinton\", \"Clinton Gore Administration\", \"Bill Clinton's Post-Presidency\", \"William Jefferson (Bill) Clinton\", \"Virginia Cassidy Blythe\", \"Willam Jefferson Blythe III\", \"Virginia Kelly\", \"William Jefferson %22Bill%22 Clinton\", \"William %22Bill%22 Clinton\", \"Bil Clinton\", \"@billclinton\"]", "[\"Will Young Live\", \"Will Young\"]", "[\"Denver City, Jefferson Territory\", \"Denver Colorado\", \"The Mile-High City\", \"Denver\", \"Denver, Kansas Territory\", \"Denver County, CO\", \"Denver County\", \"Mile high city\", \"Denver, United States\", \"City of Denver, Colorado\", \"Denverite\", \"Denver, Colorado, USA\", \"Denver, co\", \"Denver (CO)\", \"City of Denver\", \"City and County of Denver\", \"City and County of Denver, Colorado\", \"The Mile High City\", \"Denver, Colorado\", \"UN/LOCODE:USDEN\", \"Westwood, Denver, Colorado\", \"Mile-High City\", \"Denver CO\", \"Denver, USA\", \"Denver, US-CO\", \"Denver, CO\", \"Denver City, Colorado Territory\", \"Denver Co\", \"Denver County, Colorado\", \"Denver colorado\", \"Capital of Colorado\", \"The weather in Denver\", \"Colorado state capital\", \"State capital of Colorado\", \"Denver (Colo.)\", \"Mile High City\", \"Denver East\"]", "[\"Maroon 5's Third Studio album\", \"Marroon 5\", \"Maroon Five\", \"Maroon 5 World Tour\", \"Maroon5\", \"V Tour\", \"Members of Maroon 5\", \"Kara's Flowers\", \"Maroon 5\", \"List of Maroon 5 members\", \"Midnight Miles: On the Road Through 5 Continents & 17 Countries\", \"Kara\\u2019s Flowers\"]", "[\"Anthony Trollope\", \"One of the Firm\", \"A Trollope\", \"Anthony Trollop\", \"Trollopean\"]", "[\"A chalkboard\", \"Blackboard eraser\", \"Black board\", \"Blackboard\", \"Chalk board\", \"Chalkboard\", \"Chalk boards\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Uluru rock\", \"Ulu\\u1e5fu\", \"Airs Rock\", \"Ayer's rock\", \"Air's Rock\", \"Uluru, Australia\", \"Airs rock\", \"Uluru National Park\", \"Uluru / Ayers Rock\", \"Ayer's Rock\", \"Ayers Rock / Uluru\", \"Uluru\", \"Ayers rock\", \"Ayers Rock\", \"Urulu\", \"Uluru (central Australia)\", \"Ayres Rock\", \"Ayers Rock, Australia\", \"Ayers Rock (Uluru)\", \"Oolooroo\", \"Ularu\"]", "[\"RICHARD the SECOND\", \"Richard the Second\", \"Richard The Second\"]", "[\"Cakes\", \"Cake\", \"Orange cake\", \"Caramel cake\", \"Cake bread\", \"Slice of cake\", \"Good cake\", \"Gateau\", \"Queen Elizabeth cake\", \"Milk cake\", \"Queen Elisabeth cake\", \"Cake slice\", \"G\\u00e2teau\", \"White cake\", \"Milk Cake\", \"Cake mix\", \"Orange Cake\"]", "[\"Penquins\", \"Ptilopteri\", \"Sphenisciformes\", \"Penguine\", \"\\ud83d\\udc27\", \"Sphenisiformes\", \"Spheniscinae\", \"Pengiuns\", \"Behavior patterns of adult penguins\", \"Penguines\", \"Spheniscid\\u00e6\", \"Spheniscidae\", \"Penguins\", \"Speniscidiformes\", \"A penguin\", \"Penquin\", \"Penguin eggs\", \"Impennes\", \"Isabelline penguin\", \"Penguin\"]", "[\"Peakean\", \"Mervyn Peake\", \"Mervyn L. Peake\", \"MERVYN PEAKE\"]", "[\"Scarlett Ohara\", \"Scarlett O'hara\", \"Scarlet O'Hara\", \"Scarlett o'hara\", \"Scarlett O Hara\", \"Scarlett O'Harra\", \"Scarlett O'Hara\", \"Scarlett o'Hara\"]", "[\"Iridium satellites\", \"Iridium constellation\", \"Iridium streak\", \"IRIDIUM\", \"Iridium satellite constellation\", \"Iridium 25\", \"Iridium 95\", \"Iridium NEXT\", \"Iridium (satellite)\"]", "[\"M. Gorbachev\", \"Gorbacheu\", \"Gorbachev\", \"Gorba\\u010d\\u00ebv\", \"Gorbachoff\", \"Mihail Gorbacev\", \"Mikhail S. Gorbachev\", \"New thinking\", \"Michail Gorbatschow\", \"Gorbachav\", \"Mihail Sergeevic Gorbacev\", \"Gorbachevian\", \"M Gorbachev\", \"Mihail Gorbachev\", \"Gorbacev\", \"Mihail Gorba\\u010d\\u00ebv\", \"Mikhael Gorbachev\", \"Mikael Gorbachev\", \"Mikhail Gorbachev\", \"January Proposal\", \"Irina Mihailovna Virganskaya\", \"Gorbatsiov\", \"Mihail Gorbaciov\", \"Mihail Gorbachyov\", \"Michail Gorbatsjov\", \"\\u041c\\u0438\\u0445\\u0430\\u0438\\u043b \\u0421\\u0435\\u0440\\u0433\\u0435\\u0435\\u0432\\u0438\\u0447 \\u0413\\u043e\\u0440\\u0431\\u0430\\u0447\\u0451\\u0432\", \"Mikhail Sergeyevich Gorbachev\", \"Mikhail Gorba\\u010d\\u00ebv\", \"Irina Virganskaya\", \"Gorbatsof\", \"Mikhail Sergeyevich Gorbachov\", \"Gorbatschow\", \"Michael Gorbachev\", \"Mihail Sergeevi\\u010d Gorba\\u010d\\u00ebv\", \"Mihail Sergejevic Gorbacev\", \"Mikhail Gorbechev\", \"Gorbachyov\", \"Gorbachof\", \"Mihail Sergejevi\\u010d Gorba\\u010d\\u00ebv\", \"\\u041c\\u0438\\u0445\\u0430\\u0438\\u043b \\u0413\\u043e\\u0440\\u0431\\u0430\\u0447\\u0451\\u0432\", \"New Thinking\", \"Mikhail Gorbachyov\", \"Mikhail Gorbachov\", \"Gorbachov\", \"Mikhail Sergeyevich Gorbachyov\"]", "[\"Las Vegas City Council\", \"Las Vegas, NV\", \"Las Vegas\", \"City of Las Vegas\", \"Las Vegas (NV)\", \"Las Vegas/Climate\", \"Las vegas\", \"UN/LOCODE:USLAS\", \"Las Vegas NV\", \"LasVegas\", \"Vegas\", \"Las Vegas, Nevada\", \"Las vegas, nv\", \"LV, NV\", \"The City of Las Vegas\", \"Las vagas\"]", "[\"US President Bill Clinton\", \"Buddy (Clinton's dog)\", \"William Jefferson Blythe III\", \"President Bill Clinton\", \"Bill Clinton's Post Presidency\", \"Bill Blythe IV\", \"42nd President of the United States\", \"Clintonesque\", \"Klin-ton\", \"Willy Clinton\", \"Bill Klinton\", \"William Jefferson Blythe IV\", \"Bill Clinton%5C\", \"Bill clinton\", \"Clinton, Bill\", \"The MTV President\", \"Bill Clinton's sex scandals\", \"William Jefferson Clinton\", \"William Blythe III\", \"Billy Clinton\", \"William clinton\", \"MTV president\", \"Bill Jefferson Clinton\", \"BillClinton\", \"William J. Blythe III\", \"President Clinton\", \"William J Clinton\", \"Virginia Clinton Kelly\", \"Bubba Clinton\", \"Bill Clinton\", \"Bull Clinton\", \"WilliamJeffersonClinton\", \"William J. Blythe\", \"William Clinton\", \"MTV President\", \"Billl Clinton\", \"Billll Clinton\", \"Bill J. Clinton\", \"Virginia Clinton\", \"William J. Clinton\", \"Clinton Gore Administration\", \"Bill Clinton's Post-Presidency\", \"William Jefferson (Bill) Clinton\", \"Virginia Cassidy Blythe\", \"Willam Jefferson Blythe III\", \"Virginia Kelly\", \"William Jefferson %22Bill%22 Clinton\", \"William %22Bill%22 Clinton\", \"Bil Clinton\", \"@billclinton\"]", "[\"Will Young Live\", \"Will Young\"]", "[\"Denver City, Jefferson Territory\", \"Denver Colorado\", \"The Mile-High City\", \"Denver\", \"Denver, Kansas Territory\", \"Denver County, CO\", \"Denver County\", \"Mile high city\", \"Denver, United States\", \"City of Denver, Colorado\", \"Denverite\", \"Denver, Colorado, USA\", \"Denver, co\", \"Denver (CO)\", \"City of Denver\", \"City and County of Denver\", \"City and County of Denver, Colorado\", \"The Mile High City\", \"Denver, Colorado\", \"UN/LOCODE:USDEN\", \"Westwood, Denver, Colorado\", \"Mile-High City\", \"Denver CO\", \"Denver, USA\", \"Denver, US-CO\", \"Denver, CO\", \"Denver City, Colorado Territory\", \"Denver Co\", \"Denver County, Colorado\", \"Denver colorado\", \"Capital of Colorado\", \"The weather in Denver\", \"Colorado state capital\", \"State capital of Colorado\", \"Denver (Colo.)\", \"Mile High City\", \"Denver East\"]", "[\"Maroon 5's Third Studio album\", \"Marroon 5\", \"Maroon Five\", \"Maroon 5 World Tour\", \"Maroon5\", \"V Tour\", \"Members of Maroon 5\", \"Kara's Flowers\", \"Maroon 5\", \"List of Maroon 5 members\", \"Midnight Miles: On the Road Through 5 Continents & 17 Countries\", \"Kara\\u2019s Flowers\"]", "[\"Anthony Trollope\", \"One of the Firm\", \"A Trollope\", \"Anthony Trollop\", \"Trollopean\"]", "[\"A chalkboard\", \"Blackboard eraser\", \"Black board\", \"Blackboard\", \"Chalk board\", \"Chalkboard\", \"Chalk boards\"]" ]
[ "What do Australian aborigines call Ayers Rock?", "Which deposed king of England died in Pontefract Castle in 1400?", "A ‘Singing Hinny’ is what type of foodstuff’?", "Which flightless marine birds of the southern hemisphere live in rookeries?", "'Steerpike', 'Doctor Alfred Prunesquallor' and 'Fuschia Groan' are characters created by which author?", "Who owned the fictional plantation of Tara?", "Which chemical element, listed as number 77 in the periodic table takes its name from the Latin for the rainbow?", "What world leader had a prominent birthmark on his head?", "\"What city is nicknamed \"\"Sin City\"\"?\"", "The Real Estate investments of which US President were investigated in the ‘Whitewater Scandal’?", "Whose single 'Evergreen' was the best-selling record in the UK in the decade to December 31st 2009?", "In what city did Barack Obama formally accept the Democratic nomination for the US presidential election?", "Adam Levine is the lead singer of which US pop rock band?", "Which English author’s novels are set in the imaginary county of Barsetshire?", "What gets whiter the dirtier it gets?" ]
15
[ 86745, 86746, 86747, 86748, 86749, 86750, 86751, 86752, 86753, 86754, 86755, 86756, 86757, 86758, 86759 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What is the term for reactions some people have that are severe and life-threatening allergies (to environmental or dietary allergens or to medication)?\nQuestion 2: What type of animal is a bongo\nQuestion 3: On which racecourse did Frankie Dettori ride all seven winners at one meeting\nQuestion 4: Which European capital city hosted the 1952 Summer Olympics?\nQuestion 5: What is the second most common pub name in the UK behind the Red Lion?\nQuestion 6: The death of which dictator, closely associated with revolution and with World War II, happened in 1953 while he was in office as leader of his country?\nQuestion 7: Which US state is known as the Keystone State?\nQuestion 8: In which month of the year did Bing Crosby record White Christmas?\nQuestion 9: What word is used to describe the repetition of vowel sounds in words?\nQuestion 10: What 2007 film is an over-the-top send-up of action movies, featuring a large amount of violence (including killing by carrots), starring Clive Owen, Monica Bellucci & Paul Giamatti?\nQuestion 11: Where was the most recent volcanic eruption in the contiguous states of the USA?\nQuestion 12: How is the Rowan tree also known in the UK?\nQuestion 13: What is the main ingredient of hummus?\nQuestion 14: Which herb is an essential ingredient in the Swedish salmon dish, Gravlax?\nQuestion 15: \"Which poet laureate wrote the poems \"\"the hawk in the rain\"\", Moortown\"\" and \"\"Birthday letters\"\" ?\"", "role": "user" } ]
["[\"Anaphylactoid reaction\", \"Antaphylatic shock\", \"Anaphylactic\", \"Anaphelactic shock\", \"Anaphalaxis\", \"Anaphylactic shock\", \"Anaphalactic shock\", \"Idiopathic anaphylaxis\", \"Anaphylactic hypersensivity\", \"Passive transfer anaphylaxis\", \"Anaphlaxis\", \"Anaphylactic reaction\", \"Exercise-induced anaphylaxis\", \"Anaphylactoid reactions\", \"Anaphylaxic shock\", \"Exercise induced anaphylaxis\", \"Pseudo-anaphylaxis\", \"Passive transfer\", \"Pseudoanaphylaxis\", \"Anaphylactic reactions\", \"Anaphylaxis\", \"Annafeltic shock\", \"Anaphylatic Shock\"]", "[\"Botswanan Antelopes\", \"Antelope\", \"Antilopina\", \"Antelopes\", \"Hybrid antelope\"]", "[\"Ascott\", \"Ascot\", \"Ascot (disambiguation)\", \"Ascot, Victoria\"]", "[\"Helsingfors\", \"Helsinki,Finland\", \"Helstinky\", \"Helsinki\", \"Helsinki, finland\", \"UN/LOCODE:FIHEL\", \"Helsinki, Finland\", \"Stadi\", \"Helsinky\", \"Demographics of Helsinki\", \"HELSINKI\", \"Gelsingfors\", \"Helinski\", \"Capital of Finland\", \"Helsinkiem\", \"Helsset\", \"City of Helsinki\"]", "[\"Royal Oak\", \"The Royal Oak\", \"Royal Oak (tree)\"]", "[\"Josif Djugashvili\", \"Joseph Stalin's death conspiracy Theories\", \"StalinJosef\", \"Joseph Dzhugashvili\", \"\\u0418\\u043e\\u0441\\u0438\\u0444 \\u0421\\u0442\\u0430\\u043b\\u0438\\u043d\", \"Josef Dzugashvili\", \"Staline\", \"Stalin Joseph\", \"\\u65af\\u5927\\u6797\", \"Joseph, Man of Steel\", \"Josef Vissarionovich Djugashvili\", \"Joseph V Stalin\", \"Iosif Vissarionovic Stalin\", \"Stalin, Josef\", \"Josef stalin\", \"Jossif Vissarionovich Dhzugazvili\", \"Joseph Djugashvili\", \"Yosef Stalin\", \"Jose Stalin\", \"Iosif Vissarionovi\\u010d Stalin\", \"Joseph Vissarionovich Stalin\", \"Yosif Stalin\", \"Uncle Joe Stalin\", \"Ioseb Vissarionovich Jugashvili\", \"Ioseb Besarionis dze Jugashvili\", \"J. Dzhugashvili\", \"Ioseb Dzhugashvili\", \"Joseph Staline\", \"Josif Vissarionovich Dzhugashvili\", \"I\\u00f3sif Dzhugashv\\u00edli\", \"Jozef Stalin\", \"E\\u00f2saph Stalin\", \"Josef Jughashvili\", \"Vissarionovich Stalin\", \"\\u0421\\u0442\\u0430\\u0301\\u043b\\u0438\\u043d\", \"Stalin,Josef\", \"Iosif Jugashvili\", \"Iosif Vissarionovic Dzugasvili\", \"Joseph Vissarionovich Dzhugashvili\", \"Joseph Vissarionovich Djugashvili\", \"Iosif Vissarionovich Stalin\", \"Stalin\", \"Iosef Dzhugashvili\", \"Josif Dzhugashvili\", \"STALIN\", \"Joseph Stalin and religion\", \"Death of Stalin\", \"Chijikov\", \"Stallin\", \"Joseph V. Stalin\", \"\\u0418\\u043e\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0414\\u0436\\u0443\\u0433\\u0430\\u0448\\u0432\\u0438\\u043b\\u0438\", \"Ioseb Jugashvili\", \"S\\u012b D\\u00e0l\\u00edn\", \"J V Stalin\", \"Joseph stalin\", \"Vissarionovich Dzhugashvili\", \"\\u0421\\u0442\\u0430\\u043b\\u0438\\u043d\", \"Joseph Jughashvili\", \"Ioseb Jughashvili\", \"\\u0418\\u043e\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0421\\u0442\\u0430\\u043b\\u0438\\u043d\", \"Dze Jugashvili\", \"J.V. Stalin\", \"Iosif Vissarionovich Djugashvili\", \"Soso Stalin\", \"Iosef Jugashvili\", \"Josef Dzhugashvili\", \"Death of Joseph Stalin\", \"Comrade Stalin\", \"Stalin's\", \"\\u10d8\\u10dd\\u10e1\\u10d4\\u10d1 \\u10d1\\u10d4\\u10e1\\u10d0\\u10e0\\u10d8\\u10dd\\u10dc\\u10d8\\u10e1 \\u10eb\\u10d4 \\u10ef\\u10e3\\u10e6\\u10d0\\u10e8\\u10d5\\u10d8\\u10da\\u10d8\", \"Stalin, Joseph\", \"Josip Stalin\", \"\\u0418\\u043e\\u0301\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u0301\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0414\\u0436\\u0443\\u0433\\u0430\\u0448\\u0432\\u0438\\u043b\", \"\\u10d8\\u10dd\\u10e1\\u10d4\\u10d1 \\u10ef\\u10e3\\u10e6\\u10d0\\u10e8\\u10d5\\u10d8\\u10da\\u10d8\", \"Ivan Stalin\", \"Joseph Stalin\", \"\\u10d8\\u10dd\\u10e1\\u10d4\\u10d1 \\u10e1\\u10e2\\u10d0\\u10da\\u10d8\\u10dc\\u10d8\", \"Iosif Djugashvili\", \"Yosif Vissarionovich Dzhugashvili\", \"Joe Stalin\", \"Josif Stalin\", \"Ioseb Besarionis Dze Jughashvili\", \"I.V. Stalin\", \"Josef Vissarionovich Dzhugashvili\", \"Joseph Stalin's death conspiracy\", \"Joseph Stalins's religious views\", \"Iosif Vissarionovich Dzhugashvili\", \"Critique of Stalin\", \"Iosif Vissarionovi\\u010d D\\u017euga\\u0161vili\", \"\\u0418\\u043e\\u0301\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u0301\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0421\\u0442\\u0430\\u0301\\u043b\\u0438\\u043d\", \"\\u053b\\u0578\\u057d\\u056b\\u0586 \\u054d\\u057f\\u0561\\u056c\\u056b\\u0576\", \"Djugashvili\", \"Iosif Stalin\", \"Josef Stalin\", \"Eosaph Stalin\", \"Nijeradze\", \"StalinJoseph\", \"Iosif Dzhugashvili\", \"Dzjugasjvili\", \"Joey Stalin\", \"Iosef Stalin\", \"Stalin Josef\", \"J. V. Stalin\", \"Marshal Stalin\", \"Stalin,Joseph\", \"JV Stalin\", \"Iosef Dzugashvili\"]", "[\"Pennyslvania, United States\", \"Cuisine of Pennsylvania\", \"US-PA\", \"Pennsilfaani\", \"Pennsylvannia\", \"Commonwealth of Pennsylvania\", \"Pensylvania\", \"2nd State\", \"Pennsylvania, United States of America\", \"Pennsylvania (state)\", \"Penn's Woods\", \"The Oil State\", \"The Keystone State\", \"Second State\", \"The Quaker State\", \"Pennfylvania\", \"The Commonwealth of Pennsylvania\", \"Keystone State\", \"PA state\", \"State of pennsylvania\", \"Penn.\", \"Pennslyvania\", \"State of Pennsylvania\", \"Transport in Pennsylvania\", \"The Coal State\", \"Pennsylvania, United States\", \"PA (state)\", \"Pennsylvania\", \"Penna.\", \"Keystone state\", \"Economy of Pennsylvania\", \"Pennsilvania\", \"Pennylvania\", \"Pensylvaina\", \"EPnnsylvania\", \"Religion in Pennsylvania\", \"Pencilvania\", \"Demographics of Pennsylvania\", \"Transportation in Pennsylvania\", \"Pennsylvana\", \"Pennsylvania (U.S. state)\"]", "[\"\\u32c4\", \"May sickness\", \"May\", \"Veliki traven\", \"May (month)\", \"Month May\"]", "[\"Assonance\", \"Assonants\"]", "[\"Cute 'em up\", \"Arcade shooter\", \"Shoot Em Up\", \"Shoot 'em up\", \"Shump\", \"Multi-directional shooter\", \"Curtain fire\", \"Twin-stick shooter\", \"Manic shooter\", \"Horizontal shooter\", \"Shoot'em-up\", \"On rails\", \"Run and gun (video gaming)\", \"On-rail shooter\", \"Top down shooter\", \"Scrolling shooter\", \"Curtain Shooter\", \"On-rails\", \"Shoot-em-up\", \"On-rail shooters\", \"Shootemup\", \"Shooter on Iaails\", \"Side-scrolling shooter\", \"Isometric shooter\", \"Rail Shooter\", \"Curtain Fire\", \"Shoot 'em Up\", \"Scrolling shooters\", \"Rail shooters\", \"On-rails shooter\", \"Shoot 'em up video game\", \"Spread gun\", \"Shoot em ups\", \"List of shoot 'em ups\", \"Scrolling Shooter\", \"Shoot em up\", \"Twin stick shooters\", \"SHMUPs\", \"Shootemups\", \"Tube shooter\", \"Rail shooter\", \"Fixed shooter\", \"List of Rail Shooters\", \"SHMUP\", \"Shoot-'em-up\", \"Shmups\", \"FPPS\", \"Platform Shooters\", \"Video game/Scrolling shooters\", \"List of Run 'n Gun Shooters\", \"List of Tube Shooters\", \"SHMUPS\", \"Twin Stick Shooter\", \"Shoot'em up\", \"Shoot 'Em Up\", \"Overhead shooters\", \"On-rails shooters\", \"Shoot'em ups\", \"List of SHMUPS\", \"Run and gun (video game)\", \"Twitch shooter\", \"Danmaku\", \"Twin-Stick Shooter\", \"Bullet hell\", \"Shmup\", \"Top-down shooter\", \"Shoot 'em ups\", \"Manic shooters\", \"Multidirectional shooter\"]", "[\"Washington (Amtrak station)\", \"Washington College (disambiguation)\", \"Washington, United States\", \"Washington, USA\", \"Washington University (disambiguation)\", \"Washington\", \"Washington (CTA)\", \"Washington (CTA) (disambiguation)\", \"Washington, United States (disambiguation)\", \"Washington, U.S.\", \"Washington (disambiguation)\"]", "[\"Mountain ash (botany)\", \"Mountain-ash\", \"Mountain ash\", \"Mountain Ash (disambiguation)\", \"Mountain Ash\", \"Mountain ash (disambiguation)\"]", "[\"Garbanzos\", \"Ceci bean\", \"Chickpeas\", \"Garbonzo\", \"Kabuli chana\", \"Chole (bean)\", \"Chick Pea\", \"Channa dal\", \"Chick-pea\", \"Bengal gram\", \"Chicpea\", \"Chick peas\", \"Garbonzo bean\", \"Chick pea\", \"Garbanzo beans\", \"Chick-Pea\", \"Garbanza\", \"Garbanzo\", \"Garbanzo bean\", \"Chickpea\", \"Cicer arietinum\", \"Kala chana\", \"Kala-chana\"]", "[\"Dillenius\", \"DILL\", \"Johann Jacob Dillenius\", \"Dill.\", \"Dilllenius\", \"Johann Jakob Dillenius\", \"Joannes Jacobus Dillenius\", \"Dillenius, Johann Jacob\"]", "[\"Hughes, Ted\", \"Ted hughes\", \"Ted Hughes\", \"Edward James Hughes\", \"TED HUGHES\", \"Carol Hughes (Hughes)\", \"Edward James %22Ted%22 Hughes\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Anaphylactoid reaction\", \"Antaphylatic shock\", \"Anaphylactic\", \"Anaphelactic shock\", \"Anaphalaxis\", \"Anaphylactic shock\", \"Anaphalactic shock\", \"Idiopathic anaphylaxis\", \"Anaphylactic hypersensivity\", \"Passive transfer anaphylaxis\", \"Anaphlaxis\", \"Anaphylactic reaction\", \"Exercise-induced anaphylaxis\", \"Anaphylactoid reactions\", \"Anaphylaxic shock\", \"Exercise induced anaphylaxis\", \"Pseudo-anaphylaxis\", \"Passive transfer\", \"Pseudoanaphylaxis\", \"Anaphylactic reactions\", \"Anaphylaxis\", \"Annafeltic shock\", \"Anaphylatic Shock\"]", "[\"Botswanan Antelopes\", \"Antelope\", \"Antilopina\", \"Antelopes\", \"Hybrid antelope\"]", "[\"Ascott\", \"Ascot\", \"Ascot (disambiguation)\", \"Ascot, Victoria\"]", "[\"Helsingfors\", \"Helsinki,Finland\", \"Helstinky\", \"Helsinki\", \"Helsinki, finland\", \"UN/LOCODE:FIHEL\", \"Helsinki, Finland\", \"Stadi\", \"Helsinky\", \"Demographics of Helsinki\", \"HELSINKI\", \"Gelsingfors\", \"Helinski\", \"Capital of Finland\", \"Helsinkiem\", \"Helsset\", \"City of Helsinki\"]", "[\"Royal Oak\", \"The Royal Oak\", \"Royal Oak (tree)\"]", "[\"Josif Djugashvili\", \"Joseph Stalin's death conspiracy Theories\", \"StalinJosef\", \"Joseph Dzhugashvili\", \"\\u0418\\u043e\\u0441\\u0438\\u0444 \\u0421\\u0442\\u0430\\u043b\\u0438\\u043d\", \"Josef Dzugashvili\", \"Staline\", \"Stalin Joseph\", \"\\u65af\\u5927\\u6797\", \"Joseph, Man of Steel\", \"Josef Vissarionovich Djugashvili\", \"Joseph V Stalin\", \"Iosif Vissarionovic Stalin\", \"Stalin, Josef\", \"Josef stalin\", \"Jossif Vissarionovich Dhzugazvili\", \"Joseph Djugashvili\", \"Yosef Stalin\", \"Jose Stalin\", \"Iosif Vissarionovi\\u010d Stalin\", \"Joseph Vissarionovich Stalin\", \"Yosif Stalin\", \"Uncle Joe Stalin\", \"Ioseb Vissarionovich Jugashvili\", \"Ioseb Besarionis dze Jugashvili\", \"J. Dzhugashvili\", \"Ioseb Dzhugashvili\", \"Joseph Staline\", \"Josif Vissarionovich Dzhugashvili\", \"I\\u00f3sif Dzhugashv\\u00edli\", \"Jozef Stalin\", \"E\\u00f2saph Stalin\", \"Josef Jughashvili\", \"Vissarionovich Stalin\", \"\\u0421\\u0442\\u0430\\u0301\\u043b\\u0438\\u043d\", \"Stalin,Josef\", \"Iosif Jugashvili\", \"Iosif Vissarionovic Dzugasvili\", \"Joseph Vissarionovich Dzhugashvili\", \"Joseph Vissarionovich Djugashvili\", \"Iosif Vissarionovich Stalin\", \"Stalin\", \"Iosef Dzhugashvili\", \"Josif Dzhugashvili\", \"STALIN\", \"Joseph Stalin and religion\", \"Death of Stalin\", \"Chijikov\", \"Stallin\", \"Joseph V. Stalin\", \"\\u0418\\u043e\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0414\\u0436\\u0443\\u0433\\u0430\\u0448\\u0432\\u0438\\u043b\\u0438\", \"Ioseb Jugashvili\", \"S\\u012b D\\u00e0l\\u00edn\", \"J V Stalin\", \"Joseph stalin\", \"Vissarionovich Dzhugashvili\", \"\\u0421\\u0442\\u0430\\u043b\\u0438\\u043d\", \"Joseph Jughashvili\", \"Ioseb Jughashvili\", \"\\u0418\\u043e\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0421\\u0442\\u0430\\u043b\\u0438\\u043d\", \"Dze Jugashvili\", \"J.V. Stalin\", \"Iosif Vissarionovich Djugashvili\", \"Soso Stalin\", \"Iosef Jugashvili\", \"Josef Dzhugashvili\", \"Death of Joseph Stalin\", \"Comrade Stalin\", \"Stalin's\", \"\\u10d8\\u10dd\\u10e1\\u10d4\\u10d1 \\u10d1\\u10d4\\u10e1\\u10d0\\u10e0\\u10d8\\u10dd\\u10dc\\u10d8\\u10e1 \\u10eb\\u10d4 \\u10ef\\u10e3\\u10e6\\u10d0\\u10e8\\u10d5\\u10d8\\u10da\\u10d8\", \"Stalin, Joseph\", \"Josip Stalin\", \"\\u0418\\u043e\\u0301\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u0301\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0414\\u0436\\u0443\\u0433\\u0430\\u0448\\u0432\\u0438\\u043b\", \"\\u10d8\\u10dd\\u10e1\\u10d4\\u10d1 \\u10ef\\u10e3\\u10e6\\u10d0\\u10e8\\u10d5\\u10d8\\u10da\\u10d8\", \"Ivan Stalin\", \"Joseph Stalin\", \"\\u10d8\\u10dd\\u10e1\\u10d4\\u10d1 \\u10e1\\u10e2\\u10d0\\u10da\\u10d8\\u10dc\\u10d8\", \"Iosif Djugashvili\", \"Yosif Vissarionovich Dzhugashvili\", \"Joe Stalin\", \"Josif Stalin\", \"Ioseb Besarionis Dze Jughashvili\", \"I.V. Stalin\", \"Josef Vissarionovich Dzhugashvili\", \"Joseph Stalin's death conspiracy\", \"Joseph Stalins's religious views\", \"Iosif Vissarionovich Dzhugashvili\", \"Critique of Stalin\", \"Iosif Vissarionovi\\u010d D\\u017euga\\u0161vili\", \"\\u0418\\u043e\\u0301\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u0301\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0421\\u0442\\u0430\\u0301\\u043b\\u0438\\u043d\", \"\\u053b\\u0578\\u057d\\u056b\\u0586 \\u054d\\u057f\\u0561\\u056c\\u056b\\u0576\", \"Djugashvili\", \"Iosif Stalin\", \"Josef Stalin\", \"Eosaph Stalin\", \"Nijeradze\", \"StalinJoseph\", \"Iosif Dzhugashvili\", \"Dzjugasjvili\", \"Joey Stalin\", \"Iosef Stalin\", \"Stalin Josef\", \"J. V. Stalin\", \"Marshal Stalin\", \"Stalin,Joseph\", \"JV Stalin\", \"Iosef Dzugashvili\"]", "[\"Pennyslvania, United States\", \"Cuisine of Pennsylvania\", \"US-PA\", \"Pennsilfaani\", \"Pennsylvannia\", \"Commonwealth of Pennsylvania\", \"Pensylvania\", \"2nd State\", \"Pennsylvania, United States of America\", \"Pennsylvania (state)\", \"Penn's Woods\", \"The Oil State\", \"The Keystone State\", \"Second State\", \"The Quaker State\", \"Pennfylvania\", \"The Commonwealth of Pennsylvania\", \"Keystone State\", \"PA state\", \"State of pennsylvania\", \"Penn.\", \"Pennslyvania\", \"State of Pennsylvania\", \"Transport in Pennsylvania\", \"The Coal State\", \"Pennsylvania, United States\", \"PA (state)\", \"Pennsylvania\", \"Penna.\", \"Keystone state\", \"Economy of Pennsylvania\", \"Pennsilvania\", \"Pennylvania\", \"Pensylvaina\", \"EPnnsylvania\", \"Religion in Pennsylvania\", \"Pencilvania\", \"Demographics of Pennsylvania\", \"Transportation in Pennsylvania\", \"Pennsylvana\", \"Pennsylvania (U.S. state)\"]", "[\"\\u32c4\", \"May sickness\", \"May\", \"Veliki traven\", \"May (month)\", \"Month May\"]", "[\"Assonance\", \"Assonants\"]", "[\"Cute 'em up\", \"Arcade shooter\", \"Shoot Em Up\", \"Shoot 'em up\", \"Shump\", \"Multi-directional shooter\", \"Curtain fire\", \"Twin-stick shooter\", \"Manic shooter\", \"Horizontal shooter\", \"Shoot'em-up\", \"On rails\", \"Run and gun (video gaming)\", \"On-rail shooter\", \"Top down shooter\", \"Scrolling shooter\", \"Curtain Shooter\", \"On-rails\", \"Shoot-em-up\", \"On-rail shooters\", \"Shootemup\", \"Shooter on Iaails\", \"Side-scrolling shooter\", \"Isometric shooter\", \"Rail Shooter\", \"Curtain Fire\", \"Shoot 'em Up\", \"Scrolling shooters\", \"Rail shooters\", \"On-rails shooter\", \"Shoot 'em up video game\", \"Spread gun\", \"Shoot em ups\", \"List of shoot 'em ups\", \"Scrolling Shooter\", \"Shoot em up\", \"Twin stick shooters\", \"SHMUPs\", \"Shootemups\", \"Tube shooter\", \"Rail shooter\", \"Fixed shooter\", \"List of Rail Shooters\", \"SHMUP\", \"Shoot-'em-up\", \"Shmups\", \"FPPS\", \"Platform Shooters\", \"Video game/Scrolling shooters\", \"List of Run 'n Gun Shooters\", \"List of Tube Shooters\", \"SHMUPS\", \"Twin Stick Shooter\", \"Shoot'em up\", \"Shoot 'Em Up\", \"Overhead shooters\", \"On-rails shooters\", \"Shoot'em ups\", \"List of SHMUPS\", \"Run and gun (video game)\", \"Twitch shooter\", \"Danmaku\", \"Twin-Stick Shooter\", \"Bullet hell\", \"Shmup\", \"Top-down shooter\", \"Shoot 'em ups\", \"Manic shooters\", \"Multidirectional shooter\"]", "[\"Washington (Amtrak station)\", \"Washington College (disambiguation)\", \"Washington, United States\", \"Washington, USA\", \"Washington University (disambiguation)\", \"Washington\", \"Washington (CTA)\", \"Washington (CTA) (disambiguation)\", \"Washington, United States (disambiguation)\", \"Washington, U.S.\", \"Washington (disambiguation)\"]", "[\"Mountain ash (botany)\", \"Mountain-ash\", \"Mountain ash\", \"Mountain Ash (disambiguation)\", \"Mountain Ash\", \"Mountain ash (disambiguation)\"]", "[\"Garbanzos\", \"Ceci bean\", \"Chickpeas\", \"Garbonzo\", \"Kabuli chana\", \"Chole (bean)\", \"Chick Pea\", \"Channa dal\", \"Chick-pea\", \"Bengal gram\", \"Chicpea\", \"Chick peas\", \"Garbonzo bean\", \"Chick pea\", \"Garbanzo beans\", \"Chick-Pea\", \"Garbanza\", \"Garbanzo\", \"Garbanzo bean\", \"Chickpea\", \"Cicer arietinum\", \"Kala chana\", \"Kala-chana\"]", "[\"Dillenius\", \"DILL\", \"Johann Jacob Dillenius\", \"Dill.\", \"Dilllenius\", \"Johann Jakob Dillenius\", \"Joannes Jacobus Dillenius\", \"Dillenius, Johann Jacob\"]", "[\"Hughes, Ted\", \"Ted hughes\", \"Ted Hughes\", \"Edward James Hughes\", \"TED HUGHES\", \"Carol Hughes (Hughes)\", \"Edward James %22Ted%22 Hughes\"]" ]
[ "What is the term for reactions some people have that are severe and life-threatening allergies (to environmental or dietary allergens or to medication)?", "What type of animal is a bongo", "On which racecourse did Frankie Dettori ride all seven winners at one meeting", "Which European capital city hosted the 1952 Summer Olympics?", "What is the second most common pub name in the UK behind the Red Lion?", "The death of which dictator, closely associated with revolution and with World War II, happened in 1953 while he was in office as leader of his country?", "Which US state is known as the Keystone State?", "In which month of the year did Bing Crosby record White Christmas?", "What word is used to describe the repetition of vowel sounds in words?", "What 2007 film is an over-the-top send-up of action movies, featuring a large amount of violence (including killing by carrots), starring Clive Owen, Monica Bellucci & Paul Giamatti?", "Where was the most recent volcanic eruption in the contiguous states of the USA?", "How is the Rowan tree also known in the UK?", "What is the main ingredient of hummus?", "Which herb is an essential ingredient in the Swedish salmon dish, Gravlax?", "\"Which poet laureate wrote the poems \"\"the hawk in the rain\"\", Moortown\"\" and \"\"Birthday letters\"\" ?\"" ]
15
[ 107820, 107821, 107822, 107823, 107824, 107825, 107826, 107827, 107828, 107829, 107830, 107831, 107832, 107833, 107834 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: In Indian cuisine what vegetable is indicated by the word DAL?\nQuestion 2: What was the name given to wandering players in 12th and 13th century France, England and Germany who recited poems of love and wine?\nQuestion 3: Oscar Madison and Felix Unger are better known as which fictional Neil Simon characters?\nQuestion 4: Which novelist whose original first names were Margaret Ann before she changed them, won the 2005 Orange Prize for the book 'We Need To Talk About Kevin'?\nQuestion 5: In the passing of a Government Bill, what follows the Third Reading?\nQuestion 6: What was the eastern starting point of the Oregon Trail?\nQuestion 7: In which 90s movie did Al Pacino play retired Colonel Frank Slade?\nQuestion 8: In a book and film, which title character taught at the 'Marcia Blane School for Girls'?\nQuestion 9: Which British Prime Minister was born in Rodney Street, Liverpool?\nQuestion 10: Captain Cook is a geographical area which grows coffee on which island\nQuestion 11: Which Scottish photographer took the famous 1969 photo of The Beatles on a zebra crossing on Abbey Road?\nQuestion 12: What famous sportsman starred in the 2009 film Looking for Eric?\nQuestion 13: TAME is the national airline of which South American nation?\nQuestion 14: Cape Canaveral is in which US state?\nQuestion 15: The Russian city of St Petersburg stands on the River Neva, which runs into which gulf?", "role": "user" } ]
["[\"Lentils\", \"LENTILS\", \"Lens esculenta\", \"Red lentils\", \"Legume dal\", \"Lentiles\", \"Black lentil\", \"Masoor dal\", \"Continental lentil\", \"Masur dhal\", \"Masur dal\", \"Masoor\", \"Masoor daal\", \"Lentil\", \"Masur (lentil)\", \"Masoor dhal\", \"Lens culinaris\", \"Red lentil\"]", "[\"Goliard\", \"Goliardic verse\", \"Goliardic songs\", \"Goliards\", \"Goliardic poetry\", \"Goliardic\"]", "[\"The Odd Couple\", \"The Female Odd Couple\", \"Oscar madison\", \"Murray Greshler\", \"Oscar Madison\"]", "[\"Lionel Shriver\", \"LIONEL SHRIVER\"]", "[\"Royal Ascent\", \"Royal assent\", \"Royal Assent Act 1967\", \"Grand ducal assent\", \"Le roi s'avisera\", \"La Reyne s'avisera\", \"Royal veto\", \"Royal Assent\", \"King's Consent\", \"Le Roy s'avisera\", \"Royal Veto\", \"La reine s'avisera\"]", "[\"Misouri\", \"Politics of Missouri\", \"24th State\", \"Transport in Missouri\", \"Showme State\", \"Show Me State\", \"Missourah\", \"MO (state)\", \"Transportation in Missouri\", \"Missouri (U.S. state)\", \"Missourri\", \"The Show-Me State\", \"Demographics of Missouri\", \"Show-Me State\", \"Twenty-fourth State\", \"The Showme State\", \"Missouri\", \"The Show Me State\", \"Missoura\", \"Religion in Missouri\", \"Myssouri\", \"US-MO\", \"Misourri\", \"Missouri (state)\", \"State of Missouri\", \"Twenty-Fourth State\", \"Misuri\", \"Economy of Missouri\", \"Missouri, United States\"]", "[\"Scent of a Woman\", \"Scent of a Woman (film)\", \"Scent Of A Woman\", \"The Scent of a Woman\", \"Scent of a Woman (disambiguation)\", \"Scent of a woman\"]", "[\"Miss Jean Brodie\"]", "[\"Mr. Gresham\", \"William Gladstone\", \"Sir William Ewart Gladstone\", \"W.E. Gladstone\", \"William Ewart Gladstone\", \"Gladstonian\", \"W E Gladstone\", \"William E Gladstone\", \"William Ewert Gladstone\", \"William E. Gladstone\", \"W. E. Gladstone\", \"WE Gladstone\", \"Ewart Gladstone\"]", "[\"Haiwii\", \"The State of Hawaii\", \"Moku\\u02bb\\u0101ina o Hawai\\u02bbi\", \"Moku\\u02bba-ina o Hawai\\u02bbi\", \"Demographics of Hawaii\", \"Hawaiian culture\", \"Hawai'i Resident\", \"Economy of Hawaii\", \"Hawaii, United States\", \"Haiwaii\", \"US-HI\", \"Owhyhee\", \"Transport in Hawaii\", \"Hawii\", \"Hawaii, USA\", \"50th State\", \"Hawai\\u2019i\", \"Hawai'i\", \"Haway\", \"Hawai%60i\", \"Hawaii (U.S. state)\", \"State of Hawai\\u02bbi\", \"Haw\\u00e1i\", \"Languages of Hawaii\", \"Hawa\\u00ef\", \"Demographics of Hawai\\u02bbi\", \"State of Hawai%60i\", \"Hawwaii\", \"Hawai\\u2018i\", \"Moku%60aina o Hawai%60i\", \"U.S. (HI)\", \"Hawai\\u00ed\", \"The Aloha State\", \"Hawaii\", \"Culture of Hawaii\", \"Geography of Hawaii\", \"Hawai'i State\", \"State of Hawaii\", \"Health in Hawaii\", \"Religion in Hawaii\", \"\\u30cf\\u30ef\\u30a4\", \"Hawai\\u02bbi\", \"Hawaii Resident\", \"Moku%60a-ina o Hawai%60i\", \"Howaii\", \"Fiftieth State\", \"Hawaii (state)\", \"Aloha State\", \"Education in Hawaii\", \"State of Hawai'i\"]", "[\"Iain MacMillan\", \"Iain Macmillan\"]", "[\"Eric the king\", \"\\u00c9ric Cantona\", \"Eric cantona\", \"Cantona\", \"Eric Cantona\"]", "[\"Independence Day of Ecuador\", \"Equadorians\", \"Ecuadorean\", \"Name of Ecuador\", \"Ecuador\", \"People of Ecuador\", \"Republic of Ecuador\", \"Regions of Ecuador\", \"Independence Day (Ecuador)\", \"Ecuadorian Independence Day\", \"Administrative divisions of Ecuador\", \"Ecuadoreans\", \"Ecquador\", \"Subdivisions of Ecuador\", \"Equador\", \"Zones of Ecuador\", \"ISO 3166-1:EC\", \"Republica del Ecuador\", \"Rep\\u00fablica del Ecuador\"]", "[\"Floreda\", \"Twenty-Seventh State\", \"Sunshine State (US)\", \"Religion in Florida\", \"Fl\\u00f3rida\", \"Florida, United States\", \"Sports in Florida\", \"Flordida\", \"Florida Redbacks\", \"Florida (US state)\", \"Florida, USA\", \"27th State\", \"Economy of Florida\", \"Florida (U.S. state)\", \"US-FL\", \"Agriculture in Florida\", \"Flordia\", \"Florida\", \"Florida (State)\", \"Floridian Peninsula\", \"Tourism in Florida\", \"State of Florida\", \"Flawda\", \"FL (state)\", \"Twenty-seventh State\", \"Florida's\", \"Flowery Easter\", \"Florida (state)\", \"Peninsular State\", \"Florida map\", \"Fla.\"]", "[\"Gulf of finland\", \"Suomenlahti\", \"The Gulf of Finland\", \"Soome laht\", \"Gulf of Finland\", \"Bay of finland\", \"Pollution in the Gulf of Finland\", \"Finska viken\", \"Bay of Finland\", \"Finnish Gulf\", \"Finskiy zaliv\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Lentils\", \"LENTILS\", \"Lens esculenta\", \"Red lentils\", \"Legume dal\", \"Lentiles\", \"Black lentil\", \"Masoor dal\", \"Continental lentil\", \"Masur dhal\", \"Masur dal\", \"Masoor\", \"Masoor daal\", \"Lentil\", \"Masur (lentil)\", \"Masoor dhal\", \"Lens culinaris\", \"Red lentil\"]", "[\"Goliard\", \"Goliardic verse\", \"Goliardic songs\", \"Goliards\", \"Goliardic poetry\", \"Goliardic\"]", "[\"The Odd Couple\", \"The Female Odd Couple\", \"Oscar madison\", \"Murray Greshler\", \"Oscar Madison\"]", "[\"Lionel Shriver\", \"LIONEL SHRIVER\"]", "[\"Royal Ascent\", \"Royal assent\", \"Royal Assent Act 1967\", \"Grand ducal assent\", \"Le roi s'avisera\", \"La Reyne s'avisera\", \"Royal veto\", \"Royal Assent\", \"King's Consent\", \"Le Roy s'avisera\", \"Royal Veto\", \"La reine s'avisera\"]", "[\"Misouri\", \"Politics of Missouri\", \"24th State\", \"Transport in Missouri\", \"Showme State\", \"Show Me State\", \"Missourah\", \"MO (state)\", \"Transportation in Missouri\", \"Missouri (U.S. state)\", \"Missourri\", \"The Show-Me State\", \"Demographics of Missouri\", \"Show-Me State\", \"Twenty-fourth State\", \"The Showme State\", \"Missouri\", \"The Show Me State\", \"Missoura\", \"Religion in Missouri\", \"Myssouri\", \"US-MO\", \"Misourri\", \"Missouri (state)\", \"State of Missouri\", \"Twenty-Fourth State\", \"Misuri\", \"Economy of Missouri\", \"Missouri, United States\"]", "[\"Scent of a Woman\", \"Scent of a Woman (film)\", \"Scent Of A Woman\", \"The Scent of a Woman\", \"Scent of a Woman (disambiguation)\", \"Scent of a woman\"]", "[\"Miss Jean Brodie\"]", "[\"Mr. Gresham\", \"William Gladstone\", \"Sir William Ewart Gladstone\", \"W.E. Gladstone\", \"William Ewart Gladstone\", \"Gladstonian\", \"W E Gladstone\", \"William E Gladstone\", \"William Ewert Gladstone\", \"William E. Gladstone\", \"W. E. Gladstone\", \"WE Gladstone\", \"Ewart Gladstone\"]", "[\"Haiwii\", \"The State of Hawaii\", \"Moku\\u02bb\\u0101ina o Hawai\\u02bbi\", \"Moku\\u02bba-ina o Hawai\\u02bbi\", \"Demographics of Hawaii\", \"Hawaiian culture\", \"Hawai'i Resident\", \"Economy of Hawaii\", \"Hawaii, United States\", \"Haiwaii\", \"US-HI\", \"Owhyhee\", \"Transport in Hawaii\", \"Hawii\", \"Hawaii, USA\", \"50th State\", \"Hawai\\u2019i\", \"Hawai'i\", \"Haway\", \"Hawai%60i\", \"Hawaii (U.S. state)\", \"State of Hawai\\u02bbi\", \"Haw\\u00e1i\", \"Languages of Hawaii\", \"Hawa\\u00ef\", \"Demographics of Hawai\\u02bbi\", \"State of Hawai%60i\", \"Hawwaii\", \"Hawai\\u2018i\", \"Moku%60aina o Hawai%60i\", \"U.S. (HI)\", \"Hawai\\u00ed\", \"The Aloha State\", \"Hawaii\", \"Culture of Hawaii\", \"Geography of Hawaii\", \"Hawai'i State\", \"State of Hawaii\", \"Health in Hawaii\", \"Religion in Hawaii\", \"\\u30cf\\u30ef\\u30a4\", \"Hawai\\u02bbi\", \"Hawaii Resident\", \"Moku%60a-ina o Hawai%60i\", \"Howaii\", \"Fiftieth State\", \"Hawaii (state)\", \"Aloha State\", \"Education in Hawaii\", \"State of Hawai'i\"]", "[\"Iain MacMillan\", \"Iain Macmillan\"]", "[\"Eric the king\", \"\\u00c9ric Cantona\", \"Eric cantona\", \"Cantona\", \"Eric Cantona\"]", "[\"Independence Day of Ecuador\", \"Equadorians\", \"Ecuadorean\", \"Name of Ecuador\", \"Ecuador\", \"People of Ecuador\", \"Republic of Ecuador\", \"Regions of Ecuador\", \"Independence Day (Ecuador)\", \"Ecuadorian Independence Day\", \"Administrative divisions of Ecuador\", \"Ecuadoreans\", \"Ecquador\", \"Subdivisions of Ecuador\", \"Equador\", \"Zones of Ecuador\", \"ISO 3166-1:EC\", \"Republica del Ecuador\", \"Rep\\u00fablica del Ecuador\"]", "[\"Floreda\", \"Twenty-Seventh State\", \"Sunshine State (US)\", \"Religion in Florida\", \"Fl\\u00f3rida\", \"Florida, United States\", \"Sports in Florida\", \"Flordida\", \"Florida Redbacks\", \"Florida (US state)\", \"Florida, USA\", \"27th State\", \"Economy of Florida\", \"Florida (U.S. state)\", \"US-FL\", \"Agriculture in Florida\", \"Flordia\", \"Florida\", \"Florida (State)\", \"Floridian Peninsula\", \"Tourism in Florida\", \"State of Florida\", \"Flawda\", \"FL (state)\", \"Twenty-seventh State\", \"Florida's\", \"Flowery Easter\", \"Florida (state)\", \"Peninsular State\", \"Florida map\", \"Fla.\"]", "[\"Gulf of finland\", \"Suomenlahti\", \"The Gulf of Finland\", \"Soome laht\", \"Gulf of Finland\", \"Bay of finland\", \"Pollution in the Gulf of Finland\", \"Finska viken\", \"Bay of Finland\", \"Finnish Gulf\", \"Finskiy zaliv\"]" ]
[ "In Indian cuisine what vegetable is indicated by the word DAL?", "What was the name given to wandering players in 12th and 13th century France, England and Germany who recited poems of love and wine?", "Oscar Madison and Felix Unger are better known as which fictional Neil Simon characters?", "Which novelist whose original first names were Margaret Ann before she changed them, won the 2005 Orange Prize for the book 'We Need To Talk About Kevin'?", "In the passing of a Government Bill, what follows the Third Reading?", "What was the eastern starting point of the Oregon Trail?", "In which 90s movie did Al Pacino play retired Colonel Frank Slade?", "In a book and film, which title character taught at the 'Marcia Blane School for Girls'?", "Which British Prime Minister was born in Rodney Street, Liverpool?", "Captain Cook is a geographical area which grows coffee on which island", "Which Scottish photographer took the famous 1969 photo of The Beatles on a zebra crossing on Abbey Road?", "What famous sportsman starred in the 2009 film Looking for Eric?", "TAME is the national airline of which South American nation?", "Cape Canaveral is in which US state?", "The Russian city of St Petersburg stands on the River Neva, which runs into which gulf?" ]
15
[ 114975, 114976, 114977, 114978, 114979, 114980, 114981, 114982, 114983, 114984, 114985, 114986, 114987, 114988, 114989 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: The Bicycle manufacturers Trek, Giant and Specialized come from which country ?\nQuestion 2: What type of food was famously shared by Lady and the Tramp?\nQuestion 3: Which national newspaper has been edited by William Rees-Mogg, Charles Douglas-Home and Peter Stoddard?\nQuestion 4: On what bay does St. Petersburg, Florida lie?\nQuestion 5: Which Iain Banks novel has the name of a bird in the title? The book was also made into a television series.\nQuestion 6: Born on Dec 9, 1886, which Brooklyn, NY resident invented the process of flash freezing food to prevent damage to the food?\nQuestion 7: In which Asian country is Tagalog spoken?\nQuestion 8: What is the name of Monaco’s ruling family?\nQuestion 9: \"Who wrote the musical \"\"A Funny Thing Happened on the Way to the Forum\"\"?\"\nQuestion 10: Which cigarette brand was launched in 1924 with the slogan ‘Mild As May’?\nQuestion 11: The tune of the British national anthem appears within which composer's Jubilee Overture?\nQuestion 12: ln 1972, Laslo Toth damaged which sculpture of 1499, by Michelangelo in St Peter's, Rome?\nQuestion 13: Where is the Flavian Amphitheatre?\nQuestion 14: Which horse won the Epsom Derby in 1989?\nQuestion 15: Whose visit to Vietnam in November 2000 was the first by a U.S. President since the end of the Vietnam War?", "role": "user" } ]
["[\"The United States of America\", \"United States Of Amerca\", \"Us of a\", \"U.\\u2013S.\\u2013A.\", \"Americaland\", \"United States (U.S.A.)\", \"Amurika\", \"Unite states of america\", \"United States of America (redirect)\", \"The U S A\", \"Unietd States\", \"EE UU\", \"The U.S.A.\", \"U.-S.-A.\", \"Usa\", \"United Staets of America\", \"Unites States\", \"\\u00c9tats-Unis d'Am\\u00e9rique\", \"Verenigde State\", \"U.\\u2013S.\", \"The United States of America.\", \"The U-S-A\", \"EEUU\", \"U. S. A.\", \"Nagkaisang mga Estado\", \"The U. S. of America\", \"The USA\", \"America (United States)\", \"The U. S. A.\", \"U S of America\", \"UNITED STATES\", \"Estados Unidos\", \"The U\\u2013S\", \"American United States\", \"US and A\", \"Unitd states\", \"The US of A\", \"EE.UU.\", \"U-S\", \"The U-S\", \"Etymology of the United States\", \"U.S.A.)\", \"EE. UU.\", \"United states of america\", \"US of america\", \"Verenigde State van Amerika\", \"Nited States\", \"United-States\", \"Unite States\", \"Estados Unidos de Am\\u00e9rica\", \"UnitedStates\", \"Estaos Unios\", \"US of America\", \"The Usa\", \"United states of America\", \"Untied States of America\", \"The U S of America\", \"THE AMERICAN UNITED STATES\", \"The United-States\", \"U S A\", \"AmericA\", \"Estados Unidos de America\", \"United states\", \"The U.S. of America\", \"Amerka\", \"United\\u2013States\", \"U.s.a.\", \"United States of America\", \"United State of America\", \"United States (US)\", \"The U.S. of A\", \"America\", \"Amercia\", \"Stati Uniti d'America\", \"Los Estados Unidos de America\", \"United Stated\", \"U.S.\", \"United States (of America)\", \"United States\", \"States of America\", \"America-class\", \"Los Estados Unidos\", \"U,S,\", \"United States (country)\", \"Federal United States\", \"ISO 3166-1:US\", \"Untied States\", \"The U.\\u2013S.\\u2013A.\", \"VS America\", \"Amurica\", \"Etats-Unis d'Amerique\", \"US\", \"U.S. OF A\", \"USofA\", \"Etats-Unis\", \"U.S. of A\", \"United States of America (U.S.A.)\", \"Amarica\", \"The United States\", \"U-S-A\", \"United States/Introduction\", \"The Us\", \"Unitesd states\", \"The U S of A\", \"America class\", \"America magazine\", \"\\u0627\\u0644\\u0648\\u0644\\u0627\\u064a\\u0627\\u062a \\u0627\\u0644\\u0645\\u062a\\u062d\\u062f\\u0629 \\u0627\\u0644\\u0623\\u0645\\u0631\\u064a\\u0643\\u064a\\u0629\", \"The U. S. of A\", \"U S\", \"(USA)\", \"The United\\u2013States\", \"United States (U.S.)\", \"U.-S.\", \"United States of America (USA)\", \"'merica\", \"The US\", \"United States of America.\", \"UNited States\", \"The U.S.\", \"AMERICA\", \"United States of America/OldPage\", \"United+States\", \"The U S\", \"United Sates\", \"THE UNITED STATES OF AMERICA\", \"U\\u2013S\\u2013A\", \"United States Of America\", \"U.S. of America\", \"U\\u2013S\", \"Los Estados Unidos de Am\\u00e9rica\", \"The U.-S.\", \"United sates\", \"The United States Of America\", \"America (country)\", \"United States of American\", \"United state of america\", \"The U.\\u2013S.\", \"Amurka\", \"U. S. of A\", \"The U. S.\", \"United States America\", \"US of A\", \"\\u00c9tats-Unis\", \"USoA\", \"USA\", \"Estaos Un\\u00edos\", \"America, United States of\", \"U. S. of America\", \"U.S.American\", \"(US)\", \"The U\\u2013S\\u2013A\", \"U. S.\", \"U.S. America\", \"U.S. A\", \"Yankee land\", \"America (US)\", \"U.S\", \"America (United States of)\", \"US (country)\", \"UNITED STATES OF AMERICA\", \"U.S.A\", \"Estados unidos\", \"Americia\", \"The US of america\", \"Vereinigte Staaten\", \"US America\", \"These United States of America\", \"VS Amerika\", \"Name of the United States\", \"The united states of america\", \"Estatos Unitos\", \"America (USA)\", \"The U.-S.-A.\", \"United States of America/Introduction\", \"The US of America\", \"Americophile\", \"V.S. America\", \"U.S.A.\", \"U S of A\", \"V.S. Amerika\", \"United+States+of+America\", \"The Unites States of America\"]", "[\"Speghetti\", \"Spagheti\", \"Spaghetti preparation\", \"Striped spaghetti\", \"Spaghettoni\", \"Spaghetti\", \"Spaghetti aglio, olio e peperoncino\", \"Spaghettini\", \"Spegheti\", \"Spegetti\", \"Spaghetto\", \"\\ud83c\\udf5d\", \"Spaghetti rigati\"]", "[\"Times (United Kingdom)\", \"Times (UK)\", \"THE TIMES\", \"The Times newspaper\", \"The London Times\", \"White Times\", \"Times Online\", \"The Times of London\", \"Timesonline.co.uk\", \"Times (newspaper)\", \"The Times (United Kingdom)\", \"The Times (London)\", \"Thetimes.co.uk\", \"London Times\", \"The Saturday Times Magazine\", \"The Times\", \"Daily Universal Register\", \"The Times Online\", \"Times (London)\", \"Times of London\", \"TimesOnline\", \"The times\", \"The times of london\", \"Times2\", \"Times of london\", \"Timesonline\", \"Times online\"]", "[\"Tampa Bay, Florida\", \"Hillsborough Bay (Florida)\", \"Tampa Bay, FL\", \"Old Tampa Bay\", \"Tampa Bay\"]", "[\"Crow Road\", \"The Crow Road\", \"The Crow Road (novel)\", \"Iain Banks/The Crow Road\", \"THE CROW ROAD\"]", "[\"Clarence Frank Birdseye\", \"Birdseye Frozen Foods\", \"Clarence Birdseye\"]", "[\"Islas Filipinas\", \"The Republic of the Philippines\", \"Philippines Republic\", \"Pinas (country)\", \"Philipine\", \"Phillipines\", \"Republic of Philippines\", \"ISO 3166-1:PH\", \"Republic of Pilipinas\", \"PHILIPPINE\", \"Regional population of the Philippines\", \"Fillipines\", \"The Philipines\", \"Filippines\", \"Phillippenes\", \"Las Islas Filipinas\", \"Islas de Filipinas\", \"Filipines\", \"Legazpi Boulevard\", \"Republic of the Philippines\", \"Philippines\", \"Fillippines\", \"Philippine archipelago\", \"Philippine islands\", \"Philippinan\", \"The Phillipines\", \"PHILIPPINES\", \"The Phillippines\", \"Lu Sung\", \"Philippine republic\", \"Philipines\", \"Philippine Islands\", \"Phillipine\", \"Etymology of the Philippines\", \"Philippine Archipelago\", \"Filipino Republic\", \"Philippines Colonial History\", \"Phillippines\", \"Republika ng Pilipinas\", \"Philippines archipelago\", \"Pilipinas\", \"The Philippines\", \"Philippine\", \"Philiphines\", \"Department of Health-Center for Health Development\", \"Philippenes\", \"Phillippine\", \"Phillipenes\"]", "[\"Grimaldi (disambiguation)\", \"GRIMALDI\", \"Grimaldi\"]", "[\"Joshua Sondheim\", \"Steven Sondheim\", \"Sondhiem\", \"Stephen Joshua Sondheim\", \"Stephen Sondheim\", \"Sondheim vor der Rhoen\", \"Steven sondheim\", \"Stephen Joshua\", \"Sondheim vor der Rh\\u00f6n\", \"Sondheim vor der Rhon\", \"The Stephen Sondheim Society\"]", "[\"Marlboro\", \"Marlboro Reds\", \"Marlboro (Disambiguation)\", \"Marolboro\", \"Marlboro (disambiguation)\"]", "[\"Karl Maria Friedrich Ernst, Baron von Weber\", \"Carl von Weber\", \"Von Weber\", \"Carl Maria Friedrich Ernest von Weber\", \"Carl Maria von Weber\", \"Weber, Karl Maria Friedrich Ernst von\", \"Von weber\", \"Carl maria von webber\", \"Carl-Maria von Weber\", \"Carl Maria Friedrich Ernst von Weber\", \"Cmvw\", \"Carl maria von weber\", \"Carl Maria Weber\", \"Carl Maria Von Weber\", \"Karl Maria Friedrich Ernst von Weber\", \"Karl Maria von Weber\"]", "[\"Pi\\u00e8ta\", \"La Pieta\", \"La Piet\\u00e0\", \"Piet\\u00e1\", \"The Pieta\", \"Vesperbild\", \"Pieta\", \"Piet\\u00e0\"]", "[\"Capital city of italy\", \"Demographics of Rome\", \"Comune di Roma\", \"Symbols and trivia of Rome\", \"Roma, Italy\", \"Citt\\u00e0 Eterna\", \"City of the Seven Hills\", \"R\\u014dma\", \"ROME\", \"Roma (city)\", \"Rome, Lazio\", \"Capital of Italy\", \"Rome, Italy\", \"Rome, Republic and Empire\", \"UN/LOCODE:ITROM\", \"Rome\", \"Rome,Italy\", \"Roma, Italia\", \"Italian capital\", \"Rome (Italy)\", \"City of Rome\", \"Symbols and Trivia of Rome\", \"The weather in Rome\"]", "[\"Nashwan\", \"Nashwan (horse)\"]", "[\"US President Bill Clinton\", \"Buddy (Clinton's dog)\", \"William Jefferson Blythe III\", \"President Bill Clinton\", \"Bill Clinton's Post Presidency\", \"Bill Blythe IV\", \"42nd President of the United States\", \"Clintonesque\", \"Klin-ton\", \"Willy Clinton\", \"Bill Klinton\", \"William Jefferson Blythe IV\", \"Bill Clinton%5C\", \"Bill clinton\", \"Clinton, Bill\", \"The MTV President\", \"Bill Clinton's sex scandals\", \"William Jefferson Clinton\", \"William Blythe III\", \"Billy Clinton\", \"William clinton\", \"MTV president\", \"Bill Jefferson Clinton\", \"BillClinton\", \"William J. Blythe III\", \"President Clinton\", \"William J Clinton\", \"Virginia Clinton Kelly\", \"Bubba Clinton\", \"Bill Clinton\", \"Bull Clinton\", \"WilliamJeffersonClinton\", \"William J. Blythe\", \"William Clinton\", \"MTV President\", \"Billl Clinton\", \"Billll Clinton\", \"Bill J. Clinton\", \"Virginia Clinton\", \"William J. Clinton\", \"Clinton Gore Administration\", \"Bill Clinton's Post-Presidency\", \"William Jefferson (Bill) Clinton\", \"Virginia Cassidy Blythe\", \"Willam Jefferson Blythe III\", \"Virginia Kelly\", \"William Jefferson %22Bill%22 Clinton\", \"William %22Bill%22 Clinton\", \"Bil Clinton\", \"@billclinton\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"The United States of America\", \"United States Of Amerca\", \"Us of a\", \"U.\\u2013S.\\u2013A.\", \"Americaland\", \"United States (U.S.A.)\", \"Amurika\", \"Unite states of america\", \"United States of America (redirect)\", \"The U S A\", \"Unietd States\", \"EE UU\", \"The U.S.A.\", \"U.-S.-A.\", \"Usa\", \"United Staets of America\", \"Unites States\", \"\\u00c9tats-Unis d'Am\\u00e9rique\", \"Verenigde State\", \"U.\\u2013S.\", \"The United States of America.\", \"The U-S-A\", \"EEUU\", \"U. S. A.\", \"Nagkaisang mga Estado\", \"The U. S. of America\", \"The USA\", \"America (United States)\", \"The U. S. A.\", \"U S of America\", \"UNITED STATES\", \"Estados Unidos\", \"The U\\u2013S\", \"American United States\", \"US and A\", \"Unitd states\", \"The US of A\", \"EE.UU.\", \"U-S\", \"The U-S\", \"Etymology of the United States\", \"U.S.A.)\", \"EE. UU.\", \"United states of america\", \"US of america\", \"Verenigde State van Amerika\", \"Nited States\", \"United-States\", \"Unite States\", \"Estados Unidos de Am\\u00e9rica\", \"UnitedStates\", \"Estaos Unios\", \"US of America\", \"The Usa\", \"United states of America\", \"Untied States of America\", \"The U S of America\", \"THE AMERICAN UNITED STATES\", \"The United-States\", \"U S A\", \"AmericA\", \"Estados Unidos de America\", \"United states\", \"The U.S. of America\", \"Amerka\", \"United\\u2013States\", \"U.s.a.\", \"United States of America\", \"United State of America\", \"United States (US)\", \"The U.S. of A\", \"America\", \"Amercia\", \"Stati Uniti d'America\", \"Los Estados Unidos de America\", \"United Stated\", \"U.S.\", \"United States (of America)\", \"United States\", \"States of America\", \"America-class\", \"Los Estados Unidos\", \"U,S,\", \"United States (country)\", \"Federal United States\", \"ISO 3166-1:US\", \"Untied States\", \"The U.\\u2013S.\\u2013A.\", \"VS America\", \"Amurica\", \"Etats-Unis d'Amerique\", \"US\", \"U.S. OF A\", \"USofA\", \"Etats-Unis\", \"U.S. of A\", \"United States of America (U.S.A.)\", \"Amarica\", \"The United States\", \"U-S-A\", \"United States/Introduction\", \"The Us\", \"Unitesd states\", \"The U S of A\", \"America class\", \"America magazine\", \"\\u0627\\u0644\\u0648\\u0644\\u0627\\u064a\\u0627\\u062a \\u0627\\u0644\\u0645\\u062a\\u062d\\u062f\\u0629 \\u0627\\u0644\\u0623\\u0645\\u0631\\u064a\\u0643\\u064a\\u0629\", \"The U. S. of A\", \"U S\", \"(USA)\", \"The United\\u2013States\", \"United States (U.S.)\", \"U.-S.\", \"United States of America (USA)\", \"'merica\", \"The US\", \"United States of America.\", \"UNited States\", \"The U.S.\", \"AMERICA\", \"United States of America/OldPage\", \"United+States\", \"The U S\", \"United Sates\", \"THE UNITED STATES OF AMERICA\", \"U\\u2013S\\u2013A\", \"United States Of America\", \"U.S. of America\", \"U\\u2013S\", \"Los Estados Unidos de Am\\u00e9rica\", \"The U.-S.\", \"United sates\", \"The United States Of America\", \"America (country)\", \"United States of American\", \"United state of america\", \"The U.\\u2013S.\", \"Amurka\", \"U. S. of A\", \"The U. S.\", \"United States America\", \"US of A\", \"\\u00c9tats-Unis\", \"USoA\", \"USA\", \"Estaos Un\\u00edos\", \"America, United States of\", \"U. S. of America\", \"U.S.American\", \"(US)\", \"The U\\u2013S\\u2013A\", \"U. S.\", \"U.S. America\", \"U.S. A\", \"Yankee land\", \"America (US)\", \"U.S\", \"America (United States of)\", \"US (country)\", \"UNITED STATES OF AMERICA\", \"U.S.A\", \"Estados unidos\", \"Americia\", \"The US of america\", \"Vereinigte Staaten\", \"US America\", \"These United States of America\", \"VS Amerika\", \"Name of the United States\", \"The united states of america\", \"Estatos Unitos\", \"America (USA)\", \"The U.-S.-A.\", \"United States of America/Introduction\", \"The US of America\", \"Americophile\", \"V.S. America\", \"U.S.A.\", \"U S of A\", \"V.S. Amerika\", \"United+States+of+America\", \"The Unites States of America\"]", "[\"Speghetti\", \"Spagheti\", \"Spaghetti preparation\", \"Striped spaghetti\", \"Spaghettoni\", \"Spaghetti\", \"Spaghetti aglio, olio e peperoncino\", \"Spaghettini\", \"Spegheti\", \"Spegetti\", \"Spaghetto\", \"\\ud83c\\udf5d\", \"Spaghetti rigati\"]", "[\"Times (United Kingdom)\", \"Times (UK)\", \"THE TIMES\", \"The Times newspaper\", \"The London Times\", \"White Times\", \"Times Online\", \"The Times of London\", \"Timesonline.co.uk\", \"Times (newspaper)\", \"The Times (United Kingdom)\", \"The Times (London)\", \"Thetimes.co.uk\", \"London Times\", \"The Saturday Times Magazine\", \"The Times\", \"Daily Universal Register\", \"The Times Online\", \"Times (London)\", \"Times of London\", \"TimesOnline\", \"The times\", \"The times of london\", \"Times2\", \"Times of london\", \"Timesonline\", \"Times online\"]", "[\"Tampa Bay, Florida\", \"Hillsborough Bay (Florida)\", \"Tampa Bay, FL\", \"Old Tampa Bay\", \"Tampa Bay\"]", "[\"Crow Road\", \"The Crow Road\", \"The Crow Road (novel)\", \"Iain Banks/The Crow Road\", \"THE CROW ROAD\"]", "[\"Clarence Frank Birdseye\", \"Birdseye Frozen Foods\", \"Clarence Birdseye\"]", "[\"Islas Filipinas\", \"The Republic of the Philippines\", \"Philippines Republic\", \"Pinas (country)\", \"Philipine\", \"Phillipines\", \"Republic of Philippines\", \"ISO 3166-1:PH\", \"Republic of Pilipinas\", \"PHILIPPINE\", \"Regional population of the Philippines\", \"Fillipines\", \"The Philipines\", \"Filippines\", \"Phillippenes\", \"Las Islas Filipinas\", \"Islas de Filipinas\", \"Filipines\", \"Legazpi Boulevard\", \"Republic of the Philippines\", \"Philippines\", \"Fillippines\", \"Philippine archipelago\", \"Philippine islands\", \"Philippinan\", \"The Phillipines\", \"PHILIPPINES\", \"The Phillippines\", \"Lu Sung\", \"Philippine republic\", \"Philipines\", \"Philippine Islands\", \"Phillipine\", \"Etymology of the Philippines\", \"Philippine Archipelago\", \"Filipino Republic\", \"Philippines Colonial History\", \"Phillippines\", \"Republika ng Pilipinas\", \"Philippines archipelago\", \"Pilipinas\", \"The Philippines\", \"Philippine\", \"Philiphines\", \"Department of Health-Center for Health Development\", \"Philippenes\", \"Phillippine\", \"Phillipenes\"]", "[\"Grimaldi (disambiguation)\", \"GRIMALDI\", \"Grimaldi\"]", "[\"Joshua Sondheim\", \"Steven Sondheim\", \"Sondhiem\", \"Stephen Joshua Sondheim\", \"Stephen Sondheim\", \"Sondheim vor der Rhoen\", \"Steven sondheim\", \"Stephen Joshua\", \"Sondheim vor der Rh\\u00f6n\", \"Sondheim vor der Rhon\", \"The Stephen Sondheim Society\"]", "[\"Marlboro\", \"Marlboro Reds\", \"Marlboro (Disambiguation)\", \"Marolboro\", \"Marlboro (disambiguation)\"]", "[\"Karl Maria Friedrich Ernst, Baron von Weber\", \"Carl von Weber\", \"Von Weber\", \"Carl Maria Friedrich Ernest von Weber\", \"Carl Maria von Weber\", \"Weber, Karl Maria Friedrich Ernst von\", \"Von weber\", \"Carl maria von webber\", \"Carl-Maria von Weber\", \"Carl Maria Friedrich Ernst von Weber\", \"Cmvw\", \"Carl maria von weber\", \"Carl Maria Weber\", \"Carl Maria Von Weber\", \"Karl Maria Friedrich Ernst von Weber\", \"Karl Maria von Weber\"]", "[\"Pi\\u00e8ta\", \"La Pieta\", \"La Piet\\u00e0\", \"Piet\\u00e1\", \"The Pieta\", \"Vesperbild\", \"Pieta\", \"Piet\\u00e0\"]", "[\"Capital city of italy\", \"Demographics of Rome\", \"Comune di Roma\", \"Symbols and trivia of Rome\", \"Roma, Italy\", \"Citt\\u00e0 Eterna\", \"City of the Seven Hills\", \"R\\u014dma\", \"ROME\", \"Roma (city)\", \"Rome, Lazio\", \"Capital of Italy\", \"Rome, Italy\", \"Rome, Republic and Empire\", \"UN/LOCODE:ITROM\", \"Rome\", \"Rome,Italy\", \"Roma, Italia\", \"Italian capital\", \"Rome (Italy)\", \"City of Rome\", \"Symbols and Trivia of Rome\", \"The weather in Rome\"]", "[\"Nashwan\", \"Nashwan (horse)\"]", "[\"US President Bill Clinton\", \"Buddy (Clinton's dog)\", \"William Jefferson Blythe III\", \"President Bill Clinton\", \"Bill Clinton's Post Presidency\", \"Bill Blythe IV\", \"42nd President of the United States\", \"Clintonesque\", \"Klin-ton\", \"Willy Clinton\", \"Bill Klinton\", \"William Jefferson Blythe IV\", \"Bill Clinton%5C\", \"Bill clinton\", \"Clinton, Bill\", \"The MTV President\", \"Bill Clinton's sex scandals\", \"William Jefferson Clinton\", \"William Blythe III\", \"Billy Clinton\", \"William clinton\", \"MTV president\", \"Bill Jefferson Clinton\", \"BillClinton\", \"William J. Blythe III\", \"President Clinton\", \"William J Clinton\", \"Virginia Clinton Kelly\", \"Bubba Clinton\", \"Bill Clinton\", \"Bull Clinton\", \"WilliamJeffersonClinton\", \"William J. Blythe\", \"William Clinton\", \"MTV President\", \"Billl Clinton\", \"Billll Clinton\", \"Bill J. Clinton\", \"Virginia Clinton\", \"William J. Clinton\", \"Clinton Gore Administration\", \"Bill Clinton's Post-Presidency\", \"William Jefferson (Bill) Clinton\", \"Virginia Cassidy Blythe\", \"Willam Jefferson Blythe III\", \"Virginia Kelly\", \"William Jefferson %22Bill%22 Clinton\", \"William %22Bill%22 Clinton\", \"Bil Clinton\", \"@billclinton\"]" ]
[ "The Bicycle manufacturers Trek, Giant and Specialized come from which country ?", "What type of food was famously shared by Lady and the Tramp?", "Which national newspaper has been edited by William Rees-Mogg, Charles Douglas-Home and Peter Stoddard?", "On what bay does St. Petersburg, Florida lie?", "Which Iain Banks novel has the name of a bird in the title? The book was also made into a television series.", "Born on Dec 9, 1886, which Brooklyn, NY resident invented the process of flash freezing food to prevent damage to the food?", "In which Asian country is Tagalog spoken?", "What is the name of Monaco’s ruling family?", "\"Who wrote the musical \"\"A Funny Thing Happened on the Way to the Forum\"\"?\"", "Which cigarette brand was launched in 1924 with the slogan ‘Mild As May’?", "The tune of the British national anthem appears within which composer's Jubilee Overture?", "ln 1972, Laslo Toth damaged which sculpture of 1499, by Michelangelo in St Peter's, Rome?", "Where is the Flavian Amphitheatre?", "Which horse won the Epsom Derby in 1989?", "Whose visit to Vietnam in November 2000 was the first by a U.S. President since the end of the Vietnam War?" ]
15
[ 136005, 136006, 136007, 136008, 136009, 136010, 136011, 136012, 136013, 136014, 136015, 136016, 136017, 136018, 136019 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What is the name of the area where baseball relief pitchers warm up?\nQuestion 2: \"Who wrote the song \"\"God bless America\"\"?\"\nQuestion 3: Guy Garvey is a singer with which band?\nQuestion 4: Who discovered, in 1895, that X Rays could be applied to medicine?\nQuestion 5: Who played Don Vito Corleone in the 1972 film The Godfather?\nQuestion 6: \"Whose epitaph on his tombstone reads \"\"That's All Folks\"\"?\"\nQuestion 7: Which Native American Indian tribe bought the Hard Rock chain for a reputed $965m in 2006?\nQuestion 8: Yellowknife, the capital of Canada's North West Territories, lies on the shore of which lake?\nQuestion 9: What kooky movie character, portrayed by Johnny Depp, was skilled at topiary?\nQuestion 10: ‘Connubial’ relates to which type of relationship?\nQuestion 11: Which actor played the role of Admiral Harriman Nelson in the 1960's TV series Voyage to the Bottom of the Sea?\nQuestion 12: The rhea is a large South American species of?\nQuestion 13: Who was the Archbishop of Canterbury when women were first ordained as priests into the Church of England?\nQuestion 14: The Pacific Islands nation of Tuvalu was known by which name until becoming independent in 1974?\nQuestion 15: What is the name of the 1971 Spielberg film which pits Dennis Weaver against an unseen truck driver?", "role": "user" } ]
["[\"Bull Pen\", \"Bullpen\", \"Bull pens\"]", "[\"Ellin Mackay\", \"Irving Berlin\", \"Marie (Irving Berlin song)\", \"I Love a Piano\", \"Israel Baline\", \"Israel Isadore Baline\", \"Israel Isidore Baline\"]", "[\"Elbows\", \"Elbow Joint\", \"Carrying angle\", \"Cubital angle\", \"ELBOW\", \"Elbow examination\", \"Elbow-joint\", \"Elbow joint\", \"Anconal\", \"Elbow\", \"Cubital joint\", \"Articulatio cubiti\"]", "[\"Milliroentgen (mR)\", \"Milliroentgen\", \"Roentgen (unit)\", \"Roentgen (R)\", \"R\\u00f6ntgens\", \"Roentgens\", \"R\\u00f6ntgen (unit)\", \"\\u039cR/h\", \"RoNtgen\", \"Roentgen unit\", \"Rontgen\"]", "[\"Marlon Brando Jr.\", \"Marlon brando\", \"Marlon Brando Jr\", \"Marlin Brando\", \"Marlon Brando, Jr.\", \"Brandoesque\", \"Marlon Brando\", \"Brando family\"]", "[\"The Man of a Thousand Voices\", \"Sy, the Little Mexican\", \"Melvin Jerome Blank\", \"Professor LeBlanc\", \"Melvin Jerome Blanc\", \"Mel Blanc\", \"Mel Blank\", \"Melvin Jerome %22Mel%22 Blanc\", \"Melvin Blanc\"]", "[\"Seminoles\", \"Seminole Nation\", \"Seminole\", \"Siman\\u00f3\\u02d9li\", \"Seminole people\", \"Seminole Indian\", \"Seminole (tribe)\", \"Seminole Tribe\", \"Seminole Indians\", \"Seminole tribe\"]", "[\"Grand lac des Esclaves\", \"Great slave lake\", \"GREAT SLAVE LAKE\", \"Great Slave Lake\", \"Athupusco\", \"Lake Great Slave\"]", "[\"Edward ScissorHands\", \"Edward Scissorhands\", \"Edward scissorhands\", \"Edward Scissor Hands\", \"Edward Scissorhands (character)\"]", "[\"Marraige\", \"Husband and wife\", \"Definition of marriage\", \"Marrying\", \"Legally married\", \"Married couple\", \"Marriages\", \"Marrage\", \"History of marriage\", \"Marriage (traditional)\", \"Husband And Wife\", \"Till death do we part\", \"Get hitched\", \"Nuptiality\", \"\\u26ad\", \"Secular wedding\", \"Connubial\", \"Wedlocks\", \"Getting hitched\", \"Heterosexual marriage\", \"Hong Kong wedding style\", \"Bonds of matrimony\", \"Tying the knot\", \"Matrimony\", \"Institution of marriage\", \"Marrige\", \"Marry\", \"Married\", \"Hypergyny\", \"Marriage, History of\", \"Marriage rates\", \"Marriage\", \"Marital relationship\", \"Deuterogamist\", \"Marries\", \"Marriage, Civil\", \"Matrimonial\", \"Origins of marriage\", \"Husband and Wife\", \"Isogyny\", \"Non-confessional marriage\", \"Conjugal affinity\", \"Marital\", \"Matrimonially\", \"Religious aspects of marriage\", \"Redefinition of marriage\", \"-gamy\", \"Contract of marriage\", \"History of Marriage\", \"Married couples\", \"Marital bed\"]", "[\"Richard Basehart\", \"RICHARD BASEHART\"]", "[\"Flightless bird\", \"Flightless Birds\", \"Birds unable to fly\", \"Flightless birds\", \"Non-volant\", \"Flightless\"]", "[\"George Leonard Carey, Baron Carey of Clifton\", \"George Carey\", \"Baron Carey of Clifton\", \"George Carey, Baron Carey of Clifton\", \"Lord Carey of Clifton\", \"George Leonard Carey\", \"The Lord Carey of Clifton\", \"George L. Carey\", \"Lord Carey\"]", "[\"Lagoon Islands\", \"THE ELLICE ISLANDS\", \"Water supply and sanitation in Tuvalu\", \"Transportation in Tuvalu\", \"Ellis Islands\", \"ISO 3166-1:TV\", \"Impact of climate change in Tuvalu\", \"Culture of Tuvalu\", \"Tuvalu\", \"Eight standing together\", \"Tuvalo\", \"Tuvalu/Transportation\", \"Tourism in Tuvalu\", \"Tuvalu/Transnational issues\", \"Transport in Tuvalu\", \"Tuvalu Islands\", \"Toovaloo\", \"Tuvalu islands\", \"Ellice Islands\", \"Tepuka Savilivili\", \"Sport in Tuvalu\", \"Nivalakita\", \"Ellice Island\", \"Education in Tuvalu\"]", "[\"Dueling sword\", \"European dueling sword\", \"Duel\", \"European duelling sword\", \"Duels\", \"European dueling swords\", \"Weapon duel\", \"Single fight\", \"Duelling sword\", \"Pistol duel\", \"Dueling\", \"Second (duel)\", \"Final duel\", \"Duelist (occupation)\", \"Duelling\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Bull Pen\", \"Bullpen\", \"Bull pens\"]", "[\"Ellin Mackay\", \"Irving Berlin\", \"Marie (Irving Berlin song)\", \"I Love a Piano\", \"Israel Baline\", \"Israel Isadore Baline\", \"Israel Isidore Baline\"]", "[\"Elbows\", \"Elbow Joint\", \"Carrying angle\", \"Cubital angle\", \"ELBOW\", \"Elbow examination\", \"Elbow-joint\", \"Elbow joint\", \"Anconal\", \"Elbow\", \"Cubital joint\", \"Articulatio cubiti\"]", "[\"Milliroentgen (mR)\", \"Milliroentgen\", \"Roentgen (unit)\", \"Roentgen (R)\", \"R\\u00f6ntgens\", \"Roentgens\", \"R\\u00f6ntgen (unit)\", \"\\u039cR/h\", \"RoNtgen\", \"Roentgen unit\", \"Rontgen\"]", "[\"Marlon Brando Jr.\", \"Marlon brando\", \"Marlon Brando Jr\", \"Marlin Brando\", \"Marlon Brando, Jr.\", \"Brandoesque\", \"Marlon Brando\", \"Brando family\"]", "[\"The Man of a Thousand Voices\", \"Sy, the Little Mexican\", \"Melvin Jerome Blank\", \"Professor LeBlanc\", \"Melvin Jerome Blanc\", \"Mel Blanc\", \"Mel Blank\", \"Melvin Jerome %22Mel%22 Blanc\", \"Melvin Blanc\"]", "[\"Seminoles\", \"Seminole Nation\", \"Seminole\", \"Siman\\u00f3\\u02d9li\", \"Seminole people\", \"Seminole Indian\", \"Seminole (tribe)\", \"Seminole Tribe\", \"Seminole Indians\", \"Seminole tribe\"]", "[\"Grand lac des Esclaves\", \"Great slave lake\", \"GREAT SLAVE LAKE\", \"Great Slave Lake\", \"Athupusco\", \"Lake Great Slave\"]", "[\"Edward ScissorHands\", \"Edward Scissorhands\", \"Edward scissorhands\", \"Edward Scissor Hands\", \"Edward Scissorhands (character)\"]", "[\"Marraige\", \"Husband and wife\", \"Definition of marriage\", \"Marrying\", \"Legally married\", \"Married couple\", \"Marriages\", \"Marrage\", \"History of marriage\", \"Marriage (traditional)\", \"Husband And Wife\", \"Till death do we part\", \"Get hitched\", \"Nuptiality\", \"\\u26ad\", \"Secular wedding\", \"Connubial\", \"Wedlocks\", \"Getting hitched\", \"Heterosexual marriage\", \"Hong Kong wedding style\", \"Bonds of matrimony\", \"Tying the knot\", \"Matrimony\", \"Institution of marriage\", \"Marrige\", \"Marry\", \"Married\", \"Hypergyny\", \"Marriage, History of\", \"Marriage rates\", \"Marriage\", \"Marital relationship\", \"Deuterogamist\", \"Marries\", \"Marriage, Civil\", \"Matrimonial\", \"Origins of marriage\", \"Husband and Wife\", \"Isogyny\", \"Non-confessional marriage\", \"Conjugal affinity\", \"Marital\", \"Matrimonially\", \"Religious aspects of marriage\", \"Redefinition of marriage\", \"-gamy\", \"Contract of marriage\", \"History of Marriage\", \"Married couples\", \"Marital bed\"]", "[\"Richard Basehart\", \"RICHARD BASEHART\"]", "[\"Flightless bird\", \"Flightless Birds\", \"Birds unable to fly\", \"Flightless birds\", \"Non-volant\", \"Flightless\"]", "[\"George Leonard Carey, Baron Carey of Clifton\", \"George Carey\", \"Baron Carey of Clifton\", \"George Carey, Baron Carey of Clifton\", \"Lord Carey of Clifton\", \"George Leonard Carey\", \"The Lord Carey of Clifton\", \"George L. Carey\", \"Lord Carey\"]", "[\"Lagoon Islands\", \"THE ELLICE ISLANDS\", \"Water supply and sanitation in Tuvalu\", \"Transportation in Tuvalu\", \"Ellis Islands\", \"ISO 3166-1:TV\", \"Impact of climate change in Tuvalu\", \"Culture of Tuvalu\", \"Tuvalu\", \"Eight standing together\", \"Tuvalo\", \"Tuvalu/Transportation\", \"Tourism in Tuvalu\", \"Tuvalu/Transnational issues\", \"Transport in Tuvalu\", \"Tuvalu Islands\", \"Toovaloo\", \"Tuvalu islands\", \"Ellice Islands\", \"Tepuka Savilivili\", \"Sport in Tuvalu\", \"Nivalakita\", \"Ellice Island\", \"Education in Tuvalu\"]", "[\"Dueling sword\", \"European dueling sword\", \"Duel\", \"European duelling sword\", \"Duels\", \"European dueling swords\", \"Weapon duel\", \"Single fight\", \"Duelling sword\", \"Pistol duel\", \"Dueling\", \"Second (duel)\", \"Final duel\", \"Duelist (occupation)\", \"Duelling\"]" ]
[ "What is the name of the area where baseball relief pitchers warm up?", "\"Who wrote the song \"\"God bless America\"\"?\"", "Guy Garvey is a singer with which band?", "Who discovered, in 1895, that X Rays could be applied to medicine?", "Who played Don Vito Corleone in the 1972 film The Godfather?", "\"Whose epitaph on his tombstone reads \"\"That's All Folks\"\"?\"", "Which Native American Indian tribe bought the Hard Rock chain for a reputed $965m in 2006?", "Yellowknife, the capital of Canada's North West Territories, lies on the shore of which lake?", "What kooky movie character, portrayed by Johnny Depp, was skilled at topiary?", "‘Connubial’ relates to which type of relationship?", "Which actor played the role of Admiral Harriman Nelson in the 1960's TV series Voyage to the Bottom of the Sea?", "The rhea is a large South American species of?", "Who was the Archbishop of Canterbury when women were first ordained as priests into the Church of England?", "The Pacific Islands nation of Tuvalu was known by which name until becoming independent in 1974?", "What is the name of the 1971 Spielberg film which pits Dennis Weaver against an unseen truck driver?" ]
15
[ 124845, 124846, 124847, 124848, 124849, 124850, 124851, 124852, 124853, 124854, 124855, 124856, 124857, 124858, 124859 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What is the maximum permitted length of an entry in the Eurovision Song Contest?\nQuestion 2: Who wrote children's books featuring Noddy and Big Ears, and the Famous Five?\nQuestion 3: Which colour/color is generally considered between violet and green in the optical spectrum?\nQuestion 4: Who developed bifocal spectacles in 1784?\nQuestion 5: In astronomy and metaphorical language what is the opposite of zenith?\nQuestion 6: Apart from Stoke on Trent which is Staffordshire's only other city?\nQuestion 7: Who painted Portrait of Adele Bloch-Bauer in 1907, sold in 2006 for $135 million?\nQuestion 8: What was the middle name of Mark Chapman, John Lennon’s killer?\nQuestion 9: The Bridge of Sighs was given its name by Lord Byron from the suggestion that prisoners would sigh at their final view of which beautiful city out of its window before being taken to their cells?\nQuestion 10: The asteroid belt is a series of rocks that orbit the sun between Mars and which other planet?\nQuestion 11: What is the name of a family of satellites launched since 1995 and operated by Eutelsat, located at 13E over the Equator (orbital position) with a transmitting footprint over Europe, North Africa and the Middle East?\nQuestion 12: Dermatitis affects what part of the body?\nQuestion 13: Which cartoon character was born at the Daisy Hill Puppy Farm?\nQuestion 14: If a skateboarder is ‘goofy-footed’, which foot is closest to the front of the board?\nQuestion 15: Which nuts are traditionally given as ‘Wedding Favours’ to a bride’s guests?", "role": "user" } ]
["[\"Three Minutes (Lost)\", \"Three Minutes\"]", "[\"The Little lose hen\", \"Blyton, Enid\", \"Enid Blyton's Short-Stories\", \"Enid Bylton\", \"Little lost hen\", \"The little lost hen\", \"The Little Lost Hen\", \"Enid Mary Blyton\", \"Mary Pollock\", \"Enid Blighton\", \"Enid blyton\", \"Enid Blyton's short stories\", \"Enid Blyton\"]", "[\"Blue\", \"Rgb(0, 0, 255)\", \"Orphan blue\", \"Slate Blue (color)\", \"Bluishness\", \"Dark Blue (color)\", \"Pale Blue\", \"Blue in human culture\", \"Blue (color)\", \"Police car blue\", \"Blue (Colour)\", \"Blueishness\", \"List of terms associated with the color blue\", \"Caspian blue\", \"Blue (colour)\", \"Light-blue\", \"Bluest\", \"Bluish\", \"Bluishly\", \"(0, 0, 255)\", \"Blueishly\", \"Bluer\", \"Blae\", \"Blueness\"]", "[\"A Tradesman of Philidelphia\", \"Bin Franklin\", \"Abigail Afterwit\", \"The Busybody\", \"Anthony Afterwit\", \"Betty Diligent\", \"Benjamin Franklin\", \"The Benjamin Franklin\", \"Franklinian\", \"Friend to the Poor\", \"Ben Franlkin\", \"Bejamin franklin\", \"Alice Addertongue\", \"Sage of the Constitutional Convention\", \"Franklinic\", \"Benjamin franklin\", \"Those who would give up Essential Liberty\", \"Ben Franklin\", \"B franklin\", \"The Benjamin Franklin Bust\", \"B. Franklin\", \"Abigail Twitterfield\", \"Benjamin (Ben) Franklin\", \"Ben franklin\", \"Sidi Mehemet Ibrahim\", \"B Franklin\"]", "[\"Nadir\", \"Nadirs\"]", "[\"Licidfelth\", \"Lichfield\", \"Lichfield City\", \"Netherstowe high school\", \"City of Lichfield\", \"LICHFIELD\", \"Municipal Borough of Lichfield\", \"Lichfield (city)\"]", "[\"Gustav klimt\", \"Gustav Klimpt\", \"Die Hoffnung\", \"Klimt\", \"Gustav Klimmt\", \"Gustav Klimt\", \"Gustov Klimt\", \"Gustoff Climt\", \"Gustaf Klimt\", \"Gustave Klimt\", \"Klimtian\", \"Gustav Kilmt\"]", "[\"D\\u00e1vid (name)\", \"Dawidh\", \"David (name)\", \"Yeshay\", \"David's throne\", \"Daevid\", \"Da'oud\", \"Yeshai\", \"DAVID\", \"Davidh\", \"David (given name)\", \"Davut\", \"David (surname)\", \"Dawood (name)\", \"Musical Instruments of King David\", \"Dafydd\", \"Dovid\", \"Da'ud\", \"Dawud (name)\"]", "[\"Sestiere (Venice)\", \"Venice\", \"Venedig\", \"Districts of Venice\", \"Venesia\", \"Venice, Italy\", \"Venice subsidence\", \"Venices\", \"Venezia\", \"Venice (Italy)\", \"UN/LOCODE:ITVCE\", \"The weather in Venice\", \"Vinegia\"]", "[\"Physical characteristics of Jupiter\", \"Sol 5\", \"Jupiter (astronomy)\", \"Weight of Jupiter\", \"Life on Jupiter\", \"Jupitor\", \"Planet Jupiter\", \"Wood Star\", \"Jupiter (Planet)\", \"Jovian diameter\", \"Jupiter!\", \"Mass of Jupiter\", \"Astronomy Jupiter\", \"Zenography\", \"Jupiter (planet)\", \"Jupiter's\", \"\\u2643\", \"Sol-5\", \"Jovian orbit\", \"The mass of Jupiter\", \"Sun f\", \"Sol f\", \"Jupiter weight\", \"Jupiter(planet)\", \"The weight of Jupiter\", \"Sol V\", \"Jupiter's radio emissions\", \"Jupiter\", \"Jupiter radius\", \"Jupitero\"]", "[\"Hot Bird 1\", \"HOT BIRD\", \"Hot Bird 3\", \"Hot Bird 5\", \"Hot Bird 2\", \"Hot Bird 7A\", \"Hot Bird\", \"Hotbird\"]", "[\"Animal skin\", \"Skin cell turnover\", \"Cutaneous fold\", \"Skin cells\", \"Silver salts in the skin\", \"Cutaneous\", \"Skin cell\", \"Skin\"]", "[\"Snoopie\", \"Snoopy dog\", \"Daisy Hill Puppy Farm\", \"Snoopy\"]", "[\"Left foot\", \"Right footed\", \"Footedness\", \"Boarding stance\", \"Left-footed\", \"Right-footed\", \"Right foot\", \"Switch-stance\", \"Goofy-foot\", \"Goofy stance\", \"Regular foot\", \"Left footed\", \"Mongo foot\", \"Switch Stance\", \"Goofy foot\", \"Switch stance\", \"Regular stance\", \"Left-footer\"]", "[\"Almond tree\", \"Luz (nut)\", \"Amygdalus amara\", \"Almond oil\", \"Marcona almonds\", \"Mandel (nut)\", \"Badam\", \"Almond Bitter Oil\", \"Prunus dulcis\", \"Almond trees\", \"Amygdalus communis\", \"Almendrado\", \"Amygdalus dulcis\", \"Marcona Almonds\", \"Prunus amygdalus dulcis\", \"Druparia amygdalus\", \"Marcona almond\", \"Marcona Almond\", \"Prunus amygdalus\", \"Almond extract\", \"Amygdalus fragilis\", \"Amygdalus sativa\", \"Baadaam\", \"Oil of bitter almond\", \"Toasted Almond\", \"Oleum amygdalae\", \"Bitter almonds\", \"Sweet almond oil\", \"Almond\", \"\\u0644\\u0648\\u0632\", \"Almonds\", \"Oil of Bitter Almonds\", \"Almond syrup\", \"Bitter almond\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Three Minutes (Lost)\", \"Three Minutes\"]", "[\"The Little lose hen\", \"Blyton, Enid\", \"Enid Blyton's Short-Stories\", \"Enid Bylton\", \"Little lost hen\", \"The little lost hen\", \"The Little Lost Hen\", \"Enid Mary Blyton\", \"Mary Pollock\", \"Enid Blighton\", \"Enid blyton\", \"Enid Blyton's short stories\", \"Enid Blyton\"]", "[\"Blue\", \"Rgb(0, 0, 255)\", \"Orphan blue\", \"Slate Blue (color)\", \"Bluishness\", \"Dark Blue (color)\", \"Pale Blue\", \"Blue in human culture\", \"Blue (color)\", \"Police car blue\", \"Blue (Colour)\", \"Blueishness\", \"List of terms associated with the color blue\", \"Caspian blue\", \"Blue (colour)\", \"Light-blue\", \"Bluest\", \"Bluish\", \"Bluishly\", \"(0, 0, 255)\", \"Blueishly\", \"Bluer\", \"Blae\", \"Blueness\"]", "[\"A Tradesman of Philidelphia\", \"Bin Franklin\", \"Abigail Afterwit\", \"The Busybody\", \"Anthony Afterwit\", \"Betty Diligent\", \"Benjamin Franklin\", \"The Benjamin Franklin\", \"Franklinian\", \"Friend to the Poor\", \"Ben Franlkin\", \"Bejamin franklin\", \"Alice Addertongue\", \"Sage of the Constitutional Convention\", \"Franklinic\", \"Benjamin franklin\", \"Those who would give up Essential Liberty\", \"Ben Franklin\", \"B franklin\", \"The Benjamin Franklin Bust\", \"B. Franklin\", \"Abigail Twitterfield\", \"Benjamin (Ben) Franklin\", \"Ben franklin\", \"Sidi Mehemet Ibrahim\", \"B Franklin\"]", "[\"Nadir\", \"Nadirs\"]", "[\"Licidfelth\", \"Lichfield\", \"Lichfield City\", \"Netherstowe high school\", \"City of Lichfield\", \"LICHFIELD\", \"Municipal Borough of Lichfield\", \"Lichfield (city)\"]", "[\"Gustav klimt\", \"Gustav Klimpt\", \"Die Hoffnung\", \"Klimt\", \"Gustav Klimmt\", \"Gustav Klimt\", \"Gustov Klimt\", \"Gustoff Climt\", \"Gustaf Klimt\", \"Gustave Klimt\", \"Klimtian\", \"Gustav Kilmt\"]", "[\"D\\u00e1vid (name)\", \"Dawidh\", \"David (name)\", \"Yeshay\", \"David's throne\", \"Daevid\", \"Da'oud\", \"Yeshai\", \"DAVID\", \"Davidh\", \"David (given name)\", \"Davut\", \"David (surname)\", \"Dawood (name)\", \"Musical Instruments of King David\", \"Dafydd\", \"Dovid\", \"Da'ud\", \"Dawud (name)\"]", "[\"Sestiere (Venice)\", \"Venice\", \"Venedig\", \"Districts of Venice\", \"Venesia\", \"Venice, Italy\", \"Venice subsidence\", \"Venices\", \"Venezia\", \"Venice (Italy)\", \"UN/LOCODE:ITVCE\", \"The weather in Venice\", \"Vinegia\"]", "[\"Physical characteristics of Jupiter\", \"Sol 5\", \"Jupiter (astronomy)\", \"Weight of Jupiter\", \"Life on Jupiter\", \"Jupitor\", \"Planet Jupiter\", \"Wood Star\", \"Jupiter (Planet)\", \"Jovian diameter\", \"Jupiter!\", \"Mass of Jupiter\", \"Astronomy Jupiter\", \"Zenography\", \"Jupiter (planet)\", \"Jupiter's\", \"\\u2643\", \"Sol-5\", \"Jovian orbit\", \"The mass of Jupiter\", \"Sun f\", \"Sol f\", \"Jupiter weight\", \"Jupiter(planet)\", \"The weight of Jupiter\", \"Sol V\", \"Jupiter's radio emissions\", \"Jupiter\", \"Jupiter radius\", \"Jupitero\"]", "[\"Hot Bird 1\", \"HOT BIRD\", \"Hot Bird 3\", \"Hot Bird 5\", \"Hot Bird 2\", \"Hot Bird 7A\", \"Hot Bird\", \"Hotbird\"]", "[\"Animal skin\", \"Skin cell turnover\", \"Cutaneous fold\", \"Skin cells\", \"Silver salts in the skin\", \"Cutaneous\", \"Skin cell\", \"Skin\"]", "[\"Snoopie\", \"Snoopy dog\", \"Daisy Hill Puppy Farm\", \"Snoopy\"]", "[\"Left foot\", \"Right footed\", \"Footedness\", \"Boarding stance\", \"Left-footed\", \"Right-footed\", \"Right foot\", \"Switch-stance\", \"Goofy-foot\", \"Goofy stance\", \"Regular foot\", \"Left footed\", \"Mongo foot\", \"Switch Stance\", \"Goofy foot\", \"Switch stance\", \"Regular stance\", \"Left-footer\"]", "[\"Almond tree\", \"Luz (nut)\", \"Amygdalus amara\", \"Almond oil\", \"Marcona almonds\", \"Mandel (nut)\", \"Badam\", \"Almond Bitter Oil\", \"Prunus dulcis\", \"Almond trees\", \"Amygdalus communis\", \"Almendrado\", \"Amygdalus dulcis\", \"Marcona Almonds\", \"Prunus amygdalus dulcis\", \"Druparia amygdalus\", \"Marcona almond\", \"Marcona Almond\", \"Prunus amygdalus\", \"Almond extract\", \"Amygdalus fragilis\", \"Amygdalus sativa\", \"Baadaam\", \"Oil of bitter almond\", \"Toasted Almond\", \"Oleum amygdalae\", \"Bitter almonds\", \"Sweet almond oil\", \"Almond\", \"\\u0644\\u0648\\u0632\", \"Almonds\", \"Oil of Bitter Almonds\", \"Almond syrup\", \"Bitter almond\"]" ]
[ "What is the maximum permitted length of an entry in the Eurovision Song Contest?", "Who wrote children's books featuring Noddy and Big Ears, and the Famous Five?", "Which colour/color is generally considered between violet and green in the optical spectrum?", "Who developed bifocal spectacles in 1784?", "In astronomy and metaphorical language what is the opposite of zenith?", "Apart from Stoke on Trent which is Staffordshire's only other city?", "Who painted Portrait of Adele Bloch-Bauer in 1907, sold in 2006 for $135 million?", "What was the middle name of Mark Chapman, John Lennon’s killer?", "The Bridge of Sighs was given its name by Lord Byron from the suggestion that prisoners would sigh at their final view of which beautiful city out of its window before being taken to their cells?", "The asteroid belt is a series of rocks that orbit the sun between Mars and which other planet?", "What is the name of a family of satellites launched since 1995 and operated by Eutelsat, located at 13E over the Equator (orbital position) with a transmitting footprint over Europe, North Africa and the Middle East?", "Dermatitis affects what part of the body?", "Which cartoon character was born at the Daisy Hill Puppy Farm?", "If a skateboarder is ‘goofy-footed’, which foot is closest to the front of the board?", "Which nuts are traditionally given as ‘Wedding Favours’ to a bride’s guests?" ]
15
[ 58710, 58711, 58712, 58713, 58714, 58715, 58716, 58717, 58718, 58719, 58720, 58721, 58722, 58723, 58724 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Argentum is Latin for which chemical element?\nQuestion 2: \"Which Italian foodstuff which comprises of dumplings made of flour, semolina or potatoes boiled or baked and served with grated cheese or sauce takes it’s name from the Italian for \"\"Knock On Wood\"\" ?\"\nQuestion 3: The longest serving and first flying space shuttle, which vehicle was lost on re-entry during mission STS-107 on Feb 1, 2003?\nQuestion 4: What CNN news anchor was the “moderator” of yesterday’s presidential debate at Hofstra University in NY?\nQuestion 5: Tatiana Day is celebrated in January in which country?\nQuestion 6: What candy company is responsible for M&Ms, Milky Way, Snickers, and Twix bars, among others?\nQuestion 7: What number completes the title of the last book in Arthur C. Clarke's 'Space Odyssey' series: '...... The Final Odyssey'?\nQuestion 8: Connie Fisher won a TV competition to find the lead for Andrew Lloyd Webber's production of which musical?\nQuestion 9: Wembley Stadium is in what city?\nQuestion 10: What links a village in Oxfordshire, a game show that was presented by Jasper Carrott, and David Beckham?\nQuestion 11: Which method of strangulation was once the official method of execution in Spain?\nQuestion 12: What was the cause of an epidemic of 355 cases (46% fatal) between March and June 2010 in Zamfara State, Nigeria?\nQuestion 13: What is the nickname of the character Henrietta played by Anna Chancellor in the film Four Weddings and a Funeral?\nQuestion 14: How high should a badminton net be at the centre?\nQuestion 15: \"Whose 2010 biography was called \"\"Elephant to Hollywood\"\"?\"", "role": "user" } ]
["[\"ATC code D08AL30\", \"Ag+\", \"Element 47\", \"Argentical\", \"Silvermounted\", \"Silver mounted\", \"Silvern\", \"Silveriness\", \"Silverily\", \"\\ud83d\\udf1b\", \"Silver ions\", \"Argentate\", \"Native silver\", \"Argentic\", \"Element XLVII\", \"Argentically\", \"Silver processing\", \"Argentous\", \"Silver\", \"Silver compounds\", \"7440-22-4\", \"Silver (element)\", \"ATCvet code QD08AL30\", \"Silver-mounted\", \"E174\", \"Timcanpi\", \"Silverly\", \"Silverness\", \"Argentum\", \"Silver metallurgy\", \"Edible silver\", \"Silver (metal)\"]", "[\"Gnocco\", \"Gnocchetti\", \"GNOCCHI\", \"Gnocchi\", \"Gnocci\"]", "[\"Columbia\", \"Columbia (municipality)\", \"Columbia (song)\", \"Columbia automobile\", \"Columbia (yacht)\", \"Columbia (disambiguation)\", \"Columbia (town)\"]", "[\"Candy Crowley\", \"Candy A. Crowley\", \"Candy Alt Crowley\"]", "[\"Russia (1991-1993)\", \"\\u041e\\u0440\\u043e\\u0441\\u044b\\u043d \\u0425\\u043e\\u043b\\u0431\\u043e\\u043e\\u043d\\u044b \\u0423\\u043b\\u0441\", \"Etymology of Russia\", \"The Russian federation\", \"\\u0420\\u04d9\\u0441\\u04d9\\u0439\", \"ISO 3166-1:RU\", \"Russia (1990-1993)\", \"\\u0420\\u0435\\u0441\\u0435\\u0439\", \"Novaya russia\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0301\\u044f\", \"\\u0420\\u0430\\u04ab\\u04ab\\u0435\\u0439\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0439\\u0441\\u043a\\u0430\\u044f \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0446\\u0438\\u044f\", \"Poccnr\", \"\\u0420\\u043e\\u0441\\u0456\\u044f\", \"\\u041e\\u0440\\u043e\\u0434\\u043e\\u0439 \\u0425\\u043e\\u043b\\u0431\\u043e\\u043e\\u043d\\u043e\\u0439 \\u0423\\u043b\\u0430\\u0441\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0438\", \"The Russian Federation\", \"Russsia\", \"Russian (citizen)\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0301\\u0439\\u0441\\u043a\\u0430\\u044f \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0301\\u0446\\u0438\\u044f\", \"\\u0423\\u0440\\u044b\\u0441\\u0435\\u0439\", \"\\u0410\\u0440\\u0430\\u0441\\u0441\\u044b\\u044b\\u0439\\u0430\", \"Rossiyskaya Federatsiya\", \"\\u041e\\u044c\\u0440\\u0441\\u0438\\u0439\\u043d \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0446\\u0438\\u0439\", \"Russian-born\", \"\\u0410\\u044c\\u0440\\u0430\\u0441\\u0430\\u0442\", \"Russia (Federation)\", \"POCCNR\", \"Northern Russia\", \"Federation of Russia\", \"Russia (country)\", \"\\u0420\\u043e\\u0447\\u043c\\u0443\", \"\\u0420\\u0435\\u0441\\u0435\\u0439 \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0446\\u0438\\u044f\\u0441\\u044b\", \"Venaja\", \"\\u0420\\u0443\\u0441\\u0438\\u044f\", \"\\u0423\\u0440\\u044b\\u0441\\u0442\\u04d9\\u044b\\u043b\\u0430\", \"Resey\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u044f\", \"Wildlife of Russia\", \"The Country Russia\", \"\\u0423\\u00e6\\u0440\\u00e6\\u0441\\u0435\", \"Venaejae\", \"Russian federation\", \"Russie\", \"Russia\", \"Rossijskaja Federatsija\", \"RUSSIA\", \"Ryssland\", \"Russian Federation\", \"Russiya\", \"\\u0420\\u0443\\u0441\\u0438\\u0458\\u0430\", \"RusSia\", \"\\u041e\\u0440\\u0441\\u0438\\u043d \\u041d\\u0438\\u0438\\u0446\\u04d9\\u043d\", \"Russland\", \"\\u0420\\u0443\\u0437\\u043c\\u0430\\u0441\\u0442\\u043e\\u0440\", \"RussiA\"]", "[\"Fourth planet\", \"Sol 4\", \"Mars surface features\", \"Mars\", \"Mars/Planet\", \"Hydrology of Mars\", \"Magnetosphere of Mars\", \"Marte (planet)\", \"Mars (planet)\", \"Sol-4\", \"2003 opposition of Mars\", \"4th planet\", \"Planet Mars\", \"Sun e\", \"Sol e\", \"Mars (Planet)\", \"Physical characteristics of Mars\", \"Mars opposition\", \"Sol IV\", \"Oblate Mars\", \"Opposition of Mars\", \"Mars orbit\"]", "[\"3520s\", \"3230s\", \"XXXIII century\", \"3499\", \"3440s\", \"3380s\", \"3750s\", \"3090s\", \"3880s\", \"3860s\", \"3650\", \"3799\", \"3970s\", \"3797\", \"3150s\", \"3710s\", \"3999\", \"3300s\", \"3010s\", \"3650s\", \"3820s\", \"3270s\", \"3400s\", \"3570s\", \"3401\", \"3480s\", \"3648\", \"3647\", \"3646\", \"3950s\", \"4th millennium CE\", \"3180s\", \"3430s\", \"3006\", \"35th century\", \"3050s\", \"3610s\", \"3680s\", \"3120s\", \"3720s\", \"3910s\", \"3450s\", \"3210s\", \"3070s\", \"3100s\", \"3870s\", \"31st century\", \"3300\", \"3200s\", \"3960s\", \"32nd century\", \"3590s\", \"3280s\", \"3740s\", \"37th century\", \"3389\", \"3330s\", \"40th century\", \"3830s\", \"3020s\", \"3410s\", \"3560s\", \"3170s\", \"3140s\", \"3370s\", \"3790s\", \"3620s\", \"3940s\", \"3467\", \"3399\", \"3840s\", \"3010\", \"3190s\", \"3690s\", \"3060s\", \"3660s\", \"3900s\", \"3110s\", \"3099\", \"3340s\", \"3000s\", \"3990s\", \"33rd century\", \"3599\", \"3800\", \"3360s\", \"34th century\", \"3005\", \"3004\", \"3007\", \"3001 (year)\", \"3001\", \"3299\", \"3003\", \"3002\", \"3009\", \"3008\", \"3460s\", \"3699\", \"3770s\", \"3670s\", \"3800s\", \"3899\", \"3580s\", \"3510s\", \"3290s\", \"38th century\", \"3601\", \"3600\", \"3780s\", \"3130s\", \"3320s\", \"3890s\", \"3030s\", \"36th century\", \"3550s\", \"3850s\", \"3688\", \"3201\", \"3200\", \"3630s\", \"3730s\", \"3700s\", \"3930s\", \"4th millennium AD\", \"3501\", \"'3001'\", \"3240s\", \"3900\", \"3470s\", \"3490s\", \"3530s\", \"3220s\", \"3065\", \"3390s\", \"3080s\", \"3980s\", \"3606\", \"3310s\", \"3810s\", \"3640s\", \"3100\", \"3101\", \"3102\", \"3500s\", \"3160s\", \"3760s\", \"3301\", \"Fourth millennium\", \"3350s\", \"3260s\", \"3500\", \"3540s\", \"3059\", \"3700\", \"4th millennium\", \"3040s\", \"3600s\", \"3920s\", \"3400\", \"39th century\", \"3250s\", \"3901\", \"3420s\", \"3199\"]", "[\"The Sound of Music (play)\", \"The sound of music\", \"Sound of Music\", \"The Sound Of Music\", \"The Sound of Music\", \"Sound Of Music\", \"So Long Farewell\", \"Sound of music\", \"Sound Of music\"]", "[\"London (UK)\", \"Climate in London\", \"London (England)\", \"London England\", \"Lodnon\", \"Wongdon\", \"Londyn\", \"London\", \"Climate of London\", \"LONDON\", \"London Britain\", \"England London\", \"London, Greater London\", \"Capital of the UK\", \"Londonshire\", \"Climate of london\", \"Capital of the United Kingdom\", \"London UK\", \"Londra\", \"London (United Kingdom)\", \"London,England\", \"London, England, UK\", \"United Kingdom/London\", \"London (Great Britain)\", \"Londonize\", \"Capital of England\", \"London, UK\", \"The Metropolis\", \"UN/LOCODE:GBLON\", \"Londonise\", \"London's\", \"London (Britain)\", \"London, England\", \"Lund\\u00fanir\", \"London area\", \"London, Great Britain\", \"London-on-Thames\", \"Southwest London\", \"The metropolis\", \"Londontown\", \"London england\", \"Weather in London\", \"London, England, United Kingdom\", \"Llundain\", \"London, U.K.\", \"London, england\", \"London, United Kingdom\", \"GBLON\", \"London weather\", \"London, Britain\", \"Lundein\", \"Lundunir\"]", "[\"Goldenballs\", \"GoldenBalls\", \"Golden Balls\"]", "[\"Garrote\", \"Garrot\", \"Garrotte\", \"Fibre wire\", \"Fiber wire\", \"Garrote Wire\", \"Garotte\", \"Garrotted\", \"Garrote vil\", \"Garroting\"]", "[\"Lead pollution\", \"Painter's colic\", \"Plumbism\", \"Chronic lead exposure\", \"Lead neuropathy\", \"Lead poisoning\", \"Lead intoxication\", \"Lead neurotoxicity\", \"Lead poisoning, nervous system\", \"Lead and brain damage\", \"Lead toxicity\", \"Lead Poisoning\", \"Saturnism\"]", "[\"Duckface\", \"DUCKFACE\", \"Duck face\"]", "[\"1.524 metres (5 ft)\"]", "[\"Micheal Caine\", \"Maurice Joseph Micklewhite\", \"Sir Maurice Joseph Micklewhite, Jr.\", \"Micheal caine\", \"Caine, Michael\", \"Sir Maurice Joseph Micklewhite\", \"Mike Caine\", \"Maurice Micklewhite\", \"Sir Michael Caine\", \"Michael cane\", \"MICHAEL CAINE\", \"Michael Maurice Micklewhite\", \"Michael caine\", \"Maurice J. Micklewhite\", \"Cained\", \"Maurice Joseph Micklewhite, Jr.\", \"Michael Caine\", \"Sir Michael Caine, CBE\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"ATC code D08AL30\", \"Ag+\", \"Element 47\", \"Argentical\", \"Silvermounted\", \"Silver mounted\", \"Silvern\", \"Silveriness\", \"Silverily\", \"\\ud83d\\udf1b\", \"Silver ions\", \"Argentate\", \"Native silver\", \"Argentic\", \"Element XLVII\", \"Argentically\", \"Silver processing\", \"Argentous\", \"Silver\", \"Silver compounds\", \"7440-22-4\", \"Silver (element)\", \"ATCvet code QD08AL30\", \"Silver-mounted\", \"E174\", \"Timcanpi\", \"Silverly\", \"Silverness\", \"Argentum\", \"Silver metallurgy\", \"Edible silver\", \"Silver (metal)\"]", "[\"Gnocco\", \"Gnocchetti\", \"GNOCCHI\", \"Gnocchi\", \"Gnocci\"]", "[\"Columbia\", \"Columbia (municipality)\", \"Columbia (song)\", \"Columbia automobile\", \"Columbia (yacht)\", \"Columbia (disambiguation)\", \"Columbia (town)\"]", "[\"Candy Crowley\", \"Candy A. Crowley\", \"Candy Alt Crowley\"]", "[\"Russia (1991-1993)\", \"\\u041e\\u0440\\u043e\\u0441\\u044b\\u043d \\u0425\\u043e\\u043b\\u0431\\u043e\\u043e\\u043d\\u044b \\u0423\\u043b\\u0441\", \"Etymology of Russia\", \"The Russian federation\", \"\\u0420\\u04d9\\u0441\\u04d9\\u0439\", \"ISO 3166-1:RU\", \"Russia (1990-1993)\", \"\\u0420\\u0435\\u0441\\u0435\\u0439\", \"Novaya russia\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0301\\u044f\", \"\\u0420\\u0430\\u04ab\\u04ab\\u0435\\u0439\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0439\\u0441\\u043a\\u0430\\u044f \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0446\\u0438\\u044f\", \"Poccnr\", \"\\u0420\\u043e\\u0441\\u0456\\u044f\", \"\\u041e\\u0440\\u043e\\u0434\\u043e\\u0439 \\u0425\\u043e\\u043b\\u0431\\u043e\\u043e\\u043d\\u043e\\u0439 \\u0423\\u043b\\u0430\\u0441\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0438\", \"The Russian Federation\", \"Russsia\", \"Russian (citizen)\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0301\\u0439\\u0441\\u043a\\u0430\\u044f \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0301\\u0446\\u0438\\u044f\", \"\\u0423\\u0440\\u044b\\u0441\\u0435\\u0439\", \"\\u0410\\u0440\\u0430\\u0441\\u0441\\u044b\\u044b\\u0439\\u0430\", \"Rossiyskaya Federatsiya\", \"\\u041e\\u044c\\u0440\\u0441\\u0438\\u0439\\u043d \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0446\\u0438\\u0439\", \"Russian-born\", \"\\u0410\\u044c\\u0440\\u0430\\u0441\\u0430\\u0442\", \"Russia (Federation)\", \"POCCNR\", \"Northern Russia\", \"Federation of Russia\", \"Russia (country)\", \"\\u0420\\u043e\\u0447\\u043c\\u0443\", \"\\u0420\\u0435\\u0441\\u0435\\u0439 \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0446\\u0438\\u044f\\u0441\\u044b\", \"Venaja\", \"\\u0420\\u0443\\u0441\\u0438\\u044f\", \"\\u0423\\u0440\\u044b\\u0441\\u0442\\u04d9\\u044b\\u043b\\u0430\", \"Resey\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u044f\", \"Wildlife of Russia\", \"The Country Russia\", \"\\u0423\\u00e6\\u0440\\u00e6\\u0441\\u0435\", \"Venaejae\", \"Russian federation\", \"Russie\", \"Russia\", \"Rossijskaja Federatsija\", \"RUSSIA\", \"Ryssland\", \"Russian Federation\", \"Russiya\", \"\\u0420\\u0443\\u0441\\u0438\\u0458\\u0430\", \"RusSia\", \"\\u041e\\u0440\\u0441\\u0438\\u043d \\u041d\\u0438\\u0438\\u0446\\u04d9\\u043d\", \"Russland\", \"\\u0420\\u0443\\u0437\\u043c\\u0430\\u0441\\u0442\\u043e\\u0440\", \"RussiA\"]", "[\"Fourth planet\", \"Sol 4\", \"Mars surface features\", \"Mars\", \"Mars/Planet\", \"Hydrology of Mars\", \"Magnetosphere of Mars\", \"Marte (planet)\", \"Mars (planet)\", \"Sol-4\", \"2003 opposition of Mars\", \"4th planet\", \"Planet Mars\", \"Sun e\", \"Sol e\", \"Mars (Planet)\", \"Physical characteristics of Mars\", \"Mars opposition\", \"Sol IV\", \"Oblate Mars\", \"Opposition of Mars\", \"Mars orbit\"]", "[\"3520s\", \"3230s\", \"XXXIII century\", \"3499\", \"3440s\", \"3380s\", \"3750s\", \"3090s\", \"3880s\", \"3860s\", \"3650\", \"3799\", \"3970s\", \"3797\", \"3150s\", \"3710s\", \"3999\", \"3300s\", \"3010s\", \"3650s\", \"3820s\", \"3270s\", \"3400s\", \"3570s\", \"3401\", \"3480s\", \"3648\", \"3647\", \"3646\", \"3950s\", \"4th millennium CE\", \"3180s\", \"3430s\", \"3006\", \"35th century\", \"3050s\", \"3610s\", \"3680s\", \"3120s\", \"3720s\", \"3910s\", \"3450s\", \"3210s\", \"3070s\", \"3100s\", \"3870s\", \"31st century\", \"3300\", \"3200s\", \"3960s\", \"32nd century\", \"3590s\", \"3280s\", \"3740s\", \"37th century\", \"3389\", \"3330s\", \"40th century\", \"3830s\", \"3020s\", \"3410s\", \"3560s\", \"3170s\", \"3140s\", \"3370s\", \"3790s\", \"3620s\", \"3940s\", \"3467\", \"3399\", \"3840s\", \"3010\", \"3190s\", \"3690s\", \"3060s\", \"3660s\", \"3900s\", \"3110s\", \"3099\", \"3340s\", \"3000s\", \"3990s\", \"33rd century\", \"3599\", \"3800\", \"3360s\", \"34th century\", \"3005\", \"3004\", \"3007\", \"3001 (year)\", \"3001\", \"3299\", \"3003\", \"3002\", \"3009\", \"3008\", \"3460s\", \"3699\", \"3770s\", \"3670s\", \"3800s\", \"3899\", \"3580s\", \"3510s\", \"3290s\", \"38th century\", \"3601\", \"3600\", \"3780s\", \"3130s\", \"3320s\", \"3890s\", \"3030s\", \"36th century\", \"3550s\", \"3850s\", \"3688\", \"3201\", \"3200\", \"3630s\", \"3730s\", \"3700s\", \"3930s\", \"4th millennium AD\", \"3501\", \"'3001'\", \"3240s\", \"3900\", \"3470s\", \"3490s\", \"3530s\", \"3220s\", \"3065\", \"3390s\", \"3080s\", \"3980s\", \"3606\", \"3310s\", \"3810s\", \"3640s\", \"3100\", \"3101\", \"3102\", \"3500s\", \"3160s\", \"3760s\", \"3301\", \"Fourth millennium\", \"3350s\", \"3260s\", \"3500\", \"3540s\", \"3059\", \"3700\", \"4th millennium\", \"3040s\", \"3600s\", \"3920s\", \"3400\", \"39th century\", \"3250s\", \"3901\", \"3420s\", \"3199\"]", "[\"The Sound of Music (play)\", \"The sound of music\", \"Sound of Music\", \"The Sound Of Music\", \"The Sound of Music\", \"Sound Of Music\", \"So Long Farewell\", \"Sound of music\", \"Sound Of music\"]", "[\"London (UK)\", \"Climate in London\", \"London (England)\", \"London England\", \"Lodnon\", \"Wongdon\", \"Londyn\", \"London\", \"Climate of London\", \"LONDON\", \"London Britain\", \"England London\", \"London, Greater London\", \"Capital of the UK\", \"Londonshire\", \"Climate of london\", \"Capital of the United Kingdom\", \"London UK\", \"Londra\", \"London (United Kingdom)\", \"London,England\", \"London, England, UK\", \"United Kingdom/London\", \"London (Great Britain)\", \"Londonize\", \"Capital of England\", \"London, UK\", \"The Metropolis\", \"UN/LOCODE:GBLON\", \"Londonise\", \"London's\", \"London (Britain)\", \"London, England\", \"Lund\\u00fanir\", \"London area\", \"London, Great Britain\", \"London-on-Thames\", \"Southwest London\", \"The metropolis\", \"Londontown\", \"London england\", \"Weather in London\", \"London, England, United Kingdom\", \"Llundain\", \"London, U.K.\", \"London, england\", \"London, United Kingdom\", \"GBLON\", \"London weather\", \"London, Britain\", \"Lundein\", \"Lundunir\"]", "[\"Goldenballs\", \"GoldenBalls\", \"Golden Balls\"]", "[\"Garrote\", \"Garrot\", \"Garrotte\", \"Fibre wire\", \"Fiber wire\", \"Garrote Wire\", \"Garotte\", \"Garrotted\", \"Garrote vil\", \"Garroting\"]", "[\"Lead pollution\", \"Painter's colic\", \"Plumbism\", \"Chronic lead exposure\", \"Lead neuropathy\", \"Lead poisoning\", \"Lead intoxication\", \"Lead neurotoxicity\", \"Lead poisoning, nervous system\", \"Lead and brain damage\", \"Lead toxicity\", \"Lead Poisoning\", \"Saturnism\"]", "[\"Duckface\", \"DUCKFACE\", \"Duck face\"]", "[\"1.524 metres (5 ft)\"]", "[\"Micheal Caine\", \"Maurice Joseph Micklewhite\", \"Sir Maurice Joseph Micklewhite, Jr.\", \"Micheal caine\", \"Caine, Michael\", \"Sir Maurice Joseph Micklewhite\", \"Mike Caine\", \"Maurice Micklewhite\", \"Sir Michael Caine\", \"Michael cane\", \"MICHAEL CAINE\", \"Michael Maurice Micklewhite\", \"Michael caine\", \"Maurice J. Micklewhite\", \"Cained\", \"Maurice Joseph Micklewhite, Jr.\", \"Michael Caine\", \"Sir Michael Caine, CBE\"]" ]
[ "Argentum is Latin for which chemical element?", "\"Which Italian foodstuff which comprises of dumplings made of flour, semolina or potatoes boiled or baked and served with grated cheese or sauce takes it’s name from the Italian for \"\"Knock On Wood\"\" ?\"", "The longest serving and first flying space shuttle, which vehicle was lost on re-entry during mission STS-107 on Feb 1, 2003?", "What CNN news anchor was the “moderator” of yesterday’s presidential debate at Hofstra University in NY?", "Tatiana Day is celebrated in January in which country?", "What candy company is responsible for M&Ms, Milky Way, Snickers, and Twix bars, among others?", "What number completes the title of the last book in Arthur C. Clarke's 'Space Odyssey' series: '...... The Final Odyssey'?", "Connie Fisher won a TV competition to find the lead for Andrew Lloyd Webber's production of which musical?", "Wembley Stadium is in what city?", "What links a village in Oxfordshire, a game show that was presented by Jasper Carrott, and David Beckham?", "Which method of strangulation was once the official method of execution in Spain?", "What was the cause of an epidemic of 355 cases (46% fatal) between March and June 2010 in Zamfara State, Nigeria?", "What is the nickname of the character Henrietta played by Anna Chancellor in the film Four Weddings and a Funeral?", "How high should a badminton net be at the centre?", "\"Whose 2010 biography was called \"\"Elephant to Hollywood\"\"?\"" ]
15
[ 34785, 34786, 34787, 34788, 34789, 34790, 34791, 34792, 34793, 34794, 34795, 34796, 34797, 34798, 34799 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: \"Which TV network airs \"\"The Colbert Report\"\"?\"\nQuestion 2: \"Which actress, who played the part of Candice Stowe in \"\"Coronation St.\"\", joined the cast of \"\"Heartbeat\"\" in 2008, where she plays the part of Dawn Bellamy?\"\nQuestion 3: Which 1987 film, set in South Africa, starred Kevin Kline and Denzel Washington?\nQuestion 4: What was the name of the hit theme from the Van Der Valk T.V. series\nQuestion 5: The Argentinean composer Astor Piazzola made an art form of which dance?\nQuestion 6: What relation was Napoleon III of France to Napoleon I of France?\nQuestion 7: Cheyenne is the capital of which US state?\nQuestion 8: Which English King was found in a Leicester car park in 2012, and reburied in Leicester Cathedral in 2015?\nQuestion 9: \"Who directed the 1947 film \"\"It's a Wonderful Life\"\"?\"\nQuestion 10: Which British airport has the code LGW?\nQuestion 11: Quasimodo is what book character?\nQuestion 12: Up to the first half of 2013 who has won the most men's major golf championships, also known as majors (Masters Tournament, U.S. Open, The Open Championship (British Open) and US PGA Championship)?\nQuestion 13: Who wrote the TV series 'The Wire'?\nQuestion 14: Living from 1890 to 1963, what was the more famous name of American born Robert Franklin Stroud?\nQuestion 15: \"What name completes these lyrics from a hit by 'The Crystals': \"\"I met him on a Monday and my heart stood still, Da-do ron-ron-ron, da-do ron-ron, somebody told me\"", "role": "user" } ]
["[\"CTV: The Comedy Network\", \"Shartweek\", \"Comedy Central HD\", \"Cc.com\", \"Comedy central\", \"Comedy Central\", \"Comedy Partners\", \"Shart Week\", \"ComedyCentral\", \"Comedy \\u05df\\u0250\\u0279\\u0287u\\u01dd\\u0254\", \"Comedy Central's Indecision 2012\"]", "[\"Nikki Sanderson\", \"NIKKI SANDERSON\"]", "[\"Cry Freedom\"]", "[\"Eye Level\"]", "[\"Tango controls\", \"TANGO\"]", "[\"Nephew and niece\", \"Great nephew\", \"Step-nephew\", \"Niece and nephew\", \"Niece-in-law\", \"Son sister\", \"Son-sister\", \"Grand-nephew\", \"Niece\", \"Nephew and Niece\", \"Great-grand-nephew\", \"Great-nephew\", \"Nephew-in-law\", \"Half-nephew\", \"Great-niece\", \"Great-grand-niece\", \"Sister-son\", \"Grandnephew\", \"Great-nephews\", \"Nieces\", \"Nephews\", \"Nibling\", \"Sister-daughter\", \"Great-Niece\", \"Grand-niece\", \"Grand nephew\", \"Sister daughter\", \"Grand niece\", \"Cousin-nephew\", \"Nephews and nieces\", \"Step-niece\", \"Neice\", \"Half-niece\", \"Great niece\", \"Cousin-grandnephew\", \"Nieble\", \"Sister son\", \"Great-Nephew\", \"Grandniece\", \"Nephew\"]", "[\"State of Wyoming\", \"Wyoming state symbols\", \"Wyoming (state)\", \"Wyoming\", \"Cowboy State\", \"Geography of Wyoming\", \"Education in Wyoming\", \"Transport in Wyoming\", \"Forty-Fourth State\", \"Law and government of Wyoming\", \"Constitution of the State of Wyoming\", \"Symbols of the State of Wyoming\", \"Wyoming metropolitan areas\", \"Wyoming economy\", \"Constitution of Wyoming\", \"Demographics of Wyoming\", \"Big Wonderful Wyoming\", \"Wyoming counties\", \"Sports in Wyoming\", \"Equality State\", \"Wyoming state nickname\", \"The Equality State\", \"WYOMING\", \"Religion in Wyoming\", \"44th State\", \"Wyomingite\", \"US-WY\", \"Wioming\", \"Wyoming State Constitution\", \"Economy of Wyoming\", \"Wyoming factsheet\", \"Transportation in Wyoming\", \"Government of Wyoming\", \"The Cowboy State\", \"Politics of Wyoming\", \"Wyomingites\", \"Wyoming (U.S. state)\", \"Wyoming, United States\", \"Forty-fourth State\", \"Wyo.\", \"Climate of Wyoming\"]", "[\"Richard III, King of England\", \"King Richard Iii Of England\", \"Richard III (England)\", \"Richard III of England\", \"Dick III\", \"Richard iii\", \"Richard the Third\", \"Richard 3rd\", \"King Richard III of England\", \"Search for Richard III\", \"Richard 3\", \"Richard III of York\", \"Car park king\", \"Richard Iii\", \"Richard III\", \"King Richard III\", \"Richard of Gloucester\"]", "[\"Frank Capra\", \"Francesco Rosario Capra\", \"The American Film Institute Salute to Frank Capra\", \"The american film institute salute to frank capra\", \"Capraesque\", \"Francesco Capra\", \"Lou Capra\", \"Frank R. Capra\"]", "[\"London Gatwick North\", \"Gatwick International Airport\", \"Gatwick airport shuttle\", \"Gat- wick\", \"London Gatwick Airport\", \"London\\u2013Gatwick\", \"Airport Gatwick\", \"London Gatwick\", \"RAF Gatwick\", \"London-Gatwick\", \"Gatwick Airport\", \"London/Gatwick\", \"London-Gatwick Airport\", \"Gatwick, England\", \"EGKK\", \"LONDON GATWICK\", \"Gatwick\", \"Gatwick Airport monorail\", \"London gatwick airport\", \"Gatwick airport transit\", \"Egkk\", \"Gat-wick\", \"London gatwick Airport\", \"LGW Airport\", \"London Gatwick International Airport\", \"Gatwick airport\", \"London Gatwick airport\", \"Gatwick Airport transit\", \"LGW\"]", "[\"Notre-Dame of Paris (novel)\", \"Grangoire\", \"THOND\", \"Hunchback of Notre-Dame\", \"Hunchback of Notre-Dame (ballet)\", \"The Hunchback of Notre Dame (ballet)\", \"The Hunchback of Notre-Dame (ballet)\", \"The Hunchback of Notre Dame (novel)\", \"Notre-Dame de Paris (novel)\", \"The Hunchback of Notre Dame\", \"The Hunchback of Notre-Dame\", \"Notre Dame de Paris (novel)\", \"The Hunchback Of Notre Dame\", \"Hunchback of Notre Dame\", \"The Hunchback of Notra Dam\", \"Hunchback of notre dame\", \"Le bossu de notre dame\", \"The hunchback of Notre Dame\", \"The Hunchback of Notre Dam\"]", "[\"The Golden Bear\", \"Jack Nicklaus\", \"Jack William Nicklaus\", \"Nicklaus\", \"Nicklaus Golf Equipment\", \"Golden Bear golfer\", \"Jack nickalus\", \"The golden bear\"]", "[\"David Simon (producer)\", \"DAVID SIMON\", \"David Simon (writer)\", \"David Simon\"]", "[\"Birdman of Alcatrez\", \"Della Mae Jones\", \"The alcatraz bird man\", \"Robert Franklin Stroud\", \"Birdman Of Alcatraz\", \"Bird Man of Alcatraz\", \"Robert Stroud\", \"BIRDMAN OF ALCATRAZ\", \"The Birdman of Alcatraz\", \"Birdman of Alcatraz\"]", "[\"The Bill\", \"Sun Hill Police Station\", \"Sunhill Seige (2007)\", \"Mbarnes\", \"Chief Inspector Paul Stritch\", \"Episode1.11 (The Bill)\", \"The Bill: Previous Episode\", \"The bill\", \"The Bill on ITV\", \"Eddie Olosunde\", \"The Chief Superintendent's Party\", \"Sun Hill police station\", \"Sun Hill (The Bill)\", \"Jane Kendall\", \"PC Samuel Harker\", \"Sun Hill Station\", \"Episode2.12 (The Bill)\", \"'BILL'\", \"THE BILL\", \"Recurring and minor cast of The Bill\", \"Recurring and Minor Cast of The Bill\", \"The Bill (TV series)\", \"The Sweet Smell of Failure\", \"Sunhill Siege (2007)\", \"The Bill Present Cast\", \"Doug Wright (The Bill)\", \"Douglas Wright the bill\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"CTV: The Comedy Network\", \"Shartweek\", \"Comedy Central HD\", \"Cc.com\", \"Comedy central\", \"Comedy Central\", \"Comedy Partners\", \"Shart Week\", \"ComedyCentral\", \"Comedy \\u05df\\u0250\\u0279\\u0287u\\u01dd\\u0254\", \"Comedy Central's Indecision 2012\"]", "[\"Nikki Sanderson\", \"NIKKI SANDERSON\"]", "[\"Cry Freedom\"]", "[\"Eye Level\"]", "[\"Tango controls\", \"TANGO\"]", "[\"Nephew and niece\", \"Great nephew\", \"Step-nephew\", \"Niece and nephew\", \"Niece-in-law\", \"Son sister\", \"Son-sister\", \"Grand-nephew\", \"Niece\", \"Nephew and Niece\", \"Great-grand-nephew\", \"Great-nephew\", \"Nephew-in-law\", \"Half-nephew\", \"Great-niece\", \"Great-grand-niece\", \"Sister-son\", \"Grandnephew\", \"Great-nephews\", \"Nieces\", \"Nephews\", \"Nibling\", \"Sister-daughter\", \"Great-Niece\", \"Grand-niece\", \"Grand nephew\", \"Sister daughter\", \"Grand niece\", \"Cousin-nephew\", \"Nephews and nieces\", \"Step-niece\", \"Neice\", \"Half-niece\", \"Great niece\", \"Cousin-grandnephew\", \"Nieble\", \"Sister son\", \"Great-Nephew\", \"Grandniece\", \"Nephew\"]", "[\"State of Wyoming\", \"Wyoming state symbols\", \"Wyoming (state)\", \"Wyoming\", \"Cowboy State\", \"Geography of Wyoming\", \"Education in Wyoming\", \"Transport in Wyoming\", \"Forty-Fourth State\", \"Law and government of Wyoming\", \"Constitution of the State of Wyoming\", \"Symbols of the State of Wyoming\", \"Wyoming metropolitan areas\", \"Wyoming economy\", \"Constitution of Wyoming\", \"Demographics of Wyoming\", \"Big Wonderful Wyoming\", \"Wyoming counties\", \"Sports in Wyoming\", \"Equality State\", \"Wyoming state nickname\", \"The Equality State\", \"WYOMING\", \"Religion in Wyoming\", \"44th State\", \"Wyomingite\", \"US-WY\", \"Wioming\", \"Wyoming State Constitution\", \"Economy of Wyoming\", \"Wyoming factsheet\", \"Transportation in Wyoming\", \"Government of Wyoming\", \"The Cowboy State\", \"Politics of Wyoming\", \"Wyomingites\", \"Wyoming (U.S. state)\", \"Wyoming, United States\", \"Forty-fourth State\", \"Wyo.\", \"Climate of Wyoming\"]", "[\"Richard III, King of England\", \"King Richard Iii Of England\", \"Richard III (England)\", \"Richard III of England\", \"Dick III\", \"Richard iii\", \"Richard the Third\", \"Richard 3rd\", \"King Richard III of England\", \"Search for Richard III\", \"Richard 3\", \"Richard III of York\", \"Car park king\", \"Richard Iii\", \"Richard III\", \"King Richard III\", \"Richard of Gloucester\"]", "[\"Frank Capra\", \"Francesco Rosario Capra\", \"The American Film Institute Salute to Frank Capra\", \"The american film institute salute to frank capra\", \"Capraesque\", \"Francesco Capra\", \"Lou Capra\", \"Frank R. Capra\"]", "[\"London Gatwick North\", \"Gatwick International Airport\", \"Gatwick airport shuttle\", \"Gat- wick\", \"London Gatwick Airport\", \"London\\u2013Gatwick\", \"Airport Gatwick\", \"London Gatwick\", \"RAF Gatwick\", \"London-Gatwick\", \"Gatwick Airport\", \"London/Gatwick\", \"London-Gatwick Airport\", \"Gatwick, England\", \"EGKK\", \"LONDON GATWICK\", \"Gatwick\", \"Gatwick Airport monorail\", \"London gatwick airport\", \"Gatwick airport transit\", \"Egkk\", \"Gat-wick\", \"London gatwick Airport\", \"LGW Airport\", \"London Gatwick International Airport\", \"Gatwick airport\", \"London Gatwick airport\", \"Gatwick Airport transit\", \"LGW\"]", "[\"Notre-Dame of Paris (novel)\", \"Grangoire\", \"THOND\", \"Hunchback of Notre-Dame\", \"Hunchback of Notre-Dame (ballet)\", \"The Hunchback of Notre Dame (ballet)\", \"The Hunchback of Notre-Dame (ballet)\", \"The Hunchback of Notre Dame (novel)\", \"Notre-Dame de Paris (novel)\", \"The Hunchback of Notre Dame\", \"The Hunchback of Notre-Dame\", \"Notre Dame de Paris (novel)\", \"The Hunchback Of Notre Dame\", \"Hunchback of Notre Dame\", \"The Hunchback of Notra Dam\", \"Hunchback of notre dame\", \"Le bossu de notre dame\", \"The hunchback of Notre Dame\", \"The Hunchback of Notre Dam\"]", "[\"The Golden Bear\", \"Jack Nicklaus\", \"Jack William Nicklaus\", \"Nicklaus\", \"Nicklaus Golf Equipment\", \"Golden Bear golfer\", \"Jack nickalus\", \"The golden bear\"]", "[\"David Simon (producer)\", \"DAVID SIMON\", \"David Simon (writer)\", \"David Simon\"]", "[\"Birdman of Alcatrez\", \"Della Mae Jones\", \"The alcatraz bird man\", \"Robert Franklin Stroud\", \"Birdman Of Alcatraz\", \"Bird Man of Alcatraz\", \"Robert Stroud\", \"BIRDMAN OF ALCATRAZ\", \"The Birdman of Alcatraz\", \"Birdman of Alcatraz\"]", "[\"The Bill\", \"Sun Hill Police Station\", \"Sunhill Seige (2007)\", \"Mbarnes\", \"Chief Inspector Paul Stritch\", \"Episode1.11 (The Bill)\", \"The Bill: Previous Episode\", \"The bill\", \"The Bill on ITV\", \"Eddie Olosunde\", \"The Chief Superintendent's Party\", \"Sun Hill police station\", \"Sun Hill (The Bill)\", \"Jane Kendall\", \"PC Samuel Harker\", \"Sun Hill Station\", \"Episode2.12 (The Bill)\", \"'BILL'\", \"THE BILL\", \"Recurring and minor cast of The Bill\", \"Recurring and Minor Cast of The Bill\", \"The Bill (TV series)\", \"The Sweet Smell of Failure\", \"Sunhill Siege (2007)\", \"The Bill Present Cast\", \"Doug Wright (The Bill)\", \"Douglas Wright the bill\"]" ]
[ "\"Which TV network airs \"\"The Colbert Report\"\"?\"", "\"Which actress, who played the part of Candice Stowe in \"\"Coronation St.\"\", joined the cast of \"\"Heartbeat\"\" in 2008, where she plays the part of Dawn Bellamy?\"", "Which 1987 film, set in South Africa, starred Kevin Kline and Denzel Washington?", "What was the name of the hit theme from the Van Der Valk T.V. series", "The Argentinean composer Astor Piazzola made an art form of which dance?", "What relation was Napoleon III of France to Napoleon I of France?", "Cheyenne is the capital of which US state?", "Which English King was found in a Leicester car park in 2012, and reburied in Leicester Cathedral in 2015?", "\"Who directed the 1947 film \"\"It's a Wonderful Life\"\"?\"", "Which British airport has the code LGW?", "Quasimodo is what book character?", "Up to the first half of 2013 who has won the most men's major golf championships, also known as majors (Masters Tournament, U.S. Open, The Open Championship (British Open) and US PGA Championship)?", "Who wrote the TV series 'The Wire'?", "Living from 1890 to 1963, what was the more famous name of American born Robert Franklin Stroud?", "\"What name completes these lyrics from a hit by 'The Crystals': \"\"I met him on a Monday and my heart stood still, Da-do ron-ron-ron, da-do ron-ron, somebody told me\"" ]
15
[ 33735, 33736, 33737, 33738, 33739, 33740, 33741, 33742, 33743, 33744, 33745, 33746, 33747, 33748, 33749 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which actor played Sergeant Neil Howie in the 1973 film The Wicker Man?\nQuestion 2: What type of rock is carbonado?\nQuestion 3: What international yachting regatta organised by the Royal Ocean Racing Club, competed for between 3 boats for each national team, based at Cowes on the Isle of Wight off southern England, was a biennial event from 1957 to 1999?\nQuestion 4: Which gland, secreting various hormones essential for growth and other bodily functions, is situated in the brain ?\nQuestion 5: Bentley Drummle is a villainous character in which novel?\nQuestion 6: Name the most southerly county in the Republic of Ireland?\nQuestion 7: If you were involved the craft of tatting what would you be making?\nQuestion 8: Sent as a gift to King James II of Scotland in 1457, what is the alliterative name of the medieval bombard siege gun located outside of Edinburgh Castle?\nQuestion 9: If you are pogonophobic what are you afraid of?\nQuestion 10: Turkey's international vehicle registration code (typically shown on vehicle registration plates) is?\nQuestion 11: In sport who are the Black Caps?\nQuestion 12: Which every day edible vegetable is from the daucus genus of plants?\nQuestion 13: How many of William the Conqueror's sons became king of England\nQuestion 14: Which Belgian in 1969, was the first man to win all three major prizesin the Tour de France?\nQuestion 15: What is the name of cartoon character Bugs Bunny’s girlfriend?", "role": "user" } ]
["[\"Edward Woodward\", \"Ewar Woowar\", \"EDWARD WOODWARD\"]", "[\"Diamond\", \"4-C's of Diamond Grading\", \"The 4 C's Of Diamonds\", \"Polished diamond\", \"Diamonds\", \"Natural diamond\", \"Diamond industry\", \"Mitre-crozier applique\", \"Diamond powder\", \"Bortz\", \"Industrial diamonds\", \"Type-II diamond\", \"Daimonds\", \"Mitre-crozier appliqu\\u00e9\", \"Impact diamonds\", \"Diamonad\", \"Industrial diamond\", \"Industrial Diamond\"]", "[\"The Admiral's Cup\", \"Admiral's Cup\", \"Admirals Cup\"]", "[\"Pituitary glands\", \"Pituitary Gland\", \"Receptors, pituitary hormone\", \"Hypophysical\", \"Pituary gland\", \"Pituatary gland\", \"Hypophyse\", \"Glandula pituitaria\", \"Pituitary diseases\", \"Hypophysis cerebri\", \"Pituitary gland\", \"Pituitary\", \"PITUITARY\", \"Pituitary body\"]", "[\"Herbert Pocket\", \"Great Expectation\", \"Jaggers\", \"Great Expectations plot details\", \"Great Expectations\", \"Joe Gargery\", \"Bentley Drummle\", \"Great expectations\", \"Mrs joe\"]", "[\"Cork (disambiguation)\", \"Cork (Parliament of Ireland constituency)\", \"Cork\", \"CORK\", \"Corks\"]", "[\"Lace\", \"Lace-making\", \"Real lace\", \"Lacework\", \"Lace making\"]", "[\"'MONS MEG'\", \"Mons Meg\"]", "[\"Beard\", \"Bearded\", \"Neard\", \"Manbeard\", \"BEARDS\", \"Pogonology\", \"Full beard\", \"Neckbeard\", \"\\u0627\\u0644\\u0631\\u062c\\u0644 \\u0628\\u0644\\u0627 \\u0634\\u0646\\u0628 \\u0643\\u0627\\u0644\\u0642\\u0637 \\u0628\\u0644\\u0627 \\u0630\\u0646\\u0628\", \"Neck beard\", \"Neck hair\", \"Beards\", \"Bearded people\", \"Five o'clock shadow\"]", "[\"T.R.\", \"T.r.\", \"Tr.\", \"TR (disambiguation)\", \"TR\", \"Tr\", \"T. R.\", \"T R\"]", "[\"NEW ZEALAND CRICKET TEAM\", \"New zealand national cricket team\", \"New Zealand national cricket team\", \"New Zealand cricket team in Australia in 1996-97\", \"Black Caps\", \"Baby BlackCaps\", \"NZ cricket team\", \"New Zealand cricket team\", \"New Zealand cricket team in Australia in 2002-03\", \"New Zealand cricket team in Australia in 1998-99\", \"New zealand cricket team\", \"BlackCaps\", \"New Zealand cricket team in Australia in 2000-01\", \"Black caps\", \"New Zealand Cricket Team\"]", "[\"Daucus carota subsp. sativus,\", \"Carrots\", \"Karrot\", \"Bird's-nest root\", \"Devil's Plague\", \"CARROTS\", \"Carota\", \"Carrot\", \"Common carrot\", \"Bee's-nest plant\", \"Black carrot\", \"Bee's-nest\", \"Daucus carota subsp. sativus\", \"Black Carrot\"]", "[\"2\", \"Two\", \"two\"]", "[\"Edward Merckx\", \"Eddy merkx\", \"Eddie Merckx\", \"Edouard Louis Joseph, Baron Merckx\", \"Eddy Merckx\", \"Eddy Merx\", \"EDDY MERCKX\", \"Eddie Merx\", \"Eddy Merkx\", \"Eddy Merckx (cyclist)\", \"Eddie Merkx\", \"Eddy merx\"]", "[\"Lola Bunny\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Edward Woodward\", \"Ewar Woowar\", \"EDWARD WOODWARD\"]", "[\"Diamond\", \"4-C's of Diamond Grading\", \"The 4 C's Of Diamonds\", \"Polished diamond\", \"Diamonds\", \"Natural diamond\", \"Diamond industry\", \"Mitre-crozier applique\", \"Diamond powder\", \"Bortz\", \"Industrial diamonds\", \"Type-II diamond\", \"Daimonds\", \"Mitre-crozier appliqu\\u00e9\", \"Impact diamonds\", \"Diamonad\", \"Industrial diamond\", \"Industrial Diamond\"]", "[\"The Admiral's Cup\", \"Admiral's Cup\", \"Admirals Cup\"]", "[\"Pituitary glands\", \"Pituitary Gland\", \"Receptors, pituitary hormone\", \"Hypophysical\", \"Pituary gland\", \"Pituatary gland\", \"Hypophyse\", \"Glandula pituitaria\", \"Pituitary diseases\", \"Hypophysis cerebri\", \"Pituitary gland\", \"Pituitary\", \"PITUITARY\", \"Pituitary body\"]", "[\"Herbert Pocket\", \"Great Expectation\", \"Jaggers\", \"Great Expectations plot details\", \"Great Expectations\", \"Joe Gargery\", \"Bentley Drummle\", \"Great expectations\", \"Mrs joe\"]", "[\"Cork (disambiguation)\", \"Cork (Parliament of Ireland constituency)\", \"Cork\", \"CORK\", \"Corks\"]", "[\"Lace\", \"Lace-making\", \"Real lace\", \"Lacework\", \"Lace making\"]", "[\"'MONS MEG'\", \"Mons Meg\"]", "[\"Beard\", \"Bearded\", \"Neard\", \"Manbeard\", \"BEARDS\", \"Pogonology\", \"Full beard\", \"Neckbeard\", \"\\u0627\\u0644\\u0631\\u062c\\u0644 \\u0628\\u0644\\u0627 \\u0634\\u0646\\u0628 \\u0643\\u0627\\u0644\\u0642\\u0637 \\u0628\\u0644\\u0627 \\u0630\\u0646\\u0628\", \"Neck beard\", \"Neck hair\", \"Beards\", \"Bearded people\", \"Five o'clock shadow\"]", "[\"T.R.\", \"T.r.\", \"Tr.\", \"TR (disambiguation)\", \"TR\", \"Tr\", \"T. R.\", \"T R\"]", "[\"NEW ZEALAND CRICKET TEAM\", \"New zealand national cricket team\", \"New Zealand national cricket team\", \"New Zealand cricket team in Australia in 1996-97\", \"Black Caps\", \"Baby BlackCaps\", \"NZ cricket team\", \"New Zealand cricket team\", \"New Zealand cricket team in Australia in 2002-03\", \"New Zealand cricket team in Australia in 1998-99\", \"New zealand cricket team\", \"BlackCaps\", \"New Zealand cricket team in Australia in 2000-01\", \"Black caps\", \"New Zealand Cricket Team\"]", "[\"Daucus carota subsp. sativus,\", \"Carrots\", \"Karrot\", \"Bird's-nest root\", \"Devil's Plague\", \"CARROTS\", \"Carota\", \"Carrot\", \"Common carrot\", \"Bee's-nest plant\", \"Black carrot\", \"Bee's-nest\", \"Daucus carota subsp. sativus\", \"Black Carrot\"]", "[\"2\", \"Two\", \"two\"]", "[\"Edward Merckx\", \"Eddy merkx\", \"Eddie Merckx\", \"Edouard Louis Joseph, Baron Merckx\", \"Eddy Merckx\", \"Eddy Merx\", \"EDDY MERCKX\", \"Eddie Merx\", \"Eddy Merkx\", \"Eddy Merckx (cyclist)\", \"Eddie Merkx\", \"Eddy merx\"]", "[\"Lola Bunny\"]" ]
[ "Which actor played Sergeant Neil Howie in the 1973 film The Wicker Man?", "What type of rock is carbonado?", "What international yachting regatta organised by the Royal Ocean Racing Club, competed for between 3 boats for each national team, based at Cowes on the Isle of Wight off southern England, was a biennial event from 1957 to 1999?", "Which gland, secreting various hormones essential for growth and other bodily functions, is situated in the brain ?", "Bentley Drummle is a villainous character in which novel?", "Name the most southerly county in the Republic of Ireland?", "If you were involved the craft of tatting what would you be making?", "Sent as a gift to King James II of Scotland in 1457, what is the alliterative name of the medieval bombard siege gun located outside of Edinburgh Castle?", "If you are pogonophobic what are you afraid of?", "Turkey's international vehicle registration code (typically shown on vehicle registration plates) is?", "In sport who are the Black Caps?", "Which every day edible vegetable is from the daucus genus of plants?", "How many of William the Conqueror's sons became king of England", "Which Belgian in 1969, was the first man to win all three major prizesin the Tour de France?", "What is the name of cartoon character Bugs Bunny’s girlfriend?" ]
15
[ 41610, 41611, 41612, 41613, 41614, 41615, 41616, 41617, 41618, 41619, 41620, 41621, 41622, 41623, 41624 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What type of creature is a bleak?\nQuestion 2: Which TV presenter was married to Lady Carina Fitzalan-Howard, daughter of the late Duke of Norfolk?\nQuestion 3: Which islands lie off the Northwest coast of Anglesey?\nQuestion 4: Who is the patron saint of the Order of the Garter?\nQuestion 5: To which political party does Australian Prime Minister Kevin Rudd belong?\nQuestion 6: In Greek mythology Achilles was the son of Peleus and whom?\nQuestion 7: What colour are the petals of the flower known as the Black-eyed Susan?\nQuestion 8: What is the second biggest city in Australia?\nQuestion 9: In the 1964 film ‘Goldfinger’, what is the name of the team of Goldfinger’s all-female pilots?\nQuestion 10: What letter is used the most often in English language and literature?\nQuestion 11: What is the name of the heritage railway line that runs fornine miles along the border of East and West Sussex?\nQuestion 12: In November 1943 which South American country sent 60,000 troops plus aircraft to assist allied forces in Europe?\nQuestion 13: Cleeve Hill is the highest point in which English county?\nQuestion 14: In the novel ‘1984’, in which ministry is room 101?\nQuestion 15: How many sons of Philip IV of France became King?", "role": "user" } ]
["[\"Fish proteins\", \"Fin-fish\", \"Fish vs fishes\", \"Ichthyoid\", \"Fish versus fishes\", \"\\ud83d\\udc1f\", \"Fish (Biology)\", \"Fishes or fish\", \"Piscines\", \"Fish or fishes\", \"Fisshes\", \"Fishes\", \"Fishes versus fish\", \"Fush\", \"Sick fish\", \"Fishbones\", \"Pisces (zoology)\", \"Finfish\", \"Marine fish\", \"Fish (zoology)\", \"Ichthyes\", \"Fish\", \"Ichthyofauna\", \"Inchthyic\", \"Fish venoms\"]", "[\"Sir David Paradine Frost\", \"David Frost (broadcaster)\", \"The David Frost Show\", \"David Frost\", \"David Paradine\", \"Sir David Frost\", \"David Frost Show\", \"David Paradine Frost\"]", "[\"Skerries (disambiguation)\", \"Skerry (disambiguation)\", \"The Skerries\", \"Skerries\"]", "[\"George the Victorious\", \"St. George the Victorious\", \"Sant Jordi\", \"St. George\", \"Saint George\", \"Saint George the Victorious\", \"St George\", \"St George the Martyr\", \"Red Cross Knight\", \"St george the martyr\", \"ST GEORGE\", \"El Khader\", \"St George The Martyr\", \"George of Lydda\", \"St George the Victorious\", \"El-Khader\"]", "[\"THE LABOUR PARTY\", \"Labour Party\", \"Labor Party (Poland)\", \"Labor Party\", \"Labour (political party)\", \"Labour party\", \"Union Labor Party (United States)\", \"Labour Party (disambiguation)\", \"Polish Labor Party\", \"Labor Party of America\", \"Labourite\", \"Labor Party (US)\", \"Polska Partia Pracy\", \"Labor Party (disambiguation)\", \"Labor Party (USA)\", \"The Labour Party\", \"Labor government\", \"Labour parties\", \"United States Labor Party\", \"Labor party\", \"Labour Government\", \"Labor Party (United States)\"]", "[\"Thetis\", \"Peleus and Thetis\", \"\\u0398\\u03ad\\u03c4\\u03b9\\u03c2\", \"Hetis\", \"THETIS\", \"Thetys\"]", "[\"YELLOW\", \"Hong Jin-ho\", \"Hong Jinho\", \"Hong Jin-Ho\", \"YellOw\"]", "[\"Melbourne, AU-VIC\", \"Melbourne australia\", \"Melb\", \"UN/LOCODE:AUMEL\", \"Melbourne City\", \"Melbourne, Australia.\", \"Greater Melbourne\", \"Melben\", \"Melbourne city\", \"Melbourne (Vic.)\", \"Melbourne (Victoria)\", \"Economy of Melbourne\", \"Melbourne\", \"Melbourne, Australia\", \"Menbourne\", \"Melborne\", \"Melbourne, VIC\", \"Mlebourne\", \"Melbourne (Vic.), Australia\", \"Melbourne, Victoria\", \"Melbourne, Victoria, Australia\", \"Melbourne Australia\", \"Melbourne (Australia)\", \"Melbouren\", \"Melbournian\", \"Mlbourne\", \"Marvellous melbourne\"]", "[\"Flying circus (disambiguation)\", \"Flying Circus (disambiguation)\", \"Flying circuis\", \"Flying Circus\"]", "[\"\\u24a0\", \"\\uff25\", \"\\ud83c\\udd14\", \"\\ud83c\\udd74\", \"E (letter)\", \"\\ud83c\\udd34\", \"E\", \"\\ud83c\\udd54\"]", "[\"Bluebell railway\", \"Sharpethorne Tunnel\", \"Lewes and East Grinstead Railway\", \"Bluebell Line\", \"Bluebell Railway\", \"Sharpthorne Tunnel\", \"Sharpthorne tunnel\", \"BLUEBELL LINE\"]", "[\"Brazil\", \"BRAZIL\", \"Etymology of Brazil\", \"Federal Republic of Brazil\", \"Brasil\", \"Barzil\", \"Federative Republic of Brazil\", \"Brazil (country)\", \"Brassil\", \"Republic of Brazil\", \"Br\\u00e9sil\", \"Brzil\", \"Brazilian Federative Republic\", \"Republica Federativa do Brasil\", \"Bresil\", \"Brazilian Republic\", \"ISO 3166-1:BR\", \"Rep\\u00fablica Federativa do Brasil\", \"Brazilo\"]", "[\"Gloucestershire, England\", \"County of Gloucester\", \"Gloucestershire (traditional)\", \"Gloucestershire (administrative)\", \"Gloucestershire (rump)\", \"Windsoredge\", \"Glouchestershire\", \"Gloucestershire\", \"Glos.\", \"Gloucestershire, United Kingdom\", \"Glocs\", \"GLOUCESTERSHIRE\"]", "[\"Room101\", \"Ministry of Plenty\", \"Miniluv\", \"Ministry of Peace\", \"Ministry of truth\", \"Ministry of love\", \"The Ministry of Love\", \"Ministry of Love\", \"Ministries of Nineteen Eighty-Four\", \"Minitrue\", \"Room 101\", \"Ministry of Truth\"]", "[\"3\", \"three\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Fish proteins\", \"Fin-fish\", \"Fish vs fishes\", \"Ichthyoid\", \"Fish versus fishes\", \"\\ud83d\\udc1f\", \"Fish (Biology)\", \"Fishes or fish\", \"Piscines\", \"Fish or fishes\", \"Fisshes\", \"Fishes\", \"Fishes versus fish\", \"Fush\", \"Sick fish\", \"Fishbones\", \"Pisces (zoology)\", \"Finfish\", \"Marine fish\", \"Fish (zoology)\", \"Ichthyes\", \"Fish\", \"Ichthyofauna\", \"Inchthyic\", \"Fish venoms\"]", "[\"Sir David Paradine Frost\", \"David Frost (broadcaster)\", \"The David Frost Show\", \"David Frost\", \"David Paradine\", \"Sir David Frost\", \"David Frost Show\", \"David Paradine Frost\"]", "[\"Skerries (disambiguation)\", \"Skerry (disambiguation)\", \"The Skerries\", \"Skerries\"]", "[\"George the Victorious\", \"St. George the Victorious\", \"Sant Jordi\", \"St. George\", \"Saint George\", \"Saint George the Victorious\", \"St George\", \"St George the Martyr\", \"Red Cross Knight\", \"St george the martyr\", \"ST GEORGE\", \"El Khader\", \"St George The Martyr\", \"George of Lydda\", \"St George the Victorious\", \"El-Khader\"]", "[\"THE LABOUR PARTY\", \"Labour Party\", \"Labor Party (Poland)\", \"Labor Party\", \"Labour (political party)\", \"Labour party\", \"Union Labor Party (United States)\", \"Labour Party (disambiguation)\", \"Polish Labor Party\", \"Labor Party of America\", \"Labourite\", \"Labor Party (US)\", \"Polska Partia Pracy\", \"Labor Party (disambiguation)\", \"Labor Party (USA)\", \"The Labour Party\", \"Labor government\", \"Labour parties\", \"United States Labor Party\", \"Labor party\", \"Labour Government\", \"Labor Party (United States)\"]", "[\"Thetis\", \"Peleus and Thetis\", \"\\u0398\\u03ad\\u03c4\\u03b9\\u03c2\", \"Hetis\", \"THETIS\", \"Thetys\"]", "[\"YELLOW\", \"Hong Jin-ho\", \"Hong Jinho\", \"Hong Jin-Ho\", \"YellOw\"]", "[\"Melbourne, AU-VIC\", \"Melbourne australia\", \"Melb\", \"UN/LOCODE:AUMEL\", \"Melbourne City\", \"Melbourne, Australia.\", \"Greater Melbourne\", \"Melben\", \"Melbourne city\", \"Melbourne (Vic.)\", \"Melbourne (Victoria)\", \"Economy of Melbourne\", \"Melbourne\", \"Melbourne, Australia\", \"Menbourne\", \"Melborne\", \"Melbourne, VIC\", \"Mlebourne\", \"Melbourne (Vic.), Australia\", \"Melbourne, Victoria\", \"Melbourne, Victoria, Australia\", \"Melbourne Australia\", \"Melbourne (Australia)\", \"Melbouren\", \"Melbournian\", \"Mlbourne\", \"Marvellous melbourne\"]", "[\"Flying circus (disambiguation)\", \"Flying Circus (disambiguation)\", \"Flying circuis\", \"Flying Circus\"]", "[\"\\u24a0\", \"\\uff25\", \"\\ud83c\\udd14\", \"\\ud83c\\udd74\", \"E (letter)\", \"\\ud83c\\udd34\", \"E\", \"\\ud83c\\udd54\"]", "[\"Bluebell railway\", \"Sharpethorne Tunnel\", \"Lewes and East Grinstead Railway\", \"Bluebell Line\", \"Bluebell Railway\", \"Sharpthorne Tunnel\", \"Sharpthorne tunnel\", \"BLUEBELL LINE\"]", "[\"Brazil\", \"BRAZIL\", \"Etymology of Brazil\", \"Federal Republic of Brazil\", \"Brasil\", \"Barzil\", \"Federative Republic of Brazil\", \"Brazil (country)\", \"Brassil\", \"Republic of Brazil\", \"Br\\u00e9sil\", \"Brzil\", \"Brazilian Federative Republic\", \"Republica Federativa do Brasil\", \"Bresil\", \"Brazilian Republic\", \"ISO 3166-1:BR\", \"Rep\\u00fablica Federativa do Brasil\", \"Brazilo\"]", "[\"Gloucestershire, England\", \"County of Gloucester\", \"Gloucestershire (traditional)\", \"Gloucestershire (administrative)\", \"Gloucestershire (rump)\", \"Windsoredge\", \"Glouchestershire\", \"Gloucestershire\", \"Glos.\", \"Gloucestershire, United Kingdom\", \"Glocs\", \"GLOUCESTERSHIRE\"]", "[\"Room101\", \"Ministry of Plenty\", \"Miniluv\", \"Ministry of Peace\", \"Ministry of truth\", \"Ministry of love\", \"The Ministry of Love\", \"Ministry of Love\", \"Ministries of Nineteen Eighty-Four\", \"Minitrue\", \"Room 101\", \"Ministry of Truth\"]", "[\"3\", \"three\"]" ]
[ "What type of creature is a bleak?", "Which TV presenter was married to Lady Carina Fitzalan-Howard, daughter of the late Duke of Norfolk?", "Which islands lie off the Northwest coast of Anglesey?", "Who is the patron saint of the Order of the Garter?", "To which political party does Australian Prime Minister Kevin Rudd belong?", "In Greek mythology Achilles was the son of Peleus and whom?", "What colour are the petals of the flower known as the Black-eyed Susan?", "What is the second biggest city in Australia?", "In the 1964 film ‘Goldfinger’, what is the name of the team of Goldfinger’s all-female pilots?", "What letter is used the most often in English language and literature?", "What is the name of the heritage railway line that runs fornine miles along the border of East and West Sussex?", "In November 1943 which South American country sent 60,000 troops plus aircraft to assist allied forces in Europe?", "Cleeve Hill is the highest point in which English county?", "In the novel ‘1984’, in which ministry is room 101?", "How many sons of Philip IV of France became King?" ]
15
[ 120510, 120511, 120512, 120513, 120514, 120515, 120516, 120517, 120518, 120519, 120520, 120521, 120522, 120523, 120524 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What is the English for ‘Duirt me leat go raibh me breoite’?\nQuestion 2: Which Italian noblewoman was queen of France between 1547 and 1559, and ruled as regent in the years afterwards (full name needed)?\nQuestion 3: What aquatic animal can live to be 100 years old in the wild, but usually dies before age 30 in captivity?\nQuestion 4: Where does kapok, use for stuffing mattresses and cushions, come from?\nQuestion 5: In place names what is the original meaning of `thwaite' as in Satterthwaite?\nQuestion 6: Racing driver Jacky Ickx and athlete Ivo Van Damme have both been Sports Personality of the Year in which country?\nQuestion 7: The oldest Sanskrit literature and Hindu scriptures are called what, meaning 'knowledge' in Sanskrit?\nQuestion 8: What is the common name for a cavy?\nQuestion 9: Graphite is a form of which chemical element?\nQuestion 10: Who, starting in 1962, created a series of silkscreen paintings of Marilyn Monroe?\nQuestion 11: Which popular knighted actor was born David White in 1940\nQuestion 12: Which group released the album 'Tango in the Night' in 1987?\nQuestion 13: Which late rock singer was known as ‘The Electric Poet’?\nQuestion 14: Who wrote the book The Right Stuff\nQuestion 15: Which film featured the song 'I've had the time of my life'?", "role": "user" } ]
["[\"I TOLD YOU I WAS ILL\"]", "[\"Catherine de M\\u00e9dicis\", \"Katarina de Medici\", \"CATHERINE DE' MEDICI\", \"Catherine De'Medici\", \"Joan of Volois\", \"Catherine of Medici\", \"Catharine de' Medici\", \"Catherine De Medicis\", \"Catharine de Medici\", \"Catherine deMedicis\", \"Catherine De'Medicis\", \"Catherine De Medici\", \"Catherine de M\\u00e9dici\", \"Caterina de Medici\", \"Catherine de\\u2019 Medici\", \"Catherine De' Medici\", \"Catherine de Medici\", \"Medici, Catherine de'\", \"Catherine de Medicis\", \"Catharine di' Medici\", \"Catherine de' Medici\", \"Caterina di Lorenzo de' Medici\", \"Caterina de' Medici\", \"Caterine de'Medici\", \"Catherine de'Medici\", \"Katherine de Medicis\"]", "[\"Killer Whales in the Kwakiutl Culture\", \"Whale Killer\", \"Orca Whale\", \"Orca whale\", \"Orcinus orca\", \"Killer whales\", \"Orca gladiator\", \"Orcas\", \"Killer whale\", \"Whale, killer\", \"Killer Whales\", \"Orca Whales\", \"Killer Whales in Relation to Culture\", \"O. orca\", \"Killer Whale\", \"Killer Whales In Native Culture\", \"Orca\", \"Orcinus\", \"Killer-whale\", \"Killer Whale population\", \"Orca (Cetacean)\", \"San Juan Orcas\", \"Killer whales In native culture\", \"Transient Killerwhale\"]", "[\"Sapling\", \"Macrophanerophyte\", \"Parts of a tree\", \"Big tree\", \"Arboreus\", \"Tree\", \"Trees\", \"Treee\", \"\\ud83c\\udf33\", \"The trees\", \"Wood layers\", \"Treed\", \"The Parts of a Tree\"]", "[\"CLEARING or MEADOW\"]", "[\"Belguim\", \"Koenigreich Belgien\", \"Belgium/Belgie\", \"Kingdom of Belgium\", \"Belgian\", \"Beljum\", \"K\\u00f6nigreich Belgien\", \"Belgique\", \"Belgium\", \"Beligum\", \"Kingdom of the Belgians\", \"Beljam\", \"Kingdom Of Belgium\", \"Belgum\", \"ISO 3166-1:BE\", \"Belgie\", \"Cockpit of Europe\", \"Koninkrijk Belgi\\u00eb\", \"Beldjike\", \"Blegium\", \"Belgio\", \"The Quebec of Europe\", \"Belgi\\u00eb\", \"Begium\", \"Royaume de Belgique\", \"Konigreich Belgien\", \"Koninkrijk Belgie\", \"People of Belgium\", \"Belgien\", \"Belgium/facts\", \"Administrative divisions of Belgium\", \"BELGIUM\", \"Belgium facts\"]", "[\"Vedas\", \"Las Vedas\", \"Four Vedas\", \"Three Vedas\", \"Vedic texts\", \"Vedic\", \"Vedic text\", \"V\\u00e9da\", \"Vedic scriptures\", \"\\u0935\\u0947\\u0926\", \"Vedic Literature\", \"Upaveda\", \"Vedic literature\", \"Veda\", \"Vedic scripture\", \"Vedansh\", \"The Vedas\", \"Vedic philosophy\"]", "[\"Guinea Pig\", \"Guiena Pig\", \"Guinea pigs\", \"Guineapig\", \"Pargs\", \"Laboratory cavy\", \"Domestic guinea pig\", \"Cultural references to guinea pigs\", \"Lab cavy\", \"Guinea Pigs\", \"Cavia longipilis\", \"Mus porcellus\", \"Cavia cobaya\", \"Rumblestrutting\", \"Ginny pig\", \"Giunea pig\", \"Guinea-pig\", \"Ginnie pigs\", \"Guinea Pig pregnancy\", \"Laboratory guinea pig\", \"Domestic Guinea Pig\", \"Guinea pig\", \"Short-haired guinea pigs\", \"Cavia porcellus\", \"Cavia leucopyga\"]", "[\"Carbon atom\", \"Kohlenstoff\", \"Carbon Atom\", \"Carbons\", \"Carbon atoms\", \"Carbonaceous\", \"Carbon unit\", \"Carbonous\", \"History of carbon\", \"Carbon (element)\", \"Atomic number 6\", \"C (element)\", \"Carbonic\", \"Carbon\"]", "[\"Andy Warhaul\", \"Warhol\", \"(Andy) Warhol\", \"Warholian Pop\", \"Andy Warhola\", \"Andrew warhola\", \"Andy Warhol Foundation for the Visual Arts\", \"Warholite\", \"Andy warhol\", \"Drella\", \"Andrew Warhol\", \"Andy Wahrol\", \"Andy worhol\", \"Andrew Warhola\", \"Andy Warhol Foundation\", \"Warholesque\", \"Warholian\", \"Warhol Foundation\", \"Andy Warhol\", \"Paul Warhola\"]", "[\"David Jason filmography\", \"David Jason\", \"Filmography of David Jason\", \"Sir David Jason\"]", "[\"Fleetwood Mac (band)\", \"FLEETWOOD MAC\", \"Fleetwood mack\", \"On With The Show (Fleetwood Mac album)\", \"Fleetwood Mac\"]", "[\"Mister Mojo Risin'\", \"Mr Mojo Risin'\", \"Mr. mojo rising\", \"Mojo Risin\", \"Jim Mommison\", \"James Douglas Morrison\", \"Mr. Mojo Risin\", \"Mister Mojo Rising\", \"Lament for my cock\", \"Mister Mojo Risin\", \"Jim morisson\", \"Jim Morrisson\", \"Jim moreson\", \"Jim Morrison\", \"Jim morrison\", \"Mr. Mojo Risin'\", \"Mr Mojo Rising\", \"Mr Mojo Risin\", \"Jim Morisson\"]", "[\"Tom Wolfe\", \"Tom Wolfe Jr.\", \"Thomas K. Wolfe Jr.\", \"Thomas Kennerly Wolfe Jr.\", \"Thomas Wolfe Jr.\"]", "[\"Jimmy Castle\", \"Dirty Dancing (1987 film)\", \"Dirty dancing\", \"Dirty Dancing (2014 film)\", \"DIRTY DANCING\", \"Dirty Dancing (film)\", \"Dirty Dancing (2013 film)\", \"Dirty Dancing\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"I TOLD YOU I WAS ILL\"]", "[\"Catherine de M\\u00e9dicis\", \"Katarina de Medici\", \"CATHERINE DE' MEDICI\", \"Catherine De'Medici\", \"Joan of Volois\", \"Catherine of Medici\", \"Catharine de' Medici\", \"Catherine De Medicis\", \"Catharine de Medici\", \"Catherine deMedicis\", \"Catherine De'Medicis\", \"Catherine De Medici\", \"Catherine de M\\u00e9dici\", \"Caterina de Medici\", \"Catherine de\\u2019 Medici\", \"Catherine De' Medici\", \"Catherine de Medici\", \"Medici, Catherine de'\", \"Catherine de Medicis\", \"Catharine di' Medici\", \"Catherine de' Medici\", \"Caterina di Lorenzo de' Medici\", \"Caterina de' Medici\", \"Caterine de'Medici\", \"Catherine de'Medici\", \"Katherine de Medicis\"]", "[\"Killer Whales in the Kwakiutl Culture\", \"Whale Killer\", \"Orca Whale\", \"Orca whale\", \"Orcinus orca\", \"Killer whales\", \"Orca gladiator\", \"Orcas\", \"Killer whale\", \"Whale, killer\", \"Killer Whales\", \"Orca Whales\", \"Killer Whales in Relation to Culture\", \"O. orca\", \"Killer Whale\", \"Killer Whales In Native Culture\", \"Orca\", \"Orcinus\", \"Killer-whale\", \"Killer Whale population\", \"Orca (Cetacean)\", \"San Juan Orcas\", \"Killer whales In native culture\", \"Transient Killerwhale\"]", "[\"Sapling\", \"Macrophanerophyte\", \"Parts of a tree\", \"Big tree\", \"Arboreus\", \"Tree\", \"Trees\", \"Treee\", \"\\ud83c\\udf33\", \"The trees\", \"Wood layers\", \"Treed\", \"The Parts of a Tree\"]", "[\"CLEARING or MEADOW\"]", "[\"Belguim\", \"Koenigreich Belgien\", \"Belgium/Belgie\", \"Kingdom of Belgium\", \"Belgian\", \"Beljum\", \"K\\u00f6nigreich Belgien\", \"Belgique\", \"Belgium\", \"Beligum\", \"Kingdom of the Belgians\", \"Beljam\", \"Kingdom Of Belgium\", \"Belgum\", \"ISO 3166-1:BE\", \"Belgie\", \"Cockpit of Europe\", \"Koninkrijk Belgi\\u00eb\", \"Beldjike\", \"Blegium\", \"Belgio\", \"The Quebec of Europe\", \"Belgi\\u00eb\", \"Begium\", \"Royaume de Belgique\", \"Konigreich Belgien\", \"Koninkrijk Belgie\", \"People of Belgium\", \"Belgien\", \"Belgium/facts\", \"Administrative divisions of Belgium\", \"BELGIUM\", \"Belgium facts\"]", "[\"Vedas\", \"Las Vedas\", \"Four Vedas\", \"Three Vedas\", \"Vedic texts\", \"Vedic\", \"Vedic text\", \"V\\u00e9da\", \"Vedic scriptures\", \"\\u0935\\u0947\\u0926\", \"Vedic Literature\", \"Upaveda\", \"Vedic literature\", \"Veda\", \"Vedic scripture\", \"Vedansh\", \"The Vedas\", \"Vedic philosophy\"]", "[\"Guinea Pig\", \"Guiena Pig\", \"Guinea pigs\", \"Guineapig\", \"Pargs\", \"Laboratory cavy\", \"Domestic guinea pig\", \"Cultural references to guinea pigs\", \"Lab cavy\", \"Guinea Pigs\", \"Cavia longipilis\", \"Mus porcellus\", \"Cavia cobaya\", \"Rumblestrutting\", \"Ginny pig\", \"Giunea pig\", \"Guinea-pig\", \"Ginnie pigs\", \"Guinea Pig pregnancy\", \"Laboratory guinea pig\", \"Domestic Guinea Pig\", \"Guinea pig\", \"Short-haired guinea pigs\", \"Cavia porcellus\", \"Cavia leucopyga\"]", "[\"Carbon atom\", \"Kohlenstoff\", \"Carbon Atom\", \"Carbons\", \"Carbon atoms\", \"Carbonaceous\", \"Carbon unit\", \"Carbonous\", \"History of carbon\", \"Carbon (element)\", \"Atomic number 6\", \"C (element)\", \"Carbonic\", \"Carbon\"]", "[\"Andy Warhaul\", \"Warhol\", \"(Andy) Warhol\", \"Warholian Pop\", \"Andy Warhola\", \"Andrew warhola\", \"Andy Warhol Foundation for the Visual Arts\", \"Warholite\", \"Andy warhol\", \"Drella\", \"Andrew Warhol\", \"Andy Wahrol\", \"Andy worhol\", \"Andrew Warhola\", \"Andy Warhol Foundation\", \"Warholesque\", \"Warholian\", \"Warhol Foundation\", \"Andy Warhol\", \"Paul Warhola\"]", "[\"David Jason filmography\", \"David Jason\", \"Filmography of David Jason\", \"Sir David Jason\"]", "[\"Fleetwood Mac (band)\", \"FLEETWOOD MAC\", \"Fleetwood mack\", \"On With The Show (Fleetwood Mac album)\", \"Fleetwood Mac\"]", "[\"Mister Mojo Risin'\", \"Mr Mojo Risin'\", \"Mr. mojo rising\", \"Mojo Risin\", \"Jim Mommison\", \"James Douglas Morrison\", \"Mr. Mojo Risin\", \"Mister Mojo Rising\", \"Lament for my cock\", \"Mister Mojo Risin\", \"Jim morisson\", \"Jim Morrisson\", \"Jim moreson\", \"Jim Morrison\", \"Jim morrison\", \"Mr. Mojo Risin'\", \"Mr Mojo Rising\", \"Mr Mojo Risin\", \"Jim Morisson\"]", "[\"Tom Wolfe\", \"Tom Wolfe Jr.\", \"Thomas K. Wolfe Jr.\", \"Thomas Kennerly Wolfe Jr.\", \"Thomas Wolfe Jr.\"]", "[\"Jimmy Castle\", \"Dirty Dancing (1987 film)\", \"Dirty dancing\", \"Dirty Dancing (2014 film)\", \"DIRTY DANCING\", \"Dirty Dancing (film)\", \"Dirty Dancing (2013 film)\", \"Dirty Dancing\"]" ]
[ "What is the English for ‘Duirt me leat go raibh me breoite’?", "Which Italian noblewoman was queen of France between 1547 and 1559, and ruled as regent in the years afterwards (full name needed)?", "What aquatic animal can live to be 100 years old in the wild, but usually dies before age 30 in captivity?", "Where does kapok, use for stuffing mattresses and cushions, come from?", "In place names what is the original meaning of `thwaite' as in Satterthwaite?", "Racing driver Jacky Ickx and athlete Ivo Van Damme have both been Sports Personality of the Year in which country?", "The oldest Sanskrit literature and Hindu scriptures are called what, meaning 'knowledge' in Sanskrit?", "What is the common name for a cavy?", "Graphite is a form of which chemical element?", "Who, starting in 1962, created a series of silkscreen paintings of Marilyn Monroe?", "Which popular knighted actor was born David White in 1940", "Which group released the album 'Tango in the Night' in 1987?", "Which late rock singer was known as ‘The Electric Poet’?", "Who wrote the book The Right Stuff", "Which film featured the song 'I've had the time of my life'?" ]
15
[ 47850, 47851, 47852, 47853, 47854, 47855, 47856, 47857, 47858, 47859, 47860, 47861, 47862, 47863, 47864 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Who wrote about a mongoose called Ricki Tikki Tavi\nQuestion 2: What nationality is the retail group Carrefour (at 2012)?\nQuestion 3: How many players compete in a professional beach volleyball game?\nQuestion 4: In which year was East Enders first broadcast?\nQuestion 5: Novelist John Buchan's title was first Baron . . . what?\nQuestion 6: Who plays the villainous Soviet agent Irina Spalko in the 2008 film ‘Indiana Jones and the Kingdom of the Crystal Skull’?\nQuestion 7: Name the year Rumanian dictator Nicolae Ceausecu is executed, Boris Becker wins the last of his three Wimbledon titles and Akihito succeeds his father as Emperor of Japan?\nQuestion 8: Feb 23, 1945 saw one of the iconic moments in US history when US marines (and a Navy corpsman), were photographed raising the flag atop was Iwo Jima mountain?\nQuestion 9: Who directed the opening ceremony of the 2012 Olympics?\nQuestion 10: What model pioneered personal computing in the 1980s, selling over 20 million of its (then huge) 64k memory machines?\nQuestion 11: March 2, 1904 saw the birth of what famous American author, who once wrote under the pen name Theo LeSieg?\nQuestion 12: ‘Spondulicks’ is British slang for what?\nQuestion 13: In the traditional story of Sinbad the Sailor, what is the name of the giant bird that carries him off to safety following a shipwreck?\nQuestion 14: How many steeplechase fences are on the Aintree Grand National race course?\nQuestion 15: Who was Jackie Kennedy's second husband?", "role": "user" } ]
["[\"Joseph Rudyard Kipling\", \"Kiplingesque\", \"Rudyard Kipling\", \"Kipling rudyard\", \"Rudy Kipling\", \"R Kipling\", \"Kipling\", \"Kipling, Joseph Rudyard\", \"Kiplingian\", \"R. Kipling\", \"Ruyard Kipling\", \"Kipling Society\", \"Bard of Empire\", \"Rudyard Kipling (author)\"]", "[\"Fran\\u00e7ais\", \"Francaise\", \"The French\", \"Frenchness\", \"French\", \"Francais\", \"French (disambiguation)\", \"Frrench\"]", "[\"2\", \"Two\", \"two\"]", "[\"1985\", \"one thousand, nine hundred and eighty-five\"]", "[\"Tweedsmuir\"]", "[\"Kate Blanchett\", \"Kate blanchet\", \"Cate Blanchett filmography\", \"Cate Blanchette\", \"Cate Blanchett\", \"Catherine \\u00c9lise %22Cate%22 Blanchett\", \"Catherine \\u00c9lise Blanchett\", \"Kate Blanchette\", \"Catherine Elise Blanchett\", \"Catherine Blanchett\", \"Cate Blanchet\"]", "[\"one thousand, nine hundred and eighty-nine\", \"1989\"]", "[\"Mt. Suribachi\", \"Mount Suribachi\", \"Mt Suribachi\"]", "[\"Danny Boyle\", \"Denny Boyle\", \"Gravity (2015 film)\"]", "[\".d64\", \"Commie 64\", \"CBM64\", \"Commodore 64 Emulators\", \"Comodore 64\", \"C64-II\", \"C64C\", \"Commador 64\", \"C64 (home computer)\", \"Assembler 64\", \"C=64\", \"Commodore 64\", \"CBM 64\", \"Commodore C64\", \"CBM-64\"]", "[\"Biography of dr.seuss\", \"Theodore Geissel\", \"Theodore geisel\", \"Dr.Seuss\", \"Gerald McBoing-Boing (2000 book)\", \"Dr. Soice\", \"Theodore Seuss Geisel\", \"List of films based on Dr. Seuss books\", \"Doctor Seuss\", \"Dr. Seus\", \"Dr seuss\", \"Theo LeSeig\", \"Dr. Theodore Seuss Giesel\", \"Dr sues\", \"Teddy Geisel\", \"Dr.suess\", \"Dr. Seuss' Birthday\", \"Theo Geisel\", \"Dr. Seuss\", \"Theodor Suess Geisel\", \"Theo LeSieg\", \"List of Dr. Seuss films\", \"Theodore (Dr. Seuss) Geisel's\", \"Suess books\", \"Doctor sues\", \"Seuss\", \"The Story of Dr. Seuss (film)\", \"Dr. Suess\", \"Theodor Seuss Geisel\", \"Theodor (Dr. Seuss) Geisel's\", \"Doctor suess\", \"Dr. sues\", \"Theodore Geisel\", \"Theodor Seuss\", \"Gerald McBoing-Boing (book)\", \"Doctor seus\", \"Seussian\", \"Dr.seuss\", \"Audrey Geisel\", \"Theo. LeSieg\", \"Hunches in bunches\", \"Theodor %22Dr. Seuss%22 Geisel\", \"Ted Geisel\", \"Dr Seuss\", \"The Story of Dr. Seuss\", \"Dr seus\", \"Dr Suess\"]", "[\"Monetary items\", \"Real world money\", \"Pecuniary\", \"Concept of money\", \"Functions of money\", \"Monetary\", \"Hard dollar\", \"Monies\", \"Money\", \"Commercial bank money\", \"Pelf\"]", "[\"China, the Republic of\", \"Republic of China(Taiwan)\", \"Chunghua Minkuo\", \"Taioaan\", \"ISO 3166-1:TW\", \"Tiawan\", \"Taiwan, ROC\", \"Republic of CHina\", \"Republic of China (R.O.C.)\", \"THE ROC\", \"Tai-Wan\", \"Zh\\u014dnghu\\u00e1 M\\u00edn'gu\\u00f3\", \"Chung-hua Min-kuo\", \"Republic of China/Taiwan\", \"Republic of China (1945\\u201371)\", \"Chung-Hua Min-Kuo\", \"Jhong-hua Min-guo\", \"Tawan\", \"China, Republic of\", \"Chunghwaminkuo\", \"JhongHu\\u00e1 M\\u00ednGu\\u00f3\", \"Taiwan country\", \"Ts'ai Tai-wan te Chung-hua Min-kuo\", \"T\\u00e2i-o\\u00e2n\", \"Min Guo\", \"Republic Of China\", \"Taiwan Country\", \"\\u4e2d\\u534e\\u6c11\\u56fd\", \"Taiwan, Republic of China\", \"Chuka Minkoku\", \"China (Republic of)\", \"Taiwan (ROC)\", \"Chunghwa Minkuo\", \"Republic of China on Taiwan\", \"Taiwan ROC\", \"RoC\", \"ROC (China)\", \"Ilha formosa\", \"T\\u00e1iw\\u0101n\", \"Taiwan\", \"TPKM\", \"China, Republic of (Taiwan)\", \"R.O. China\", \"Republic of China (1949\\u2013present)\", \"T\\u00e1iwan\", \"\\u81fa\\u7063\", \"China (Republic : 1949-)\", \"Taiwan (nation)\", \"Jhonghua Minguo\", \"Taioan\", \"Zh\\u014dnghu\\u00e1 M\\u00edngu\\u00f3\", \"Taiwan Island\", \"R.o.China\", \"China (ROC)\", \"Republic of China (ROC)\", \"RO China\", \"Ch\\u016bka Minkoku\", \"R China\", \"Zhonghu\\u00e1 M\\u00edngu\\u00f3\", \"The Republic of China\", \"Zhonghua Minguo\", \"Republic of China\", \"Tawian\", \"China (Taiwan)\", \"Taiwan (Republic of China)\", \"TAIWAN\", \"Republic of china\", \"Free China (modern)\", \"Taiwan (country)\", \"Ta\\u00efwan\", \"\\u53f0\\u6e7e\", \"\\u53f0\\u7063\", \"Minguo\", \"R.O.C\", \"\\u4e2d\\u83ef\\u6c11\\u570b\", \"Republic China\", \"Chunghwa Republic\", \"Chung Min Kuo\", \"Republic of China, Taiwan\", \"Taiwan (state)\", \"Republic of China (Taiwan)\", \"The R.O.C.\", \"JhongHua MinGuo\", \"Tai-oan\", \"T'aiwan\", \"Jhonghu\\u00e1 M\\u00edngu\\u00f3\"]", "[\"sixteen\", \"16\"]", "[\"\\u0391\\u03c1\\u03b9\\u03c3\\u03c4\\u03bf\\u03c4\\u03ad\\u03bb\\u03b7\\u03c2 \\u03a9\\u03bd\\u03ac\\u03c3\\u03b7\\u03c2\", \"Ingeborg Dedichen\", \"Aristotle Onasis\", \"Aristotelis Onassis\", \"Onassis family\", \"Aristotle Onassis\", \"Aristotle Socrates Onassis\", \"Aristotle Sokratis Onassis\", \"Aristotle S. Onassis\", \"Ari Onasis\", \"Ari Onassis\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Joseph Rudyard Kipling\", \"Kiplingesque\", \"Rudyard Kipling\", \"Kipling rudyard\", \"Rudy Kipling\", \"R Kipling\", \"Kipling\", \"Kipling, Joseph Rudyard\", \"Kiplingian\", \"R. Kipling\", \"Ruyard Kipling\", \"Kipling Society\", \"Bard of Empire\", \"Rudyard Kipling (author)\"]", "[\"Fran\\u00e7ais\", \"Francaise\", \"The French\", \"Frenchness\", \"French\", \"Francais\", \"French (disambiguation)\", \"Frrench\"]", "[\"2\", \"Two\", \"two\"]", "[\"1985\", \"one thousand, nine hundred and eighty-five\"]", "[\"Tweedsmuir\"]", "[\"Kate Blanchett\", \"Kate blanchet\", \"Cate Blanchett filmography\", \"Cate Blanchette\", \"Cate Blanchett\", \"Catherine \\u00c9lise %22Cate%22 Blanchett\", \"Catherine \\u00c9lise Blanchett\", \"Kate Blanchette\", \"Catherine Elise Blanchett\", \"Catherine Blanchett\", \"Cate Blanchet\"]", "[\"one thousand, nine hundred and eighty-nine\", \"1989\"]", "[\"Mt. Suribachi\", \"Mount Suribachi\", \"Mt Suribachi\"]", "[\"Danny Boyle\", \"Denny Boyle\", \"Gravity (2015 film)\"]", "[\".d64\", \"Commie 64\", \"CBM64\", \"Commodore 64 Emulators\", \"Comodore 64\", \"C64-II\", \"C64C\", \"Commador 64\", \"C64 (home computer)\", \"Assembler 64\", \"C=64\", \"Commodore 64\", \"CBM 64\", \"Commodore C64\", \"CBM-64\"]", "[\"Biography of dr.seuss\", \"Theodore Geissel\", \"Theodore geisel\", \"Dr.Seuss\", \"Gerald McBoing-Boing (2000 book)\", \"Dr. Soice\", \"Theodore Seuss Geisel\", \"List of films based on Dr. Seuss books\", \"Doctor Seuss\", \"Dr. Seus\", \"Dr seuss\", \"Theo LeSeig\", \"Dr. Theodore Seuss Giesel\", \"Dr sues\", \"Teddy Geisel\", \"Dr.suess\", \"Dr. Seuss' Birthday\", \"Theo Geisel\", \"Dr. Seuss\", \"Theodor Suess Geisel\", \"Theo LeSieg\", \"List of Dr. Seuss films\", \"Theodore (Dr. Seuss) Geisel's\", \"Suess books\", \"Doctor sues\", \"Seuss\", \"The Story of Dr. Seuss (film)\", \"Dr. Suess\", \"Theodor Seuss Geisel\", \"Theodor (Dr. Seuss) Geisel's\", \"Doctor suess\", \"Dr. sues\", \"Theodore Geisel\", \"Theodor Seuss\", \"Gerald McBoing-Boing (book)\", \"Doctor seus\", \"Seussian\", \"Dr.seuss\", \"Audrey Geisel\", \"Theo. LeSieg\", \"Hunches in bunches\", \"Theodor %22Dr. Seuss%22 Geisel\", \"Ted Geisel\", \"Dr Seuss\", \"The Story of Dr. Seuss\", \"Dr seus\", \"Dr Suess\"]", "[\"Monetary items\", \"Real world money\", \"Pecuniary\", \"Concept of money\", \"Functions of money\", \"Monetary\", \"Hard dollar\", \"Monies\", \"Money\", \"Commercial bank money\", \"Pelf\"]", "[\"China, the Republic of\", \"Republic of China(Taiwan)\", \"Chunghua Minkuo\", \"Taioaan\", \"ISO 3166-1:TW\", \"Tiawan\", \"Taiwan, ROC\", \"Republic of CHina\", \"Republic of China (R.O.C.)\", \"THE ROC\", \"Tai-Wan\", \"Zh\\u014dnghu\\u00e1 M\\u00edn'gu\\u00f3\", \"Chung-hua Min-kuo\", \"Republic of China/Taiwan\", \"Republic of China (1945\\u201371)\", \"Chung-Hua Min-Kuo\", \"Jhong-hua Min-guo\", \"Tawan\", \"China, Republic of\", \"Chunghwaminkuo\", \"JhongHu\\u00e1 M\\u00ednGu\\u00f3\", \"Taiwan country\", \"Ts'ai Tai-wan te Chung-hua Min-kuo\", \"T\\u00e2i-o\\u00e2n\", \"Min Guo\", \"Republic Of China\", \"Taiwan Country\", \"\\u4e2d\\u534e\\u6c11\\u56fd\", \"Taiwan, Republic of China\", \"Chuka Minkoku\", \"China (Republic of)\", \"Taiwan (ROC)\", \"Chunghwa Minkuo\", \"Republic of China on Taiwan\", \"Taiwan ROC\", \"RoC\", \"ROC (China)\", \"Ilha formosa\", \"T\\u00e1iw\\u0101n\", \"Taiwan\", \"TPKM\", \"China, Republic of (Taiwan)\", \"R.O. China\", \"Republic of China (1949\\u2013present)\", \"T\\u00e1iwan\", \"\\u81fa\\u7063\", \"China (Republic : 1949-)\", \"Taiwan (nation)\", \"Jhonghua Minguo\", \"Taioan\", \"Zh\\u014dnghu\\u00e1 M\\u00edngu\\u00f3\", \"Taiwan Island\", \"R.o.China\", \"China (ROC)\", \"Republic of China (ROC)\", \"RO China\", \"Ch\\u016bka Minkoku\", \"R China\", \"Zhonghu\\u00e1 M\\u00edngu\\u00f3\", \"The Republic of China\", \"Zhonghua Minguo\", \"Republic of China\", \"Tawian\", \"China (Taiwan)\", \"Taiwan (Republic of China)\", \"TAIWAN\", \"Republic of china\", \"Free China (modern)\", \"Taiwan (country)\", \"Ta\\u00efwan\", \"\\u53f0\\u6e7e\", \"\\u53f0\\u7063\", \"Minguo\", \"R.O.C\", \"\\u4e2d\\u83ef\\u6c11\\u570b\", \"Republic China\", \"Chunghwa Republic\", \"Chung Min Kuo\", \"Republic of China, Taiwan\", \"Taiwan (state)\", \"Republic of China (Taiwan)\", \"The R.O.C.\", \"JhongHua MinGuo\", \"Tai-oan\", \"T'aiwan\", \"Jhonghu\\u00e1 M\\u00edngu\\u00f3\"]", "[\"sixteen\", \"16\"]", "[\"\\u0391\\u03c1\\u03b9\\u03c3\\u03c4\\u03bf\\u03c4\\u03ad\\u03bb\\u03b7\\u03c2 \\u03a9\\u03bd\\u03ac\\u03c3\\u03b7\\u03c2\", \"Ingeborg Dedichen\", \"Aristotle Onasis\", \"Aristotelis Onassis\", \"Onassis family\", \"Aristotle Onassis\", \"Aristotle Socrates Onassis\", \"Aristotle Sokratis Onassis\", \"Aristotle S. Onassis\", \"Ari Onasis\", \"Ari Onassis\"]" ]
[ "Who wrote about a mongoose called Ricki Tikki Tavi", "What nationality is the retail group Carrefour (at 2012)?", "How many players compete in a professional beach volleyball game?", "In which year was East Enders first broadcast?", "Novelist John Buchan's title was first Baron . . . what?", "Who plays the villainous Soviet agent Irina Spalko in the 2008 film ‘Indiana Jones and the Kingdom of the Crystal Skull’?", "Name the year Rumanian dictator Nicolae Ceausecu is executed, Boris Becker wins the last of his three Wimbledon titles and Akihito succeeds his father as Emperor of Japan?", "Feb 23, 1945 saw one of the iconic moments in US history when US marines (and a Navy corpsman), were photographed raising the flag atop was Iwo Jima mountain?", "Who directed the opening ceremony of the 2012 Olympics?", "What model pioneered personal computing in the 1980s, selling over 20 million of its (then huge) 64k memory machines?", "March 2, 1904 saw the birth of what famous American author, who once wrote under the pen name Theo LeSieg?", "‘Spondulicks’ is British slang for what?", "In the traditional story of Sinbad the Sailor, what is the name of the giant bird that carries him off to safety following a shipwreck?", "How many steeplechase fences are on the Aintree Grand National race course?", "Who was Jackie Kennedy's second husband?" ]
15
[ 128745, 128746, 128747, 128748, 128749, 128750, 128751, 128752, 128753, 128754, 128755, 128756, 128757, 128758, 128759 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What on a bird has a calamus, rachis and barbs?\nQuestion 2: Both opposing generals, the British general Wolfe, and the French general Montcalm, were killed in a battle for which city in 1759?\nQuestion 3: What nickname has been given to Indian bowler Harbhajan Singh?\nQuestion 4: Which economic doctrine, popular in the 1980's, was propounded by Milton Friedman?\nQuestion 5: Which bomb was dropped on Nagasaki on 9 August, 1945\nQuestion 6: What is the name of the jockey who won the 2011 English Grand National on Ballabriggs?\nQuestion 7: Who won the Oscar for Best Film Director in 1986 for the film 'Out of Africa'?\nQuestion 8: Which rugby union team play their home games at Salford City Stadium?\nQuestion 9: In the novel Jane Eyre by Charlotte Bronte, what is the name of the headmaster of Lowood Institution?\nQuestion 10: What is the currency of Germany?\nQuestion 11: What nationality is violinist Andre Rieu?\nQuestion 12: What was the subject of the referendum held in Australia 1999?\nQuestion 13: How many natural noble gases are there?\nQuestion 14: Which eponymous heroine of an American novel is a byword for incurable optimism?\nQuestion 15: Who was Home Secretary from 1979 to 1983?", "role": "user" } ]
["[\"Pterylosis\", \"Barbule\", \"Pterylography\", \"Feathery\", \"Feathers\", \"Dyck texture\", \"Plumology\", \"Pterylae\", \"Evolution of the feather\", \"Barbicel\", \"Filoplume\", \"Feather tract\", \"Feather\", \"Feather (bird anatomy)\", \"Barb (feather)\"]", "[\"Province of Qu\\u00e9bec\", \"Quebec (province)\", \"Political culture of Quebec\", \"Qu\\u00e9bec, Canada\", \"Province de Qu\\u00e9bec\", \"Capture of Quebec\", \"Qu\\u00e8bec\", \"Qu\\u00e9bec\", \"CA-QC\", \"Quebec province\", \"Province of Quebec\", \"Qu\\u00e9bec Province\", \"Queb\\u00e9c\", \"Quebec (Province)\", \"Quebec\", \"Foreign relations of Quebec\", \"British Conquest of New France\", \"Province de Quebec\", \"Capture of quebec\", \"Qu\\u00e9bec (Province)\", \"Quebec, Canada\"]", "[\"Harbhajan singh\", \"The Turbanator\", \"Bhajji Singh\", \"\\u0a39\\u0a30\\u0a2d\\u0a1c\\u0a28 \\u0a38\\u0a3f\\u0a70\\u0a18\", \"Harbhajan Singh\"]", "[\"Monetarism\", \"Monetarianism\", \"Monetarist school\", \"Monetarist economics\", \"Monetarists\", \"Monetaristic school\", \"MONETARISM\", \"Monetary rule\", \"Monetarist view\", \"Monetarist\", \"Criticism of monetarism\"]", "[\"Fat man\", \"Nagasaki nuclear bomb\", \"Fat Man\", \"Nagasaki bomb\", \"Mark 3 nuclear bomb\", \"Model 1561\", \"Mark III nuclear bomb\"]", "[\"Jason Maguire\"]", "[\"Sidney pollack\", \"Sidney Pollack\", \"Sydney pollak\", \"Sydney Polack\", \"Sydney Pollock\", \"Sydney Pollack\", \"Sydney Irwin Pollack\", \"SIDNEY POLLACK\", \"Sidney Pollock\"]", "[\"Sale F.C.\", \"Sale Rugby Union Football Club\", \"Sale RFC\", \"Sale Sharks\"]", "[\"Jane Eyre\", \"Mr. Edward Fairfax Rochester\", \"Mr. Rochester\", \"List of artistic depictions of and related to Jane Eyre\", \"Jane Eire\", \"Edward Fairfax Rochester\", \"Jane Eyre: An Autobiography\", \"Mr. Edward Rochester\", \"Reader, I married him\", \"Mr Edward Rochester\", \"Edward Rochester\", \"\\u062c\\u064a\\u0646 \\u0623\\u064a\\u0631\", \"Jane Eyre (novel)\", \"Henry Brocklehurst\", \"St. John Rivers\", \"Mr. Brocklehurst\", \"Mr Edward Fairfax Rochester\", \"Reader, I married him.\", \"Blanche Ingram\", \"Saint John Rivers\", \"Mr Rochester\", \"Adele Varens\", \"Mr Brocklehurst\", \"St. John Eyre Rivers\"]", "[\"Euros\", \"Pros and Cons of the Euro\", \"Currency of Cyprus\", \"Currency of Monaco\", \"EUUR\", \"\\u20acuro\", \"Currency of San Marino\", \"European Union Euro\", \"Euro-Cent\", \"Euro currency\", \"K\\u20ac\", \"Currency of Belgium\", \"BAFFLING PIGS\", \"Currency of Ireland\", \"Eur\", \"Evro\", \"Eouro\", \"Currency of Latvia\", \"EURO\", \"European Union euro\", \"Eiro\", \"Currency of Slovakia\", \"Currency of Spain\", \"Single European currency\", \"E.U.R\", \"European euro\", \"Currency of the Netherlands\", \"Euro\", \"Currency of Finland\", \"\\u0395\\u03c5\\u03c1\\u03ce\", \"Currency of Andorra\", \"Euro (currency)\", \"Fixed exchange rates between the euro and old european currencies\", \"Currency of Malta\", \"Currency of the European Union\", \"Currency of Austria\", \"\\u0404\\u0432\\u0440\\u043e\", \"Currency of France\", \"Euro (EUR)\", \"European Euro\", \"\\u0415\\u0432\\u0440\\u043e\", \"EUR\", \"\\u20acUR\", \"EUuro\", \"Currency of Luxembourg\", \"Currency of Greece\", \"Currency of Italy\", \"The Euro\", \"Teuro\", \"European evro\", \"Currency of Portugal\", \"Baffling pigs\"]", "[\"Autochtones\", \"The Dutch\", \"Netherlanders\", \"Dutch people\", \"Etnic Dutch\", \"Dutch person\", \"Autochtoon\", \"Dutch (ethnic group)\", \"Dutch (ethnic group and nation)\", \"Dutchmen\", \"Dutch People\", \"People of Holland\", \"Autochtonen\", \"DUTCH\", \"Dutch (Ethnic group)\", \"Dutch ethnic group\", \"Netherlander\", \"Etnic dutch\", \"Ethnic Dutch\", \"Netherlandians\", \"Dutch (people)\"]", "[\"To become a republic\"]", "[\"six\", \"6\"]", "[\"Pollyanna Whittier\", \"'POLLYANNA'\", \"The Glad Game\", \"Polyanna\", \"Pollyana\", \"Pollyanna\"]", "[\"William Whitelaw\", \"WILLIAM WHITELAW\", \"Willie Whitelaw, 1st Viscount Whitelaw\", \"Willie Whitelaw\", \"William Whitelaw, Viscount Whitelaw\", \"Viscount Whitelaw\", \"William Whitelaw, 1st Viscount Whitelaw of Penrith\", \"William Stephen Ian Whitelaw\", \"William Whitelaw, 1st Viscount Whitelaw\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Pterylosis\", \"Barbule\", \"Pterylography\", \"Feathery\", \"Feathers\", \"Dyck texture\", \"Plumology\", \"Pterylae\", \"Evolution of the feather\", \"Barbicel\", \"Filoplume\", \"Feather tract\", \"Feather\", \"Feather (bird anatomy)\", \"Barb (feather)\"]", "[\"Province of Qu\\u00e9bec\", \"Quebec (province)\", \"Political culture of Quebec\", \"Qu\\u00e9bec, Canada\", \"Province de Qu\\u00e9bec\", \"Capture of Quebec\", \"Qu\\u00e8bec\", \"Qu\\u00e9bec\", \"CA-QC\", \"Quebec province\", \"Province of Quebec\", \"Qu\\u00e9bec Province\", \"Queb\\u00e9c\", \"Quebec (Province)\", \"Quebec\", \"Foreign relations of Quebec\", \"British Conquest of New France\", \"Province de Quebec\", \"Capture of quebec\", \"Qu\\u00e9bec (Province)\", \"Quebec, Canada\"]", "[\"Harbhajan singh\", \"The Turbanator\", \"Bhajji Singh\", \"\\u0a39\\u0a30\\u0a2d\\u0a1c\\u0a28 \\u0a38\\u0a3f\\u0a70\\u0a18\", \"Harbhajan Singh\"]", "[\"Monetarism\", \"Monetarianism\", \"Monetarist school\", \"Monetarist economics\", \"Monetarists\", \"Monetaristic school\", \"MONETARISM\", \"Monetary rule\", \"Monetarist view\", \"Monetarist\", \"Criticism of monetarism\"]", "[\"Fat man\", \"Nagasaki nuclear bomb\", \"Fat Man\", \"Nagasaki bomb\", \"Mark 3 nuclear bomb\", \"Model 1561\", \"Mark III nuclear bomb\"]", "[\"Jason Maguire\"]", "[\"Sidney pollack\", \"Sidney Pollack\", \"Sydney pollak\", \"Sydney Polack\", \"Sydney Pollock\", \"Sydney Pollack\", \"Sydney Irwin Pollack\", \"SIDNEY POLLACK\", \"Sidney Pollock\"]", "[\"Sale F.C.\", \"Sale Rugby Union Football Club\", \"Sale RFC\", \"Sale Sharks\"]", "[\"Jane Eyre\", \"Mr. Edward Fairfax Rochester\", \"Mr. Rochester\", \"List of artistic depictions of and related to Jane Eyre\", \"Jane Eire\", \"Edward Fairfax Rochester\", \"Jane Eyre: An Autobiography\", \"Mr. Edward Rochester\", \"Reader, I married him\", \"Mr Edward Rochester\", \"Edward Rochester\", \"\\u062c\\u064a\\u0646 \\u0623\\u064a\\u0631\", \"Jane Eyre (novel)\", \"Henry Brocklehurst\", \"St. John Rivers\", \"Mr. Brocklehurst\", \"Mr Edward Fairfax Rochester\", \"Reader, I married him.\", \"Blanche Ingram\", \"Saint John Rivers\", \"Mr Rochester\", \"Adele Varens\", \"Mr Brocklehurst\", \"St. John Eyre Rivers\"]", "[\"Euros\", \"Pros and Cons of the Euro\", \"Currency of Cyprus\", \"Currency of Monaco\", \"EUUR\", \"\\u20acuro\", \"Currency of San Marino\", \"European Union Euro\", \"Euro-Cent\", \"Euro currency\", \"K\\u20ac\", \"Currency of Belgium\", \"BAFFLING PIGS\", \"Currency of Ireland\", \"Eur\", \"Evro\", \"Eouro\", \"Currency of Latvia\", \"EURO\", \"European Union euro\", \"Eiro\", \"Currency of Slovakia\", \"Currency of Spain\", \"Single European currency\", \"E.U.R\", \"European euro\", \"Currency of the Netherlands\", \"Euro\", \"Currency of Finland\", \"\\u0395\\u03c5\\u03c1\\u03ce\", \"Currency of Andorra\", \"Euro (currency)\", \"Fixed exchange rates between the euro and old european currencies\", \"Currency of Malta\", \"Currency of the European Union\", \"Currency of Austria\", \"\\u0404\\u0432\\u0440\\u043e\", \"Currency of France\", \"Euro (EUR)\", \"European Euro\", \"\\u0415\\u0432\\u0440\\u043e\", \"EUR\", \"\\u20acUR\", \"EUuro\", \"Currency of Luxembourg\", \"Currency of Greece\", \"Currency of Italy\", \"The Euro\", \"Teuro\", \"European evro\", \"Currency of Portugal\", \"Baffling pigs\"]", "[\"Autochtones\", \"The Dutch\", \"Netherlanders\", \"Dutch people\", \"Etnic Dutch\", \"Dutch person\", \"Autochtoon\", \"Dutch (ethnic group)\", \"Dutch (ethnic group and nation)\", \"Dutchmen\", \"Dutch People\", \"People of Holland\", \"Autochtonen\", \"DUTCH\", \"Dutch (Ethnic group)\", \"Dutch ethnic group\", \"Netherlander\", \"Etnic dutch\", \"Ethnic Dutch\", \"Netherlandians\", \"Dutch (people)\"]", "[\"To become a republic\"]", "[\"six\", \"6\"]", "[\"Pollyanna Whittier\", \"'POLLYANNA'\", \"The Glad Game\", \"Polyanna\", \"Pollyana\", \"Pollyanna\"]", "[\"William Whitelaw\", \"WILLIAM WHITELAW\", \"Willie Whitelaw, 1st Viscount Whitelaw\", \"Willie Whitelaw\", \"William Whitelaw, Viscount Whitelaw\", \"Viscount Whitelaw\", \"William Whitelaw, 1st Viscount Whitelaw of Penrith\", \"William Stephen Ian Whitelaw\", \"William Whitelaw, 1st Viscount Whitelaw\"]" ]
[ "What on a bird has a calamus, rachis and barbs?", "Both opposing generals, the British general Wolfe, and the French general Montcalm, were killed in a battle for which city in 1759?", "What nickname has been given to Indian bowler Harbhajan Singh?", "Which economic doctrine, popular in the 1980's, was propounded by Milton Friedman?", "Which bomb was dropped on Nagasaki on 9 August, 1945", "What is the name of the jockey who won the 2011 English Grand National on Ballabriggs?", "Who won the Oscar for Best Film Director in 1986 for the film 'Out of Africa'?", "Which rugby union team play their home games at Salford City Stadium?", "In the novel Jane Eyre by Charlotte Bronte, what is the name of the headmaster of Lowood Institution?", "What is the currency of Germany?", "What nationality is violinist Andre Rieu?", "What was the subject of the referendum held in Australia 1999?", "How many natural noble gases are there?", "Which eponymous heroine of an American novel is a byword for incurable optimism?", "Who was Home Secretary from 1979 to 1983?" ]
15
[ 26475, 26476, 26477, 26478, 26479, 26480, 26481, 26482, 26483, 26484, 26485, 26486, 26487, 26488, 26489 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: \"\"\"Scarlett\"\" was a sequel to what well-known novel?\"\nQuestion 2: On which British comedian's (technically comedienne's) US TV show did The Simpsons first appear?\nQuestion 3: Widowed at 25, Martha Custis, nee Dandridge, later married which future American president?\nQuestion 4: Working in military intelligence during WWII, eventually achieving the rank of major, Diana Prince is the alter ego of what DC Comics superhero?\nQuestion 5: What type of instrument is a lute?\nQuestion 6: What baseball player was diagnosed with ALS disease?\nQuestion 7: In snooker, whose nickname is 'The Nugget'?\nQuestion 8: In children's TV what is the name of Fireman Sam's fire truck?\nQuestion 9: Which of Mahler's symphonies is entitled 'The Resurrection'?\nQuestion 10: According to majority scholarly opinion, what was Jesus Christ's main spoken language?\nQuestion 11: What is the process by which an insect undergoes distinct physical change from immaturity (typically larva or nymph) to adulthood?\nQuestion 12: In September 2011, which British comedian swam the length of the River Thames for charity?\nQuestion 13: Which pre-Socratic philosopher, born in the city of Miletus in the 7th century BC, is regarded as 'The Father of Science' and the first modern western philosopher?\nQuestion 14: Which novel by Thomas Hardytakes its title from a line in Shakespeare's 'As You Like It'?\nQuestion 15: The population of Malta is reputed to be descended from which ancient people?", "role": "user" } ]
["[\"Gone with teh wind\", \"Gone With The Wind\", \"GWTW\", \"Gone With the Wind (novel)\", \"Gone with The Wind\", \"Characters in Gone With the Wind\", \"The Winds of Tara\", \"Gone with the wind\", \"Gone with the Win\", \"Gone w/ the wind\", \"Gone With the Wind\", \"Mammy (Gone with the Wind)\", \"Gone with the Wind\", \"Charles Hamilton (Gone with the Wind)\", \"Gone with the Wind (novel)\"]", "[\"Tracy Ullman\", \"Tracy Ulman\", \"Tracey Ullman\", \"Tracey Ulman\"]", "[\"President George Washington\", \"Georg Waschingdon\", \"Geo. Washington\", \"Washington President\", \"G Washington\", \"First President of the United States\", \"George Washington\", \"Early life of George Washington\", \"George Washington's early life\", \"G:o Washington\", \"Georeg washington\", \"George washignton\", \"George Washingtin\", \"George Washington between the wars\", \"George washinton\", \"George Washington's\", \"G washington\", \"Geogre Washington\", \"G. Washington\", \"American Fabius\", \"Goerge washington\", \"Geoge washington\", \"George washington between the wars\", \"George Washinton\", \"George Weashington\", \"1st President of the United States\", \"George Washington's teeth\", \"Washington, George\", \"Geo washington\", \"General Washington\", \"Indispensable Man\", \"The first U.S President\", \"General George Washington\", \"Georgewashington\", \"1st US President\", \"George washingtom\", \"George washington\", \"President Washington\"]", "[\"Wonder-woman\", \"Wonder women\", \"Wonder Lady\", \"Wonder Woman (undeveloped film)\", \"Wonder Woman (comic book)\", \"Wonder-Woman\", \"Wonder Woman: Spirit of Truth\", \"Wonder Tot\", \"Wonder Woman (movie)\", \"Wonderwoman\", \"Wonder woman\", \"Princess Diana (comics)\", \"WonderWoman\", \"Wonder Woman\"]", "[\"Strings film\", \"Strings (film)\", \"String\", \"Strings (album)\", \"String (disambiguation)\", \"Strings\", \"Strings (Film)\"]", "[\"%22Buster%22 Gehrig\", \"Henry Louis 'Buster' Gehrig\", \"Luckiest man on the face of the earth\", \"Gehrig\", \"Biscuit pants\", \"Lou Gehrig\", \"The luckiest man on the face of the earth\", \"%22Lou%22 Gehrig\", \"Henry Louis %22Lou%22 Gehrig\", \"Lou Gehrig Appreciation Day\", \"Lou 'Buster' Gehrig\", \"Henry Louis Gehrig\", \"Ludwig Heinrich Gehrig\", \"Lou %22Buster%22 Gehrig\", \"Lou Gherig\", \"'Buster' Gehrig\", \"Henry Louis %22Buster%22 Gehrig\", \"Lou Gerhig\", \"Louis Gehrig\", \"Henry Louis 'Lou' Gehrig\", \"Lou gehrig\", \"Buster Gehrig\", \"'Lou' Gehrig\", \"Biscuit Pants\", \"Lou gerhig\"]", "[\"Romford Slim\", \"The Ginger Magician\", \"STEVE DAVIS\", \"Steve Davis\", \"Steve Davis (snooker player)\", \"Master Cueman\", \"Ginger Mushroom\", \"Steve Interesting Davis\"]", "[\"Physical characteristics of Jupiter\", \"Sol 5\", \"Jupiter (astronomy)\", \"Weight of Jupiter\", \"Life on Jupiter\", \"Jupitor\", \"Planet Jupiter\", \"Wood Star\", \"Jupiter (Planet)\", \"Jovian diameter\", \"Jupiter!\", \"Mass of Jupiter\", \"Astronomy Jupiter\", \"Zenography\", \"Jupiter (planet)\", \"Jupiter's\", \"\\u2643\", \"Sol-5\", \"Jovian orbit\", \"The mass of Jupiter\", \"Sun f\", \"Sol f\", \"Jupiter weight\", \"Jupiter(planet)\", \"The weight of Jupiter\", \"Sol V\", \"Jupiter's radio emissions\", \"Jupiter\", \"Jupiter radius\", \"Jupitero\"]", "[\"1 second\", \"Fourth (time)\", \"Second (time)\", \"Seconds\", \"Number of seconds in a year\", \"Second duration\", \"Second\", \"Secound\", \"1 E0 s\", \"Secs\", \"Third (time)\", \"Calendar Second\"]", "[\"Armaic\", \"Middle Aramaic\", \"Aramaic languages\", \"Aramaic (language)\", \"Aramaic Language\", \"Armanic\", \"Aramaic phonology\", \"\\u0710\\u072a\\u0721\\u071d\\u0710\", \"Aramic\", \"Aramaic\", \"East Aramaic language\", \"Aramaic language\", \"ISO 639:arc\", \"ARC (language)\", \"Christian Palestinian Aramaic\", \"West Aramaic language\", \"History of the Aramaic language\", \"Arameic\", \"Aramiac\", \"The Worldwide Federation of Aramaic Speakers\", \"Chaldee\", \"Eastern Middle Aramaic\", \"Middle Aramaic language\", \"\\u05d0\\u05e8\\u05de\\u05d9\\u05ea\"]", "[\"Metamorphosise\", \"Metamorphosised\", \"METAMORPHOSE - METAMORPHOSIS Mask Sound & Dance Theatre\", \"Metamorphosizes\", \"Metamorphosing\", \"METAMORPHOSE - Mask Sound & Dance Theatre\", \"Metamorphosis (biology)\", \"Metamorpheses\", \"Metamorphasis\", \"Metamorphose\", \"Holometabolis\", \"Metamorphosize\", \"Metamorphosis\", \"Metamorphosises\", \"Metamorphosizing\", \"Insect metamorphosis\", \"Metamorphisis\", \"Metamorphosising\"]", "[\"David Walliams\", \"Walliams\"]", "[\"THALES\", \"Thales (disambiguation)\"]", "[\"'UNDER THE GREENWOOD TREE'\", \"Under the Greenwood Tree: Or the Mellstock Quire\", \"Under the green wood tree\", \"Under the Greenwood Tree or The Mellstock Quire\", \"Under the Greenwood Tree\", \"Under The Greenwood Tree\", \"Under the greenwood tree\", \"Under the Greenwood Tree or The Mellstock Quire: A Rural Painting of the Dutch School\"]", "[\"Carthaginian civilization\", \"Carthaginian republic\", \"Carthaginian Kingdom\", \"Carthaginian Hegemony\", \"Carthaginians\", \"Carthaginian human sacrifice\", \"Kingdom of Carthage\", \"Carthaginian empire\", \"Ancient Carthage\", \"Carthaginean Empire\", \"Carthaginia\", \"Carthage (state)\", \"Carthaginian Empire\", \"Ancient Carthaginian\", \"Carthaginian Republic\", \"Empire of Carthage\", \"Carthaginian civilisation\", \"Ancient Phoenician Carthage\", \"The Carthaginians\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Gone with teh wind\", \"Gone With The Wind\", \"GWTW\", \"Gone With the Wind (novel)\", \"Gone with The Wind\", \"Characters in Gone With the Wind\", \"The Winds of Tara\", \"Gone with the wind\", \"Gone with the Win\", \"Gone w/ the wind\", \"Gone With the Wind\", \"Mammy (Gone with the Wind)\", \"Gone with the Wind\", \"Charles Hamilton (Gone with the Wind)\", \"Gone with the Wind (novel)\"]", "[\"Tracy Ullman\", \"Tracy Ulman\", \"Tracey Ullman\", \"Tracey Ulman\"]", "[\"President George Washington\", \"Georg Waschingdon\", \"Geo. Washington\", \"Washington President\", \"G Washington\", \"First President of the United States\", \"George Washington\", \"Early life of George Washington\", \"George Washington's early life\", \"G:o Washington\", \"Georeg washington\", \"George washignton\", \"George Washingtin\", \"George Washington between the wars\", \"George washinton\", \"George Washington's\", \"G washington\", \"Geogre Washington\", \"G. Washington\", \"American Fabius\", \"Goerge washington\", \"Geoge washington\", \"George washington between the wars\", \"George Washinton\", \"George Weashington\", \"1st President of the United States\", \"George Washington's teeth\", \"Washington, George\", \"Geo washington\", \"General Washington\", \"Indispensable Man\", \"The first U.S President\", \"General George Washington\", \"Georgewashington\", \"1st US President\", \"George washingtom\", \"George washington\", \"President Washington\"]", "[\"Wonder-woman\", \"Wonder women\", \"Wonder Lady\", \"Wonder Woman (undeveloped film)\", \"Wonder Woman (comic book)\", \"Wonder-Woman\", \"Wonder Woman: Spirit of Truth\", \"Wonder Tot\", \"Wonder Woman (movie)\", \"Wonderwoman\", \"Wonder woman\", \"Princess Diana (comics)\", \"WonderWoman\", \"Wonder Woman\"]", "[\"Strings film\", \"Strings (film)\", \"String\", \"Strings (album)\", \"String (disambiguation)\", \"Strings\", \"Strings (Film)\"]", "[\"%22Buster%22 Gehrig\", \"Henry Louis 'Buster' Gehrig\", \"Luckiest man on the face of the earth\", \"Gehrig\", \"Biscuit pants\", \"Lou Gehrig\", \"The luckiest man on the face of the earth\", \"%22Lou%22 Gehrig\", \"Henry Louis %22Lou%22 Gehrig\", \"Lou Gehrig Appreciation Day\", \"Lou 'Buster' Gehrig\", \"Henry Louis Gehrig\", \"Ludwig Heinrich Gehrig\", \"Lou %22Buster%22 Gehrig\", \"Lou Gherig\", \"'Buster' Gehrig\", \"Henry Louis %22Buster%22 Gehrig\", \"Lou Gerhig\", \"Louis Gehrig\", \"Henry Louis 'Lou' Gehrig\", \"Lou gehrig\", \"Buster Gehrig\", \"'Lou' Gehrig\", \"Biscuit Pants\", \"Lou gerhig\"]", "[\"Romford Slim\", \"The Ginger Magician\", \"STEVE DAVIS\", \"Steve Davis\", \"Steve Davis (snooker player)\", \"Master Cueman\", \"Ginger Mushroom\", \"Steve Interesting Davis\"]", "[\"Physical characteristics of Jupiter\", \"Sol 5\", \"Jupiter (astronomy)\", \"Weight of Jupiter\", \"Life on Jupiter\", \"Jupitor\", \"Planet Jupiter\", \"Wood Star\", \"Jupiter (Planet)\", \"Jovian diameter\", \"Jupiter!\", \"Mass of Jupiter\", \"Astronomy Jupiter\", \"Zenography\", \"Jupiter (planet)\", \"Jupiter's\", \"\\u2643\", \"Sol-5\", \"Jovian orbit\", \"The mass of Jupiter\", \"Sun f\", \"Sol f\", \"Jupiter weight\", \"Jupiter(planet)\", \"The weight of Jupiter\", \"Sol V\", \"Jupiter's radio emissions\", \"Jupiter\", \"Jupiter radius\", \"Jupitero\"]", "[\"1 second\", \"Fourth (time)\", \"Second (time)\", \"Seconds\", \"Number of seconds in a year\", \"Second duration\", \"Second\", \"Secound\", \"1 E0 s\", \"Secs\", \"Third (time)\", \"Calendar Second\"]", "[\"Armaic\", \"Middle Aramaic\", \"Aramaic languages\", \"Aramaic (language)\", \"Aramaic Language\", \"Armanic\", \"Aramaic phonology\", \"\\u0710\\u072a\\u0721\\u071d\\u0710\", \"Aramic\", \"Aramaic\", \"East Aramaic language\", \"Aramaic language\", \"ISO 639:arc\", \"ARC (language)\", \"Christian Palestinian Aramaic\", \"West Aramaic language\", \"History of the Aramaic language\", \"Arameic\", \"Aramiac\", \"The Worldwide Federation of Aramaic Speakers\", \"Chaldee\", \"Eastern Middle Aramaic\", \"Middle Aramaic language\", \"\\u05d0\\u05e8\\u05de\\u05d9\\u05ea\"]", "[\"Metamorphosise\", \"Metamorphosised\", \"METAMORPHOSE - METAMORPHOSIS Mask Sound & Dance Theatre\", \"Metamorphosizes\", \"Metamorphosing\", \"METAMORPHOSE - Mask Sound & Dance Theatre\", \"Metamorphosis (biology)\", \"Metamorpheses\", \"Metamorphasis\", \"Metamorphose\", \"Holometabolis\", \"Metamorphosize\", \"Metamorphosis\", \"Metamorphosises\", \"Metamorphosizing\", \"Insect metamorphosis\", \"Metamorphisis\", \"Metamorphosising\"]", "[\"David Walliams\", \"Walliams\"]", "[\"THALES\", \"Thales (disambiguation)\"]", "[\"'UNDER THE GREENWOOD TREE'\", \"Under the Greenwood Tree: Or the Mellstock Quire\", \"Under the green wood tree\", \"Under the Greenwood Tree or The Mellstock Quire\", \"Under the Greenwood Tree\", \"Under The Greenwood Tree\", \"Under the greenwood tree\", \"Under the Greenwood Tree or The Mellstock Quire: A Rural Painting of the Dutch School\"]", "[\"Carthaginian civilization\", \"Carthaginian republic\", \"Carthaginian Kingdom\", \"Carthaginian Hegemony\", \"Carthaginians\", \"Carthaginian human sacrifice\", \"Kingdom of Carthage\", \"Carthaginian empire\", \"Ancient Carthage\", \"Carthaginean Empire\", \"Carthaginia\", \"Carthage (state)\", \"Carthaginian Empire\", \"Ancient Carthaginian\", \"Carthaginian Republic\", \"Empire of Carthage\", \"Carthaginian civilisation\", \"Ancient Phoenician Carthage\", \"The Carthaginians\"]" ]
[ "\"\"\"Scarlett\"\" was a sequel to what well-known novel?\"", "On which British comedian's (technically comedienne's) US TV show did The Simpsons first appear?", "Widowed at 25, Martha Custis, nee Dandridge, later married which future American president?", "Working in military intelligence during WWII, eventually achieving the rank of major, Diana Prince is the alter ego of what DC Comics superhero?", "What type of instrument is a lute?", "What baseball player was diagnosed with ALS disease?", "In snooker, whose nickname is 'The Nugget'?", "In children's TV what is the name of Fireman Sam's fire truck?", "Which of Mahler's symphonies is entitled 'The Resurrection'?", "According to majority scholarly opinion, what was Jesus Christ's main spoken language?", "What is the process by which an insect undergoes distinct physical change from immaturity (typically larva or nymph) to adulthood?", "In September 2011, which British comedian swam the length of the River Thames for charity?", "Which pre-Socratic philosopher, born in the city of Miletus in the 7th century BC, is regarded as 'The Father of Science' and the first modern western philosopher?", "Which novel by Thomas Hardytakes its title from a line in Shakespeare's 'As You Like It'?", "The population of Malta is reputed to be descended from which ancient people?" ]
15
[ 50445, 50446, 50447, 50448, 50449, 50450, 50451, 50452, 50453, 50454, 50455, 50456, 50457, 50458, 50459 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: In what country would you find the city of Limerick?\nQuestion 2: The Athabasca oil sands are large deposits of heavy crude oil located in which country?\nQuestion 3: \"Who directed the 1995 film \"\"One Flew Over the Cuckoo's Nest'?\"\nQuestion 4: \"\"\"Omnibus\"\" is a word for a common form of public transport taken directly from Latin. What does it mean?\"\nQuestion 5: Which musical featured the song I Feel Pretty?\nQuestion 6: Where, 25 miles West of Knoxville, Tennessee, was an Atomic Bomb Research Station set up in 1942?\nQuestion 7: Which 1975 novel by Larry McMurty was adapted for a 1983 film starring Shirley MacLaine and Debra Winger as mother and daughter?\nQuestion 8: Whose assassination on 28 June 1914 sparked the war?\nQuestion 9: Inkberry, Carolina and Hawaiian are all varieties of which garden plant?\nQuestion 10: Which fashion designer opened a shop called 'Bazaar' on King's Road in London in 1957?\nQuestion 11: Ganymede is the largest moon in the solar system, around which planet does it orbit?\nQuestion 12: The followers of John Wycliffe were called what?\nQuestion 13: Dig 'Em Frog is the mascot for what brand of cereal?\nQuestion 14: Which composer wrote the operas 'The Pearl Fishers' and 'Carmen'?\nQuestion 15: Anthropologist Lévi-Strauss proposed that two animals achieved mythic status in Native American cultures as they are the mediators between life and death. Can you name one of the two?", "role": "user" } ]
["[\"Irlanda\", \"Island ireland\", \"Ireland (region)\", \"Irlandia\", \"Erin's Isle\", \"Airlan\", \"Ireland\", \"West Coast of Ireland\", \"The island of Ireland\", \"Island Ireland\", \"Ireland (island)\", \"Irland\", \"H\\u00c9ireann\", \"Ireland Ulster\", \"Population of Ireland\", \"Irelander\", \"Ireland and Ulster\", \"Ireland (Island)\", \"IRELAND\", \"Symbol of Ireland\", \"Scotia major\", \"Island of Ireland\", \"Airlann\", \"Mikra Britannia\", \"Irelanders\", \"Auld Sod\", \"Ierne (placename)\"]", "[\"Canada\", \"Canad\\u00e1\", \"The Dominion of Canada\", \"Commonwealth of Canada\", \"Dominion of canada\", \"ISO 3166-1:CA\", \"Etymology of Canada\", \"CANADA\", \"Canadiophile\", \"Canada's\", \"\\u1472\\u14c7\\u1455\", \"Canada/References\", \"America's top hat\", \"Canada.\", \"Cnada\", \"\\u010canada\", \"Canadian Federation\", \"Kenadian\", \"Canadialand\", \"Xanada\", \"Dominion of Canada\", \"Canadaa\"]", "[\"Jan Tom\\u00e1\\u0161 Forman\", \"Milo\\u0161 Forman\", \"The Ghost of Munich (film)\", \"Milos Forman\", \"The Ghost of Munich\"]", "[\"For any\", \"\\u2200\", \"Universal operator\", \"Universal quantification\", \"Given any\", \"For every\", \"Universally quantified\", \"Universal quantifier\", \"Upside Down A\", \"For All\", \"For all\", \"All (logic)\", \"Forall\", \"Logical universal\", \"Universally quantify\", \"Universal closure\", \"Upside-down A\"]", "[\"The Sharks (West Side Story)\", \"Gee, Officer Krupke\", \"Westside Story\", \"West Side Story 2008\", \"Riff (character)\", \"West side story\", \"The Jets (West Side Story)\", \"Jet Song\", \"West Side Story\", \"West Side Story (musical)\"]", "[\"Oakridge\", \"Oak Ridge, Texas\", \"Oak Rich\", \"Oak Ridge, TX\", \"Oak Ridge\", \"Oakridge (disambiguation)\", \"Oak Ridge (disambiguation)\"]", "[\"Emma Greenway Horton\", \"Terms Of Endearment (film)\", \"Terms Of Endearment (movie)\", \"Terms of Endearment (film)\", \"Term's of Endearment\", \"Aurora Greenway\", \"Terms Of Endearment\", \"Terms of Endearment\"]", "[\"Archduke Franzis Ferdinand\", \"Franz Ferdinand (archduke)\", \"Franz Habsburg\", \"Archduke Franz Ferdinand of Austria\", \"Archduke Franz Ferninard of Austria\", \"Archduke franz ferdinand of austria\", \"Archduke Francis Ferdinand of Austria\", \"Archduke Francis Ferdinand\", \"Franz Ferdinand, Archduke of Austria\", \"Archudke francis ferdinand\", \"Franz Ferdinand Karl Ludwig Josef von Habsburg-Lothringen\", \"Francis Ferdinand of Habsburg\", \"Francis Ferdinand, Archduke of Austria\", \"Franz Firdinand\", \"Archduke of Austria-Este Francis Ferdinand\", \"Franz Ferdinand of Austria-Este\", \"Franz Ferdinand of Austria\", \"Arch duke ferdinand\", \"Archduke Franz Ferdinand\", \"Francis Ferdinand\", \"Franz Ferdinand\"]", "[\"Ilex species\", \"Holly berry\", \"Holly family\", \"Ilexes\", \"Holly\", \"Aquifoliaceae\", \"Ilex\"]", "[\"Mary Quant Cosmetics\", \"Mary Quant\", \"MARY QUANT\"]", "[\"Physical characteristics of Jupiter\", \"Sol 5\", \"Jupiter (astronomy)\", \"Weight of Jupiter\", \"Life on Jupiter\", \"Jupitor\", \"Planet Jupiter\", \"Wood Star\", \"Jupiter (Planet)\", \"Jovian diameter\", \"Jupiter!\", \"Mass of Jupiter\", \"Astronomy Jupiter\", \"Zenography\", \"Jupiter (planet)\", \"Jupiter's\", \"\\u2643\", \"Sol-5\", \"Jovian orbit\", \"The mass of Jupiter\", \"Sun f\", \"Sol f\", \"Jupiter weight\", \"Jupiter(planet)\", \"The weight of Jupiter\", \"Sol V\", \"Jupiter's radio emissions\", \"Jupiter\", \"Jupiter radius\", \"Jupitero\"]", "[\"Lollardy\", \"Lollardism\", \"Lollards\", \"LOLLARDS\", \"Lollard\", \"Lollard Knights\", \"Lollardry\", \"Lollard knights\"]", "[\"Sugar Smacks\", \"Kellogg's Sugar Smacks\", \"Smacks cereal\", \"Sugar Smacks (cereal)\", \"Smacks (cereal)\", \"Smackums\", \"Kellogg's Honey Smacks\", \"Dig 'em\", \"Honni Korn Smacks\", \"Dig 'Em Frog\", \"Honey Smacks\"]", "[\"GEORGES BIZET\", \"Alexandre Bizet\", \"Georges Alexandre Cesar Leopold Bizet\", \"Bizet\", \"George Bizet\", \"Alexandre Cesar Leopold Bizet\", \"G. Bizet\", \"Alexandre Cesare Leopold Bizet\", \"Georges Bizet\", \"Alexandre C\\u00e9sar L\\u00e9opold Bizet\", \"Georges Bizet's\", \"Georges Alexandre C\\u00e9sar L\\u00e9opold Bizet\"]", "[\"Coyote (or) raven\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Irlanda\", \"Island ireland\", \"Ireland (region)\", \"Irlandia\", \"Erin's Isle\", \"Airlan\", \"Ireland\", \"West Coast of Ireland\", \"The island of Ireland\", \"Island Ireland\", \"Ireland (island)\", \"Irland\", \"H\\u00c9ireann\", \"Ireland Ulster\", \"Population of Ireland\", \"Irelander\", \"Ireland and Ulster\", \"Ireland (Island)\", \"IRELAND\", \"Symbol of Ireland\", \"Scotia major\", \"Island of Ireland\", \"Airlann\", \"Mikra Britannia\", \"Irelanders\", \"Auld Sod\", \"Ierne (placename)\"]", "[\"Canada\", \"Canad\\u00e1\", \"The Dominion of Canada\", \"Commonwealth of Canada\", \"Dominion of canada\", \"ISO 3166-1:CA\", \"Etymology of Canada\", \"CANADA\", \"Canadiophile\", \"Canada's\", \"\\u1472\\u14c7\\u1455\", \"Canada/References\", \"America's top hat\", \"Canada.\", \"Cnada\", \"\\u010canada\", \"Canadian Federation\", \"Kenadian\", \"Canadialand\", \"Xanada\", \"Dominion of Canada\", \"Canadaa\"]", "[\"Jan Tom\\u00e1\\u0161 Forman\", \"Milo\\u0161 Forman\", \"The Ghost of Munich (film)\", \"Milos Forman\", \"The Ghost of Munich\"]", "[\"For any\", \"\\u2200\", \"Universal operator\", \"Universal quantification\", \"Given any\", \"For every\", \"Universally quantified\", \"Universal quantifier\", \"Upside Down A\", \"For All\", \"For all\", \"All (logic)\", \"Forall\", \"Logical universal\", \"Universally quantify\", \"Universal closure\", \"Upside-down A\"]", "[\"The Sharks (West Side Story)\", \"Gee, Officer Krupke\", \"Westside Story\", \"West Side Story 2008\", \"Riff (character)\", \"West side story\", \"The Jets (West Side Story)\", \"Jet Song\", \"West Side Story\", \"West Side Story (musical)\"]", "[\"Oakridge\", \"Oak Ridge, Texas\", \"Oak Rich\", \"Oak Ridge, TX\", \"Oak Ridge\", \"Oakridge (disambiguation)\", \"Oak Ridge (disambiguation)\"]", "[\"Emma Greenway Horton\", \"Terms Of Endearment (film)\", \"Terms Of Endearment (movie)\", \"Terms of Endearment (film)\", \"Term's of Endearment\", \"Aurora Greenway\", \"Terms Of Endearment\", \"Terms of Endearment\"]", "[\"Archduke Franzis Ferdinand\", \"Franz Ferdinand (archduke)\", \"Franz Habsburg\", \"Archduke Franz Ferdinand of Austria\", \"Archduke Franz Ferninard of Austria\", \"Archduke franz ferdinand of austria\", \"Archduke Francis Ferdinand of Austria\", \"Archduke Francis Ferdinand\", \"Franz Ferdinand, Archduke of Austria\", \"Archudke francis ferdinand\", \"Franz Ferdinand Karl Ludwig Josef von Habsburg-Lothringen\", \"Francis Ferdinand of Habsburg\", \"Francis Ferdinand, Archduke of Austria\", \"Franz Firdinand\", \"Archduke of Austria-Este Francis Ferdinand\", \"Franz Ferdinand of Austria-Este\", \"Franz Ferdinand of Austria\", \"Arch duke ferdinand\", \"Archduke Franz Ferdinand\", \"Francis Ferdinand\", \"Franz Ferdinand\"]", "[\"Ilex species\", \"Holly berry\", \"Holly family\", \"Ilexes\", \"Holly\", \"Aquifoliaceae\", \"Ilex\"]", "[\"Mary Quant Cosmetics\", \"Mary Quant\", \"MARY QUANT\"]", "[\"Physical characteristics of Jupiter\", \"Sol 5\", \"Jupiter (astronomy)\", \"Weight of Jupiter\", \"Life on Jupiter\", \"Jupitor\", \"Planet Jupiter\", \"Wood Star\", \"Jupiter (Planet)\", \"Jovian diameter\", \"Jupiter!\", \"Mass of Jupiter\", \"Astronomy Jupiter\", \"Zenography\", \"Jupiter (planet)\", \"Jupiter's\", \"\\u2643\", \"Sol-5\", \"Jovian orbit\", \"The mass of Jupiter\", \"Sun f\", \"Sol f\", \"Jupiter weight\", \"Jupiter(planet)\", \"The weight of Jupiter\", \"Sol V\", \"Jupiter's radio emissions\", \"Jupiter\", \"Jupiter radius\", \"Jupitero\"]", "[\"Lollardy\", \"Lollardism\", \"Lollards\", \"LOLLARDS\", \"Lollard\", \"Lollard Knights\", \"Lollardry\", \"Lollard knights\"]", "[\"Sugar Smacks\", \"Kellogg's Sugar Smacks\", \"Smacks cereal\", \"Sugar Smacks (cereal)\", \"Smacks (cereal)\", \"Smackums\", \"Kellogg's Honey Smacks\", \"Dig 'em\", \"Honni Korn Smacks\", \"Dig 'Em Frog\", \"Honey Smacks\"]", "[\"GEORGES BIZET\", \"Alexandre Bizet\", \"Georges Alexandre Cesar Leopold Bizet\", \"Bizet\", \"George Bizet\", \"Alexandre Cesar Leopold Bizet\", \"G. Bizet\", \"Alexandre Cesare Leopold Bizet\", \"Georges Bizet\", \"Alexandre C\\u00e9sar L\\u00e9opold Bizet\", \"Georges Bizet's\", \"Georges Alexandre C\\u00e9sar L\\u00e9opold Bizet\"]", "[\"Coyote (or) raven\"]" ]
[ "In what country would you find the city of Limerick?", "The Athabasca oil sands are large deposits of heavy crude oil located in which country?", "\"Who directed the 1995 film \"\"One Flew Over the Cuckoo's Nest'?\"", "\"\"\"Omnibus\"\" is a word for a common form of public transport taken directly from Latin. What does it mean?\"", "Which musical featured the song I Feel Pretty?", "Where, 25 miles West of Knoxville, Tennessee, was an Atomic Bomb Research Station set up in 1942?", "Which 1975 novel by Larry McMurty was adapted for a 1983 film starring Shirley MacLaine and Debra Winger as mother and daughter?", "Whose assassination on 28 June 1914 sparked the war?", "Inkberry, Carolina and Hawaiian are all varieties of which garden plant?", "Which fashion designer opened a shop called 'Bazaar' on King's Road in London in 1957?", "Ganymede is the largest moon in the solar system, around which planet does it orbit?", "The followers of John Wycliffe were called what?", "Dig 'Em Frog is the mascot for what brand of cereal?", "Which composer wrote the operas 'The Pearl Fishers' and 'Carmen'?", "Anthropologist Lévi-Strauss proposed that two animals achieved mythic status in Native American cultures as they are the mediators between life and death. Can you name one of the two?" ]
15
[ 99960, 99961, 99962, 99963, 99964, 99965, 99966, 99967, 99968, 99969, 99970, 99971, 99972, 99973, 99974 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Rick Allen is the one armed drummer of which English rock band?\nQuestion 2: What was the Muse d'Orsay in Paris used for before it was an art gallery?\nQuestion 3: October 2, 1950 saw the introduction of the \"moderately famous\" comic strip known as Peanuts. Who was the creative genius behind the long running strip?\nQuestion 4: Referring to a mountain range, derived from the Spanish word for saw, what word represents the letter 'S' in the NATO phonetic alphabet?\nQuestion 5: Who was the second person to orbit the earth?\nQuestion 6: What colour are the flowers of the saw-wort?\nQuestion 7: Which Austrian, a pioneer in psycho-analysis, died in London in 1939, a refugee from Nazi persecution?\nQuestion 8: Next month sees the announcement of the 2011 Pulitzer Prizes. What Ivy League school administers the prize?\nQuestion 9: On which date is the Battle of Britain commemorated?\nQuestion 10: Which Portuguese navigator (1467-1520) is regarded as the discoverer of Brazil?\nQuestion 11: On which motorway is the Tamworth service station?\nQuestion 12: Which state in the USA is equidistant from the Atlantic and Pacific Oceans, containing both the geographic centre of the 48 contiguous USA states and the geodetic centre of North America?\nQuestion 13: What is the Strait between Sicily and mainland Italy?\nQuestion 14: The theme for television's 'The Apprentice', is taken from which ballet by Prokoviev?\nQuestion 15: \"Which six letter word of Japanese origin means \"\"Ten Thousand Years Of Life\"\" although foreigners confuse it with a war cry referring meaning \"\"Human Wave Attacks\"\" ?\"", "role": "user" } ]
["[\"Def leppard let's go\", \"Def lepard\", \"Deaf Leppard\", \"Deff Leppard\", \"Def Leppard band members\", \"Def leppard band members\", \"Def Leopard\", \"Der Leppar\", \"Atomic Mass band\", \"List of Def Leppard members\", \"Def Leppard\", \"Leppard\", \"DEF LEPPARD ,\", \"Deaf Leopard\"]", "[\"\\ud83d\\ude89\", \"House track\", \"Station (rail)\", \"Station track\", \"Platform track\", \"Railway stop\", \"Rail terminus\", \"Stationyards\", \"Terminal (railroad)\", \"Railroad station\", \"Terminal station\", \"Train depot\", \"Railway stations\", \"Stewarton station\", \"Train Station\", \"Haltepunkt\", \"Maintenance track\", \"Station stop\", \"Passenger depot\", \"Technical stoppages\", \"Rail Road Station\", \"Unmanned halt\", \"Passenger station\", \"Railway station\", \"City railway station\", \"Rail station\", \"Railway halt\", \"Station-yard\", \"Stationyard\", \"Railwaystation\", \"Railroad depot\", \"Railway terminal\", \"Railroad stations\", \"Railroad terminal\", \"Terminal train station\", \"Station yards\", \"Through track\", \"Technical stop (railway)\", \"Train halt\", \"Halt station\", \"Terminal (railway)\", \"Railway Station\", \"Turnback\", \"Railway Depot\", \"Terminus station\", \"Railway station (moved)\", \"Station-yards\", \"Train stations\", \"Station yard\", \"Gare\", \"Train station\", \"Halt (railway)\"]", "[\"Sparky Schulz\", \"Charles Shulz\", \"Charles M. Shultz\", \"Charles M. Schulz\", \"Charles M Schulz\", \"Schulz, Charles Monroe\", \"Charles Shultz\", \"Schulz, Charles M\", \"Charles M. Schultz\", \"Charles Monroe Schulz\", \"Schulz, Charles M.\", \"Charles Schulz\", \"Charles Shulz Tribute\", \"Charlie Brown, Snoopy and Me\"]", "[\"Sierra\", \"Sierra (disambiguation)\", \"The Sierra\"]", "[\"Gherman Titov\", \"Second man in space\", \"Second man into space\", \"German Titov\", \"\\u0413\\u0435\\u0440\\u043c\\u0430\\u043d \\u0421\\u0442\\u0435\\u043f\\u0430\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0422\\u0438\\u0442\\u043e\\u0432\", \"Gherman Stepanovich Titov\"]", "[\"Purplingly\", \"Purple (colour)\", \"Purplishness\", \"Purple\", \"Purpled\", \"Purplest\", \"Northwestern Purple (color)\", \"Heather Purple\", \"Words which rhyme with Purple\", \"Purpleish\", \"Purple flowers\", \"Purplishly\", \"Purpling\", \"Purple (color)\", \"List of terms associated with the color purple\", \"Purple vs. violet\", \"Purples\", \"Purpler\"]", "[\"Zigi Frojd\", \"Sigmund Fruid\", \"Sigmund freud\", \"Freudian\", \"Project for a Scientific Psychology\", \"Freudism\", \"Sigmund Schlomo Freud\", \"Freuds\", \"Frued\", \"Siegmund Freud\", \"Sigismund Freud\", \"Sigmund Frued\", \"Sigmund froyd\", \"Freudian psychoanalysis\", \"S. Freud\", \"Sigismund Schlomo Freud\", \"Dr. Sigmund Freud\", \"Freud\", \"Freudian theory\", \"Freud\\u2019s\", \"Vienna Psychoanalytic Association\", \"Freud, Sigmund\", \"Sick man fraud\", \"Sophie Halberstadt-Freud\", \"Sickman fraud\", \"Freudian Theory\", \"Sigismund Shlomo Freud\", \"Sigmund Freud\", \"Sigmond Freud\"]", "[\"Columbia\", \"Columbia (municipality)\", \"Columbia (song)\", \"Columbia automobile\", \"Columbia (yacht)\", \"Columbia (disambiguation)\", \"Columbia (town)\"]", "[\"15 September\", \"Sept 15\", \"Sep 15\", \"September 15th\", \"September 15\", \"15th SEPTEMBER\", \"15th September\"]", "[\"Pedraluarez Cabral\", \"Pedro Alvares Cabral\", \"Cabral, Pedralvarez\", \"Pedro Alavarez Cabral\", \"Pedr\\u00e1lvares Cabral\", \"Alvares Cabral\", \"Pedro \\u00c1lvares Cabral\", \"Pedro Cabral\", \"Pero \\u00c1lvares Cabral\", \"Pedr'\\u00c1lv\\u00e1res Cabral\", \"Pedro Alvarez Cabral\", \"(Pedro Alvares) Cabral\", \"Pietro Cabral\", \"Pedralvarez Cabral\"]", "[\"M42\", \"M-42\", \"M42 (disambiguation)\"]", "[\"Kans.\", \"Demographics of Kansas\", \"Economy of Kansas\", \"Kansasanian Soviet Socialist Republic\", \"Politics of Kansas\", \"Law of Kansas\", \"Climate of Kansas\", \"Kan.\", \"Cansas\", \"Kansas\", \"State of Kansas\", \"Geography of Kansas\", \"Culture of Kansas\", \"Transportation in Kansas\", \"KS, USA\", \"Thirty-fourth State\", \"Brownbackistan\", \"Sunflower State\", \"Transport in Kansas\", \"Religion in Kansas\", \"The Sunflower State\", \"Kansas (State)\", \"Sports in Kansas\", \"Thirty-Fourth State\", \"Kansas (U.S. state)\", \"Kansas, United States\", \"34th State\", \"Kansas (state)\"]", "[\"Straight of Messina\", \"Strait Of Messina\", \"Straits of messina\", \"Strait of Messina\", \"Straits of Messina\", \"Messina Strait\", \"Straights of Messina\"]", "[\"The Tragedy of Romeo and Juliet\", \"Juliet and Romeo (opera)\", \"The Most Excellent and Lamentable Tragedy of Romeo and Juliet\", \"Romeo and Juliet\", \"Romeo and Iuliet\", \"Romeo and juilet\", \"The most excellent and lamentable tragedie, of Romeo and Iuliet\", \"A plague on both your houses\", \"Escalus\", \"Romeo And Juliet\", \"Romeo & juliet act 5\", \"The Tragedy Of Romeo And Juliet\", \"Romeo and Julia\", \"Romeo & Juliette\", \"Romeo and Juilet\", \"'ROMEO AND JULIET'\", \"The Tragedy of Romeo & Juliet\", \"Romeo Juliet\", \"Romeo and Juliet Conflicts\", \"Romeo and Julet\", \"Romeo and juliet\", \"Romio and Julliet\", \"Romeo and Juliet (play)\", \"The Tragedy Romeo and Juliet\", \"Romeo & Juliet\", \"Montague and Capulet\", \"Romeo and Juiliet\", \"Romeo and Juliette\"]", "[\"Nippon banzai\", \"Banzei\", \"Banzai (song)\", \"BANZAI\", \"Banzai!\", \"Banzai\", \"Banzai (disambiguation)\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Def leppard let's go\", \"Def lepard\", \"Deaf Leppard\", \"Deff Leppard\", \"Def Leppard band members\", \"Def leppard band members\", \"Def Leopard\", \"Der Leppar\", \"Atomic Mass band\", \"List of Def Leppard members\", \"Def Leppard\", \"Leppard\", \"DEF LEPPARD ,\", \"Deaf Leopard\"]", "[\"\\ud83d\\ude89\", \"House track\", \"Station (rail)\", \"Station track\", \"Platform track\", \"Railway stop\", \"Rail terminus\", \"Stationyards\", \"Terminal (railroad)\", \"Railroad station\", \"Terminal station\", \"Train depot\", \"Railway stations\", \"Stewarton station\", \"Train Station\", \"Haltepunkt\", \"Maintenance track\", \"Station stop\", \"Passenger depot\", \"Technical stoppages\", \"Rail Road Station\", \"Unmanned halt\", \"Passenger station\", \"Railway station\", \"City railway station\", \"Rail station\", \"Railway halt\", \"Station-yard\", \"Stationyard\", \"Railwaystation\", \"Railroad depot\", \"Railway terminal\", \"Railroad stations\", \"Railroad terminal\", \"Terminal train station\", \"Station yards\", \"Through track\", \"Technical stop (railway)\", \"Train halt\", \"Halt station\", \"Terminal (railway)\", \"Railway Station\", \"Turnback\", \"Railway Depot\", \"Terminus station\", \"Railway station (moved)\", \"Station-yards\", \"Train stations\", \"Station yard\", \"Gare\", \"Train station\", \"Halt (railway)\"]", "[\"Sparky Schulz\", \"Charles Shulz\", \"Charles M. Shultz\", \"Charles M. Schulz\", \"Charles M Schulz\", \"Schulz, Charles Monroe\", \"Charles Shultz\", \"Schulz, Charles M\", \"Charles M. Schultz\", \"Charles Monroe Schulz\", \"Schulz, Charles M.\", \"Charles Schulz\", \"Charles Shulz Tribute\", \"Charlie Brown, Snoopy and Me\"]", "[\"Sierra\", \"Sierra (disambiguation)\", \"The Sierra\"]", "[\"Gherman Titov\", \"Second man in space\", \"Second man into space\", \"German Titov\", \"\\u0413\\u0435\\u0440\\u043c\\u0430\\u043d \\u0421\\u0442\\u0435\\u043f\\u0430\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0422\\u0438\\u0442\\u043e\\u0432\", \"Gherman Stepanovich Titov\"]", "[\"Purplingly\", \"Purple (colour)\", \"Purplishness\", \"Purple\", \"Purpled\", \"Purplest\", \"Northwestern Purple (color)\", \"Heather Purple\", \"Words which rhyme with Purple\", \"Purpleish\", \"Purple flowers\", \"Purplishly\", \"Purpling\", \"Purple (color)\", \"List of terms associated with the color purple\", \"Purple vs. violet\", \"Purples\", \"Purpler\"]", "[\"Zigi Frojd\", \"Sigmund Fruid\", \"Sigmund freud\", \"Freudian\", \"Project for a Scientific Psychology\", \"Freudism\", \"Sigmund Schlomo Freud\", \"Freuds\", \"Frued\", \"Siegmund Freud\", \"Sigismund Freud\", \"Sigmund Frued\", \"Sigmund froyd\", \"Freudian psychoanalysis\", \"S. Freud\", \"Sigismund Schlomo Freud\", \"Dr. Sigmund Freud\", \"Freud\", \"Freudian theory\", \"Freud\\u2019s\", \"Vienna Psychoanalytic Association\", \"Freud, Sigmund\", \"Sick man fraud\", \"Sophie Halberstadt-Freud\", \"Sickman fraud\", \"Freudian Theory\", \"Sigismund Shlomo Freud\", \"Sigmund Freud\", \"Sigmond Freud\"]", "[\"Columbia\", \"Columbia (municipality)\", \"Columbia (song)\", \"Columbia automobile\", \"Columbia (yacht)\", \"Columbia (disambiguation)\", \"Columbia (town)\"]", "[\"15 September\", \"Sept 15\", \"Sep 15\", \"September 15th\", \"September 15\", \"15th SEPTEMBER\", \"15th September\"]", "[\"Pedraluarez Cabral\", \"Pedro Alvares Cabral\", \"Cabral, Pedralvarez\", \"Pedro Alavarez Cabral\", \"Pedr\\u00e1lvares Cabral\", \"Alvares Cabral\", \"Pedro \\u00c1lvares Cabral\", \"Pedro Cabral\", \"Pero \\u00c1lvares Cabral\", \"Pedr'\\u00c1lv\\u00e1res Cabral\", \"Pedro Alvarez Cabral\", \"(Pedro Alvares) Cabral\", \"Pietro Cabral\", \"Pedralvarez Cabral\"]", "[\"M42\", \"M-42\", \"M42 (disambiguation)\"]", "[\"Kans.\", \"Demographics of Kansas\", \"Economy of Kansas\", \"Kansasanian Soviet Socialist Republic\", \"Politics of Kansas\", \"Law of Kansas\", \"Climate of Kansas\", \"Kan.\", \"Cansas\", \"Kansas\", \"State of Kansas\", \"Geography of Kansas\", \"Culture of Kansas\", \"Transportation in Kansas\", \"KS, USA\", \"Thirty-fourth State\", \"Brownbackistan\", \"Sunflower State\", \"Transport in Kansas\", \"Religion in Kansas\", \"The Sunflower State\", \"Kansas (State)\", \"Sports in Kansas\", \"Thirty-Fourth State\", \"Kansas (U.S. state)\", \"Kansas, United States\", \"34th State\", \"Kansas (state)\"]", "[\"Straight of Messina\", \"Strait Of Messina\", \"Straits of messina\", \"Strait of Messina\", \"Straits of Messina\", \"Messina Strait\", \"Straights of Messina\"]", "[\"The Tragedy of Romeo and Juliet\", \"Juliet and Romeo (opera)\", \"The Most Excellent and Lamentable Tragedy of Romeo and Juliet\", \"Romeo and Juliet\", \"Romeo and Iuliet\", \"Romeo and juilet\", \"The most excellent and lamentable tragedie, of Romeo and Iuliet\", \"A plague on both your houses\", \"Escalus\", \"Romeo And Juliet\", \"Romeo & juliet act 5\", \"The Tragedy Of Romeo And Juliet\", \"Romeo and Julia\", \"Romeo & Juliette\", \"Romeo and Juilet\", \"'ROMEO AND JULIET'\", \"The Tragedy of Romeo & Juliet\", \"Romeo Juliet\", \"Romeo and Juliet Conflicts\", \"Romeo and Julet\", \"Romeo and juliet\", \"Romio and Julliet\", \"Romeo and Juliet (play)\", \"The Tragedy Romeo and Juliet\", \"Romeo & Juliet\", \"Montague and Capulet\", \"Romeo and Juiliet\", \"Romeo and Juliette\"]", "[\"Nippon banzai\", \"Banzei\", \"Banzai (song)\", \"BANZAI\", \"Banzai!\", \"Banzai\", \"Banzai (disambiguation)\"]" ]
[ "Rick Allen is the one armed drummer of which English rock band?", "What was the Muse d'Orsay in Paris used for before it was an art gallery?", "October 2, 1950 saw the introduction of the \"moderately famous\" comic strip known as Peanuts. Who was the creative genius behind the long running strip?", "Referring to a mountain range, derived from the Spanish word for saw, what word represents the letter 'S' in the NATO phonetic alphabet?", "Who was the second person to orbit the earth?", "What colour are the flowers of the saw-wort?", "Which Austrian, a pioneer in psycho-analysis, died in London in 1939, a refugee from Nazi persecution?", "Next month sees the announcement of the 2011 Pulitzer Prizes. What Ivy League school administers the prize?", "On which date is the Battle of Britain commemorated?", "Which Portuguese navigator (1467-1520) is regarded as the discoverer of Brazil?", "On which motorway is the Tamworth service station?", "Which state in the USA is equidistant from the Atlantic and Pacific Oceans, containing both the geographic centre of the 48 contiguous USA states and the geodetic centre of North America?", "What is the Strait between Sicily and mainland Italy?", "The theme for television's 'The Apprentice', is taken from which ballet by Prokoviev?", "\"Which six letter word of Japanese origin means \"\"Ten Thousand Years Of Life\"\" although foreigners confuse it with a war cry referring meaning \"\"Human Wave Attacks\"\" ?\"" ]
15
[ 31365, 31366, 31367, 31368, 31369, 31370, 31371, 31372, 31373, 31374, 31375, 31376, 31377, 31378, 31379 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: ... Anise, used for aniseed flavouring typically in Asian cooking?\nQuestion 2: Who rode from Boston to Lexington to warn US forces of a British Approach?\nQuestion 3: If you ordered “cuisses de grenouilles” in a French restaurant, what would you be getting?\nQuestion 4: What is the name for a line on a map connecting places of equal rainfall?\nQuestion 5: King Ludwig II of Bavaria was the patron of which German composer ?\nQuestion 6: In 2007, Forrest Whittaker won the 'Oscar' for Best Actor for his role in which film?\nQuestion 7: Which heritage railway featured on the original film of The Railway Children?\nQuestion 8: Shakespeare's romantic tragedy written c1598 is called 'Much Ado about (What?)'?\nQuestion 9: July 12, 1862 saw the creation of what decoration, the highest military medal able to be awarded?\nQuestion 10: Which Scottish football club is nicknamed The Arabs?\nQuestion 11: \"To which interviewer did Richard Nixon say, \"\"I never cry except in public?\"\nQuestion 12: What was the name of the human powered aircraft which crossed the Channel in 1979?\nQuestion 13: The Flying Wallendas were a circus act and daredevil stunt performers with Barnum & Bailey for 40 years, and Karl Wallenda was known for high wire performances. From which country did they originate.\nQuestion 14: The Crystal Palace was re-erected on which hill in South London after the Great Exhibition of 1851?\nQuestion 15: Who wrote 'The Jungle Book'?", "role": "user" } ]
["[\"Stellar diameter\", \"Intermediate mass stars\", \"Massive star\", \"Stellum\", \"Star\", \"Star fission\", \"Wishstar\", \"Intermediate mass star\", \"End of the Sun\", \"Stellar radius\", \"Stars\", \"Intermediate star\", \"\\ud83c\\udf1f\"]", "[\"Brown Beauty\", \"The British are coming\", \"Paul Revere\", \"Revere, Paul\", \"Paul Rever\"]", "[\"Frog legs\", \"FROGS\\u2019 LEGS\", \"Frogs\\u2019 legs\", \"Frogs' legs\", \"Frog leg\", \"Frogslegs\", \"Frog's legs\", \"Frogs legs\"]", "[\"Isopleths\", \"Isobar (meteorology)\", \"Aclinic line\", \"Isohel\", \"Isoclinic line\", \"Isohyetal line\", \"Isohytes\", \"Isogon (meteorology)\", \"Isocheim\", \"Isopleth\", \"Halleyan lines\", \"Isohyat\", \"Contour plot\", \"Agonic line\", \"Isotherm (contour line)\", \"Aclinic Line\", \"Isohypse\", \"Isohyet\", \"Isotherms\", \"Agonic lines\", \"Isogon\", \"Contour line\", \"Isodynamic Lines\", \"Isolines\", \"Isodynamic line\", \"Isoclinic Lines\", \"Contour Plot\", \"Height Contours\", \"Isohume\", \"Isoflor\", \"Contour lines\", \"Isallobar\", \"Isodrosotherm\", \"Agonie Lines\", \"Isarithm\", \"Contour maps\", \"Isogon (geomagnetism)\", \"Contour map\", \"Isohyetal\", \"Mathematical Contours\", \"Isogonic lines\", \"Isotach\", \"Isophote\", \"Contour interval\", \"Halleyan line\", \"Isogonic line\"]", "[\"Wagner's\", \"Wilhelm Richard Wagner\", \"W. Richard Wagner\", \"Wagnerian opera\", \"W. R. Wagner\", \"Wagnerian\", \"Wagner\", \"Richard Wagnerr\", \"R Wagner\", \"Ricard Wagner\", \"WAGNER\", \"R.Wagner\", \"Richard Wagner\"]", "[\"Last King Of Scotland\", \"Nicholas Garrigan\", \"Last King of Scotland\", \"The Last King Of Scotland\", \"The Last King of Scotland\", \"'THE LAST KING OF SCOTLAND'\", \"Last king of scotland\", \"The Last King of Scotland (book)\", \"The last king of scotland\"]", "[\"Keighley & Worth Valley Railway\", \"Worth Valley Railway\", \"Keighley and Worth Valley Railway\", \"K&WVR\", \"keighley and worth valley railway\", \"K&wvr\", \"Keighley and Worth Valley railway\", \"Worth valley Railway\"]", "[\"Sod alll\", \"No thing\", \"Nothingness\", \"Nonexistent\", \"Diddly-squat\", \"Sod all\", \"Nothing major\", \"Nothin\", \"Nothing\", \"Diddly squat\", \"Absolutely nothing\"]", "[\"Medal of Honor Flag\", \"US Army Medal of Honor\", \"CMOH\", \"Medal Of Honor\", \"Congressional medal of honour\", \"Valor 24\", \"Congressional medal of honor\", \"Medal of Honor (United States)\", \"Congressional Medal of Honor Society of the United States of America\", \"Congressional Medal Of Honor\", \"Medal of honor\", \"Medals of Honor\", \"Congressional Medal of Honour\", \"Civil War Medal of Honor\", \"Medal of Honor\", \"Congressional Medal of Honor\"]", "[\"Dundee United F. C.\", \"Terry The Terror\", \"Dundee Utd\", \"Dundee united fc\", \"Dundee United F C\", \"Dundee United F.C.\", \"Dundee United F.C. Under-19s\", \"Dundee United\", \"Dundee Hibernian\", \"Dundee Utd F.C.\", \"Dundee United FC\", \"DUNDEE United.\", \"Dundee Hibernian F.C.\"]", "[\"Sir David Paradine Frost\", \"David Frost (broadcaster)\", \"The David Frost Show\", \"David Frost\", \"David Paradine\", \"Sir David Frost\", \"David Frost Show\", \"David Paradine Frost\"]", "[\"Gossamer Albatross\", \"MacCready Gossamer Albatross\", \"GOSSAMER ALBATROSS\"]", "[\"United States of Germany\", \"Tyskland\", \"Nimska\", \"Bundesdeutsch\", \"Vokietija\", \"Deuchland\", \"Germny\", \"GermanY\", \"FR Germany\", \"Almanya\", \"Federal Republic of Germany\", \"Jermany\", \"Geramny\", \"Etymology of Germany\", \"Nemska\", \"Germany\", \"Niemcy\", \"GERMANY\", \"ISO 3166-1:DE\", \"Land der Dichter und Denker\", \"Federal Republic Of Germany\", \"F.R. Germany\", \"Deutschland\", \"Bundesrepublik Deutschland\", \"BR Deutschland\", \"Germanio\", \"Thyskaland\", \"GerMany\", \"Germeny\", \"Teutonica\", \"Deutchland\", \"Duitsland\", \"THyskaland\", \"Alemanha\", \"N\\u011bmska\", \"Foederal Republic of Germany\"]", "[\"Sydenham Hill\"]", "[\"Joseph Rudyard Kipling\", \"Kiplingesque\", \"Rudyard Kipling\", \"Kipling rudyard\", \"Rudy Kipling\", \"R Kipling\", \"Kipling\", \"Kipling, Joseph Rudyard\", \"Kiplingian\", \"R. Kipling\", \"Ruyard Kipling\", \"Kipling Society\", \"Bard of Empire\", \"Rudyard Kipling (author)\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Stellar diameter\", \"Intermediate mass stars\", \"Massive star\", \"Stellum\", \"Star\", \"Star fission\", \"Wishstar\", \"Intermediate mass star\", \"End of the Sun\", \"Stellar radius\", \"Stars\", \"Intermediate star\", \"\\ud83c\\udf1f\"]", "[\"Brown Beauty\", \"The British are coming\", \"Paul Revere\", \"Revere, Paul\", \"Paul Rever\"]", "[\"Frog legs\", \"FROGS\\u2019 LEGS\", \"Frogs\\u2019 legs\", \"Frogs' legs\", \"Frog leg\", \"Frogslegs\", \"Frog's legs\", \"Frogs legs\"]", "[\"Isopleths\", \"Isobar (meteorology)\", \"Aclinic line\", \"Isohel\", \"Isoclinic line\", \"Isohyetal line\", \"Isohytes\", \"Isogon (meteorology)\", \"Isocheim\", \"Isopleth\", \"Halleyan lines\", \"Isohyat\", \"Contour plot\", \"Agonic line\", \"Isotherm (contour line)\", \"Aclinic Line\", \"Isohypse\", \"Isohyet\", \"Isotherms\", \"Agonic lines\", \"Isogon\", \"Contour line\", \"Isodynamic Lines\", \"Isolines\", \"Isodynamic line\", \"Isoclinic Lines\", \"Contour Plot\", \"Height Contours\", \"Isohume\", \"Isoflor\", \"Contour lines\", \"Isallobar\", \"Isodrosotherm\", \"Agonie Lines\", \"Isarithm\", \"Contour maps\", \"Isogon (geomagnetism)\", \"Contour map\", \"Isohyetal\", \"Mathematical Contours\", \"Isogonic lines\", \"Isotach\", \"Isophote\", \"Contour interval\", \"Halleyan line\", \"Isogonic line\"]", "[\"Wagner's\", \"Wilhelm Richard Wagner\", \"W. Richard Wagner\", \"Wagnerian opera\", \"W. R. Wagner\", \"Wagnerian\", \"Wagner\", \"Richard Wagnerr\", \"R Wagner\", \"Ricard Wagner\", \"WAGNER\", \"R.Wagner\", \"Richard Wagner\"]", "[\"Last King Of Scotland\", \"Nicholas Garrigan\", \"Last King of Scotland\", \"The Last King Of Scotland\", \"The Last King of Scotland\", \"'THE LAST KING OF SCOTLAND'\", \"Last king of scotland\", \"The Last King of Scotland (book)\", \"The last king of scotland\"]", "[\"Keighley & Worth Valley Railway\", \"Worth Valley Railway\", \"Keighley and Worth Valley Railway\", \"K&WVR\", \"keighley and worth valley railway\", \"K&wvr\", \"Keighley and Worth Valley railway\", \"Worth valley Railway\"]", "[\"Sod alll\", \"No thing\", \"Nothingness\", \"Nonexistent\", \"Diddly-squat\", \"Sod all\", \"Nothing major\", \"Nothin\", \"Nothing\", \"Diddly squat\", \"Absolutely nothing\"]", "[\"Medal of Honor Flag\", \"US Army Medal of Honor\", \"CMOH\", \"Medal Of Honor\", \"Congressional medal of honour\", \"Valor 24\", \"Congressional medal of honor\", \"Medal of Honor (United States)\", \"Congressional Medal of Honor Society of the United States of America\", \"Congressional Medal Of Honor\", \"Medal of honor\", \"Medals of Honor\", \"Congressional Medal of Honour\", \"Civil War Medal of Honor\", \"Medal of Honor\", \"Congressional Medal of Honor\"]", "[\"Dundee United F. C.\", \"Terry The Terror\", \"Dundee Utd\", \"Dundee united fc\", \"Dundee United F C\", \"Dundee United F.C.\", \"Dundee United F.C. Under-19s\", \"Dundee United\", \"Dundee Hibernian\", \"Dundee Utd F.C.\", \"Dundee United FC\", \"DUNDEE United.\", \"Dundee Hibernian F.C.\"]", "[\"Sir David Paradine Frost\", \"David Frost (broadcaster)\", \"The David Frost Show\", \"David Frost\", \"David Paradine\", \"Sir David Frost\", \"David Frost Show\", \"David Paradine Frost\"]", "[\"Gossamer Albatross\", \"MacCready Gossamer Albatross\", \"GOSSAMER ALBATROSS\"]", "[\"United States of Germany\", \"Tyskland\", \"Nimska\", \"Bundesdeutsch\", \"Vokietija\", \"Deuchland\", \"Germny\", \"GermanY\", \"FR Germany\", \"Almanya\", \"Federal Republic of Germany\", \"Jermany\", \"Geramny\", \"Etymology of Germany\", \"Nemska\", \"Germany\", \"Niemcy\", \"GERMANY\", \"ISO 3166-1:DE\", \"Land der Dichter und Denker\", \"Federal Republic Of Germany\", \"F.R. Germany\", \"Deutschland\", \"Bundesrepublik Deutschland\", \"BR Deutschland\", \"Germanio\", \"Thyskaland\", \"GerMany\", \"Germeny\", \"Teutonica\", \"Deutchland\", \"Duitsland\", \"THyskaland\", \"Alemanha\", \"N\\u011bmska\", \"Foederal Republic of Germany\"]", "[\"Sydenham Hill\"]", "[\"Joseph Rudyard Kipling\", \"Kiplingesque\", \"Rudyard Kipling\", \"Kipling rudyard\", \"Rudy Kipling\", \"R Kipling\", \"Kipling\", \"Kipling, Joseph Rudyard\", \"Kiplingian\", \"R. Kipling\", \"Ruyard Kipling\", \"Kipling Society\", \"Bard of Empire\", \"Rudyard Kipling (author)\"]" ]
[ "... Anise, used for aniseed flavouring typically in Asian cooking?", "Who rode from Boston to Lexington to warn US forces of a British Approach?", "If you ordered “cuisses de grenouilles” in a French restaurant, what would you be getting?", "What is the name for a line on a map connecting places of equal rainfall?", "King Ludwig II of Bavaria was the patron of which German composer ?", "In 2007, Forrest Whittaker won the 'Oscar' for Best Actor for his role in which film?", "Which heritage railway featured on the original film of The Railway Children?", "Shakespeare's romantic tragedy written c1598 is called 'Much Ado about (What?)'?", "July 12, 1862 saw the creation of what decoration, the highest military medal able to be awarded?", "Which Scottish football club is nicknamed The Arabs?", "\"To which interviewer did Richard Nixon say, \"\"I never cry except in public?\"", "What was the name of the human powered aircraft which crossed the Channel in 1979?", "The Flying Wallendas were a circus act and daredevil stunt performers with Barnum & Bailey for 40 years, and Karl Wallenda was known for high wire performances. From which country did they originate.", "The Crystal Palace was re-erected on which hill in South London after the Great Exhibition of 1851?", "Who wrote 'The Jungle Book'?" ]
15
[ 49560, 49561, 49562, 49563, 49564, 49565, 49566, 49567, 49568, 49569, 49570, 49571, 49572, 49573, 49574 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: The Chinese Year commencing in February 2016 is the year of which creature?\nQuestion 2: In October 2009 it was reported that what were being burnt as fuel at a 'bioenergy' plant in Karlskoga, in the central Sweden to provide heat for the Vrmland region?\nQuestion 3: Who is the presenter of TV programme Dragons Den?\nQuestion 4: Which country occupies the islands called Euboea, Kefalonia, Khos, Zakynthos, Thassos, Lefkada, Karpathos and Kythira?\nQuestion 5: O'Hare International Airport serves which city?\nQuestion 6: In the 1940 film Fantasia, who was the Sorcerer's Apprentice?\nQuestion 7: The TV documentary “Death of a Princess” caused a diplomatic rift between Britain and which other country?\nQuestion 8: Brooks's dyak, Keast's tube-nosed and Sulawesi naked-backed are fruit bats native to which country, an archipelago of thousands of islands?\nQuestion 9: In which country is 'Romansh' and official language?\nQuestion 10: Little boy and fat man were names for what?\nQuestion 11: In craps what is the first throw of the dice called\nQuestion 12: In which city did Rosa Parks refuse to obey a bus drivers order to give up her seat for a white passenger on December 1, 1955, becoming an important symbol of the modern Civil Rights Movement?\nQuestion 13: \"Which band put out a single in 1996 called \"\"Tonight Tonight\"\"?\"\nQuestion 14: In which sphere was John Phillip Holland a pioneer?\nQuestion 15: Zika disease, identified 1947 and epidemic in S America commencing 2015, is mainly transmitted by infected?", "role": "user" } ]
["[\"Monkey.\", \"Monkey (George Michael song)\", \"Monkey (song)\", \"MONKEY\"]", "[\"A Rabbit\", \"Bunny rabbit\", \"\\ud83d\\udc07\", \"Bunny wabbit\", \"Rabits\", \"Bunny\", \"Bunny Rabbit\", \"Rabit\", \"Bunny (animal)\", \"\\ud83d\\udc30\", \"Rabbit\", \"Cecal pellets\", \"Bunnies\", \"Bunnie rabbit\", \"Rabbitkind\", \"Smeerp\", \"Bunneh\", \"Bunnie\", \"Rabbits\", \"Bunnies!\", \"Bunny rabbits\", \"Rubbits\", \"Rabbitology\", \"Feral rabbits\", \"Rabbits and Hares\", \"Rabbit meat\", \"Wild rabbits\"]", "[\"Evan Davis\", \"Evan Davis (UK reporter)\", \"EVAN DAVIS\", \"Evan Harold Davis\", \"Evan Davis (UK broadcaster)\", \"Evan Davies (UK reporter)\", \"Evan Davis (journalist)\"]", "[\"Yunanistan\", \"Griekenland\", \"Hellenic republic\", \"Ell\\u00e1da\", \"Graecia\", \"The Hellenic Republic\", \"\\u0395\\u03bb\\u03bb\\u03ac\\u03c2\", \"El\\u00e1dha\", \"Yananistan\", \"Republic of Greece\", \"Elliniki Dimokrat\\u00eda\", \"Picki u dusa\", \"R\\u00e9publique hell\\u00e9nique\", \"Social issues in Greece\", \"Hellas\", \"Hellenic Republic\", \"Republique hellenique\", \"Eladha\", \"\\u0395\\u03bb\\u03bb\\u03ac\\u03b4\\u03b1\", \"Gr\\u00e8ce\", \"Elliniki Dimokratia\", \"Greece\", \"Temporary Government of National Defence\", \"Griechenland\", \"Grcija\", \"Ellada\", \"Hellada\", \"Greek Republic\", \"Grece\", \"\\u0395\\u03bb\\u03bb\\u03b7\\u03bd\\u03b9\\u03ba\\u03ae \\u0394\\u03b7\\u03bc\\u03bf\\u03ba\\u03c1\\u03b1\\u03c4\\u03af\\u03b1\", \"Grcka\", \"Political history of Greece\", \"Ell\\u012bnik\\u012b\\u0301 D\\u012bmokrat\\u00eda\", \"Macedonian Greece\", \"History of North Greece\", \"ISO 3166-1:GR\", \"Grecce\", \"El\\u00e1s\", \"Hell\\u00e1s\", \"\\u0395\\u03bb\\u03bb\\u03b1\\u03c2\", \"Greek law (Hellenic Republic)\"]", "[\"Chi-Beria\", \"Sayre language academy\", \"Chicago\", \"Chicago, Illinois\", \"Hog Butcher for the World\", \"Land of smelly onions\", \"Ariel Community Academy\", \"The weather in Chicago\", \"Chicago, Illinois, U.S.A.\", \"Chicago, Illionis\", \"Near North Montessori\", \"Religion in Chicago\", \"Chicago Finance Committee\", \"The Paris of America\", \"The city of Chicago\", \"City of Chicago\", \"List of sister cities of Chicago\", \"UN/LOCODE:USCHI\", \"Chicago theatre scene\", \"Chicago, WI\", \"The City of Broad Shoulders\", \"City of Broad Shoulders\", \"Sister Cities of Chicago\", \"Chicago il\", \"Chicago, Illinois, USA\", \"Performing arts in Chicago\", \"Chicago Transportation Committee\", \"Chicago, Wisconsin\", \"City of chicago\", \"Chicago theater scene\", \"Chicago, Il\", \"Chicago, IL.\", \"Chicago, Ill.\", \"City of Chicago, Illinois\", \"Chi town\", \"Chicago, United States\", \"Chicago (Ill.)\", \"Transport in Chicago\", \"Chicago, Illinois, United States\", \"Chicago (IL)\", \"USCHI\", \"Chichago\", \"Chcago\", \"Chicago, Illinois, U.S.\", \"Sister Cities Chicago\", \"Chicago, USA\", \"Chi City\", \"Chicago, IL\", \"Chi-Town\", \"Chicago theatre\", \"Paris of America\", \"Chicago, Illinois, US\", \"Chicago Illinois\", \"The city of Chicago, Illinois\", \"Sister cities of Chicago\"]", "[\"Mickey Mouse Operation\", \"Electoral career of Mickey Mouse\", \"Mickey Mouse operations\", \"Micky Mouse\", \"Mickey Mouse\", \"Mickey the mouse\", \"Miki mouse\", \"Mickey mouse\", \"Mickey Mouse operation\"]", "[\"Saudia Arabia\", \"Saudi arabia\", \"Saudi-Arabia\", \"Saudiarabia\", \"Etymology of Saudi Arabia\", \"Al-Arabiyah as Sa'udiyah\", \"Kingdom of Saudi Arabia\", \"KSA\", \"S. Arabia\", \"Saudi Arabian Kingdom\", \"Saudi Kingdom\", \"Saudi map\", \"K.S.A.\", \"Saudi Arabia\", \"Saudi Arab\", \"The Arabia of the Sauds\", \"The Kingdom of Saudi Arabia\", \"Arabia of the Sauds\", \"Saudi Arabian citizen\", \"Arabie Saoudite\", \"SAUDI ARABIA\", \"Languages of Saudi Arabia\", \"Saudi Arabaia\", \"\\u0627\\u0644\\u0645\\u0645\\u0644\\u0643\\u0629 \\u0627\\u0644\\u0639\\u0631\\u0628\\u064a\\u0629 \\u0627\\u0644\\u0633\\u0639\\u0648\\u062f\\u064a\\u0629\", \"\\u0627\\u0644\\u0633\\u0639\\u0648\\u062f\\u064a\\u0629\", \"Kingdom of Saudi-Arabia\", \"Saudi\", \"ISO 3166-1:SA\", \"Sauri Arabia\", \"Saudi Arabian\", \"Saoudi Arabia\", \"Third Saudi State\", \"Ksa\"]", "[\"Unitary state of republic of indonesia\", \"Indonesian Republic\", \"INDONESIA\", \"ISO 3166-1:ID\", \"The world's most populous Muslim nation\", \"Unitary State of Republic of Indonesia\", \"Indonezio\", \"Wildlife of Indonesia\", \"Indonnesia\", \"Indoneshia\", \"Etymology of Indonesia\", \"Republic of Indonesia\", \"Indonesia, Republic of\", \"Unitary State of the Republic of Indonesia\", \"Indonesia\", \"Indonesie\", \"Indonesian government\", \"Ecology of Indonesia\", \"Indnonesia\", \"Republic Of Indonesia\", \"Unitary state of the republic of indonesia\", \"Indonesian Empire\", \"Indon\\u00e9sie\", \"Indonisia\", \"Republik Indonesia\"]", "[\"ISO 3166-1:CH\", \"Svissland\", \"Etymology of Switzerland\", \"Confederation Helvetia\", \"Swizerland\", \"Confederatio Helvetica\", \"Environmental Integrity Group\", \"Confoederatio Helvetica\", \"Svizra\", \"SWITZERLAND\", \"Conf\\u00e9d\\u00e9ration suisse\", \"SwissEnergy\", \"Schweitz\", \"\\u0160v\\u00fdcarsko\", \"Die Schweiz\", \"Schwitzerland\", \"Confederation suisse\", \"Der Schweiz\", \"Swiss Confederated States\", \"Suiza\", \"Switz\", \"Switzeland\", \"Schweiz\", \"Confederation Helvetica\", \"Switserland\", \"Suisse\", \"Schweizerische Eidgenossenschaft\", \"Switzerland information\", \"Confederaziun Svizra\", \"Switzer land\", \"Switzerland\", \"Land of the Switzers\", \"Swiss confederation\", \"Conf\\u0153deratio Helvetica\", \"Swiss\", \"Confederation Suisse\", \"Confederation of Helvatia\", \"Land of the Swiss\", \"Confederaziun svizra\", \"Svizzera\", \"Swissland\", \"Swizterland\", \"Conf\\u00e9d\\u00e9ration Suisse\", \"Confederazione Svizzera\", \"Swiss Confederation\"]", "[\"Super nuke\", \"ATOMIC BOMBS\", \"Nuclear devices\", \"Genbaku\", \"Atombomb\", \"Atomic weapons\", \"A-Bombs\", \"A-bomb\", \"N-Bomb\", \"Nuclear Arms\", \"Neuclear bomb\", \"Gembaku\", \"Nuclear Weapons\", \"Nukes\", \"Nuclear bombing\", \"Atom bombs\", \"Nuclear Missle\", \"N Bomb\", \"A bomb\", \"Nuclear button\", \"Nuclear device\", \"Atom bomb\", \"Atomic weapon\", \"A-bombs\", \"Nuclear fission weapon\", \"Nuclear bombs\", \"Nuclear warhead\", \"Nbomb\", \"Nuclear weapons\", \"Nuclear Weapon\", \"Nuclear-weapon\", \"First nuclear fission bomb\", \"Nucular bombs\", \"Fusion Bomb\", \"Nuclear-warhead\", \"Nuclear weaponry\", \"Super Bomb\", \"Nucular weapon\", \"Atom Bomb\", \"The Atomic Bomb\", \"Nuclear Bomb\", \"Nuclear ordnance\", \"NBomb\", \"Atomic warhead\", \"Nuclear war weapon\", \"Fission bomb\", \"Nuclear weapon\", \"Atomic Bomb\", \"Atomic bombing\", \"Atomic bombs\", \"Nuclear Weaponry\", \"Nuclear-tipped missile\", \"Nukuler bomb\", \"Nuclear warheads\", \"Nuclear bomb\", \"Nuclear power weapon\", \"Superbomb\", \"Effects of a nuclear weapon\", \"Atomic bomb\", \"Nuclear arms\", \"Abomb\", \"A-Bomb\"]", "[\"Come Out (disambiguation)\", \"Come Out\", \"The come out\"]", "[\"UN/LOCODE:USMGM\", \"Montgomery, Ala\", \"Montgomery, Al\", \"Southern Convention\", \"Montgomery, Ala.\", \"Montgomery, AL\", \"Capital of Alabama\", \"Montgomery, Alabama\", \"Montgomery (AL)\", \"Cradle of the Confederacy\", \"Downtown Montgomery, Alabama\", \"Montgomery Alabama\", \"Montgomery (Alabama)\"]", "[\"Smashing Pumpkins\", \"The Smashing Pumpkins Grammys\", \"The Smashing Pumpkins\", \"Smashing Pumpkin\", \"Thesmashingpumpkins\", \"Spirits in the Sky\", \"Day for Night (The Smashing Pumpkins album)\", \"Backwards Clock Society\", \"Smashing Pumpkins, The\", \"Live Smashing Pumpkins\", \"The Samshing Pumpkins\", \"The smashing pumkins\", \"Smashing pumpkins\", \"Day for Night (Smashing Pumpkins album)\", \"The smashing pumpkins\", \"Bernadette O'Brien\", \"Billy Corgan and the Spirits in the Sky\", \"Smashing Pumpkins (band)\"]", "[\"Underwater vehicles\", \"Diesel submarine\", \"Submariners\", \"SUBMARINES\", \"Diesel-electric submarine\", \"Submarines in world war 2\", \"Patrol submarine\", \"Pig boat\", \"Submarine\", \"Submarines in World War II\", \"Military submarine\", \"Diesel submarines\", \"Fast-attack submarine\", \"Underwater boat\", \"Submarines\", \"Fast attack Submarine\"]", "[\"Dusk biter\", \"Mosquito bite\", \"Misquitos\", \"Nipper (insect)\", \"Mosquitos\", \"Macchar\", \"Mosquitoes\", \"Wriggler (mosquito larva)\", \"Mosquito bites\", \"Mozze\", \"Mosquito\", \"Culicidae\", \"Mosquitoe\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Monkey.\", \"Monkey (George Michael song)\", \"Monkey (song)\", \"MONKEY\"]", "[\"A Rabbit\", \"Bunny rabbit\", \"\\ud83d\\udc07\", \"Bunny wabbit\", \"Rabits\", \"Bunny\", \"Bunny Rabbit\", \"Rabit\", \"Bunny (animal)\", \"\\ud83d\\udc30\", \"Rabbit\", \"Cecal pellets\", \"Bunnies\", \"Bunnie rabbit\", \"Rabbitkind\", \"Smeerp\", \"Bunneh\", \"Bunnie\", \"Rabbits\", \"Bunnies!\", \"Bunny rabbits\", \"Rubbits\", \"Rabbitology\", \"Feral rabbits\", \"Rabbits and Hares\", \"Rabbit meat\", \"Wild rabbits\"]", "[\"Evan Davis\", \"Evan Davis (UK reporter)\", \"EVAN DAVIS\", \"Evan Harold Davis\", \"Evan Davis (UK broadcaster)\", \"Evan Davies (UK reporter)\", \"Evan Davis (journalist)\"]", "[\"Yunanistan\", \"Griekenland\", \"Hellenic republic\", \"Ell\\u00e1da\", \"Graecia\", \"The Hellenic Republic\", \"\\u0395\\u03bb\\u03bb\\u03ac\\u03c2\", \"El\\u00e1dha\", \"Yananistan\", \"Republic of Greece\", \"Elliniki Dimokrat\\u00eda\", \"Picki u dusa\", \"R\\u00e9publique hell\\u00e9nique\", \"Social issues in Greece\", \"Hellas\", \"Hellenic Republic\", \"Republique hellenique\", \"Eladha\", \"\\u0395\\u03bb\\u03bb\\u03ac\\u03b4\\u03b1\", \"Gr\\u00e8ce\", \"Elliniki Dimokratia\", \"Greece\", \"Temporary Government of National Defence\", \"Griechenland\", \"Grcija\", \"Ellada\", \"Hellada\", \"Greek Republic\", \"Grece\", \"\\u0395\\u03bb\\u03bb\\u03b7\\u03bd\\u03b9\\u03ba\\u03ae \\u0394\\u03b7\\u03bc\\u03bf\\u03ba\\u03c1\\u03b1\\u03c4\\u03af\\u03b1\", \"Grcka\", \"Political history of Greece\", \"Ell\\u012bnik\\u012b\\u0301 D\\u012bmokrat\\u00eda\", \"Macedonian Greece\", \"History of North Greece\", \"ISO 3166-1:GR\", \"Grecce\", \"El\\u00e1s\", \"Hell\\u00e1s\", \"\\u0395\\u03bb\\u03bb\\u03b1\\u03c2\", \"Greek law (Hellenic Republic)\"]", "[\"Chi-Beria\", \"Sayre language academy\", \"Chicago\", \"Chicago, Illinois\", \"Hog Butcher for the World\", \"Land of smelly onions\", \"Ariel Community Academy\", \"The weather in Chicago\", \"Chicago, Illinois, U.S.A.\", \"Chicago, Illionis\", \"Near North Montessori\", \"Religion in Chicago\", \"Chicago Finance Committee\", \"The Paris of America\", \"The city of Chicago\", \"City of Chicago\", \"List of sister cities of Chicago\", \"UN/LOCODE:USCHI\", \"Chicago theatre scene\", \"Chicago, WI\", \"The City of Broad Shoulders\", \"City of Broad Shoulders\", \"Sister Cities of Chicago\", \"Chicago il\", \"Chicago, Illinois, USA\", \"Performing arts in Chicago\", \"Chicago Transportation Committee\", \"Chicago, Wisconsin\", \"City of chicago\", \"Chicago theater scene\", \"Chicago, Il\", \"Chicago, IL.\", \"Chicago, Ill.\", \"City of Chicago, Illinois\", \"Chi town\", \"Chicago, United States\", \"Chicago (Ill.)\", \"Transport in Chicago\", \"Chicago, Illinois, United States\", \"Chicago (IL)\", \"USCHI\", \"Chichago\", \"Chcago\", \"Chicago, Illinois, U.S.\", \"Sister Cities Chicago\", \"Chicago, USA\", \"Chi City\", \"Chicago, IL\", \"Chi-Town\", \"Chicago theatre\", \"Paris of America\", \"Chicago, Illinois, US\", \"Chicago Illinois\", \"The city of Chicago, Illinois\", \"Sister cities of Chicago\"]", "[\"Mickey Mouse Operation\", \"Electoral career of Mickey Mouse\", \"Mickey Mouse operations\", \"Micky Mouse\", \"Mickey Mouse\", \"Mickey the mouse\", \"Miki mouse\", \"Mickey mouse\", \"Mickey Mouse operation\"]", "[\"Saudia Arabia\", \"Saudi arabia\", \"Saudi-Arabia\", \"Saudiarabia\", \"Etymology of Saudi Arabia\", \"Al-Arabiyah as Sa'udiyah\", \"Kingdom of Saudi Arabia\", \"KSA\", \"S. Arabia\", \"Saudi Arabian Kingdom\", \"Saudi Kingdom\", \"Saudi map\", \"K.S.A.\", \"Saudi Arabia\", \"Saudi Arab\", \"The Arabia of the Sauds\", \"The Kingdom of Saudi Arabia\", \"Arabia of the Sauds\", \"Saudi Arabian citizen\", \"Arabie Saoudite\", \"SAUDI ARABIA\", \"Languages of Saudi Arabia\", \"Saudi Arabaia\", \"\\u0627\\u0644\\u0645\\u0645\\u0644\\u0643\\u0629 \\u0627\\u0644\\u0639\\u0631\\u0628\\u064a\\u0629 \\u0627\\u0644\\u0633\\u0639\\u0648\\u062f\\u064a\\u0629\", \"\\u0627\\u0644\\u0633\\u0639\\u0648\\u062f\\u064a\\u0629\", \"Kingdom of Saudi-Arabia\", \"Saudi\", \"ISO 3166-1:SA\", \"Sauri Arabia\", \"Saudi Arabian\", \"Saoudi Arabia\", \"Third Saudi State\", \"Ksa\"]", "[\"Unitary state of republic of indonesia\", \"Indonesian Republic\", \"INDONESIA\", \"ISO 3166-1:ID\", \"The world's most populous Muslim nation\", \"Unitary State of Republic of Indonesia\", \"Indonezio\", \"Wildlife of Indonesia\", \"Indonnesia\", \"Indoneshia\", \"Etymology of Indonesia\", \"Republic of Indonesia\", \"Indonesia, Republic of\", \"Unitary State of the Republic of Indonesia\", \"Indonesia\", \"Indonesie\", \"Indonesian government\", \"Ecology of Indonesia\", \"Indnonesia\", \"Republic Of Indonesia\", \"Unitary state of the republic of indonesia\", \"Indonesian Empire\", \"Indon\\u00e9sie\", \"Indonisia\", \"Republik Indonesia\"]", "[\"ISO 3166-1:CH\", \"Svissland\", \"Etymology of Switzerland\", \"Confederation Helvetia\", \"Swizerland\", \"Confederatio Helvetica\", \"Environmental Integrity Group\", \"Confoederatio Helvetica\", \"Svizra\", \"SWITZERLAND\", \"Conf\\u00e9d\\u00e9ration suisse\", \"SwissEnergy\", \"Schweitz\", \"\\u0160v\\u00fdcarsko\", \"Die Schweiz\", \"Schwitzerland\", \"Confederation suisse\", \"Der Schweiz\", \"Swiss Confederated States\", \"Suiza\", \"Switz\", \"Switzeland\", \"Schweiz\", \"Confederation Helvetica\", \"Switserland\", \"Suisse\", \"Schweizerische Eidgenossenschaft\", \"Switzerland information\", \"Confederaziun Svizra\", \"Switzer land\", \"Switzerland\", \"Land of the Switzers\", \"Swiss confederation\", \"Conf\\u0153deratio Helvetica\", \"Swiss\", \"Confederation Suisse\", \"Confederation of Helvatia\", \"Land of the Swiss\", \"Confederaziun svizra\", \"Svizzera\", \"Swissland\", \"Swizterland\", \"Conf\\u00e9d\\u00e9ration Suisse\", \"Confederazione Svizzera\", \"Swiss Confederation\"]", "[\"Super nuke\", \"ATOMIC BOMBS\", \"Nuclear devices\", \"Genbaku\", \"Atombomb\", \"Atomic weapons\", \"A-Bombs\", \"A-bomb\", \"N-Bomb\", \"Nuclear Arms\", \"Neuclear bomb\", \"Gembaku\", \"Nuclear Weapons\", \"Nukes\", \"Nuclear bombing\", \"Atom bombs\", \"Nuclear Missle\", \"N Bomb\", \"A bomb\", \"Nuclear button\", \"Nuclear device\", \"Atom bomb\", \"Atomic weapon\", \"A-bombs\", \"Nuclear fission weapon\", \"Nuclear bombs\", \"Nuclear warhead\", \"Nbomb\", \"Nuclear weapons\", \"Nuclear Weapon\", \"Nuclear-weapon\", \"First nuclear fission bomb\", \"Nucular bombs\", \"Fusion Bomb\", \"Nuclear-warhead\", \"Nuclear weaponry\", \"Super Bomb\", \"Nucular weapon\", \"Atom Bomb\", \"The Atomic Bomb\", \"Nuclear Bomb\", \"Nuclear ordnance\", \"NBomb\", \"Atomic warhead\", \"Nuclear war weapon\", \"Fission bomb\", \"Nuclear weapon\", \"Atomic Bomb\", \"Atomic bombing\", \"Atomic bombs\", \"Nuclear Weaponry\", \"Nuclear-tipped missile\", \"Nukuler bomb\", \"Nuclear warheads\", \"Nuclear bomb\", \"Nuclear power weapon\", \"Superbomb\", \"Effects of a nuclear weapon\", \"Atomic bomb\", \"Nuclear arms\", \"Abomb\", \"A-Bomb\"]", "[\"Come Out (disambiguation)\", \"Come Out\", \"The come out\"]", "[\"UN/LOCODE:USMGM\", \"Montgomery, Ala\", \"Montgomery, Al\", \"Southern Convention\", \"Montgomery, Ala.\", \"Montgomery, AL\", \"Capital of Alabama\", \"Montgomery, Alabama\", \"Montgomery (AL)\", \"Cradle of the Confederacy\", \"Downtown Montgomery, Alabama\", \"Montgomery Alabama\", \"Montgomery (Alabama)\"]", "[\"Smashing Pumpkins\", \"The Smashing Pumpkins Grammys\", \"The Smashing Pumpkins\", \"Smashing Pumpkin\", \"Thesmashingpumpkins\", \"Spirits in the Sky\", \"Day for Night (The Smashing Pumpkins album)\", \"Backwards Clock Society\", \"Smashing Pumpkins, The\", \"Live Smashing Pumpkins\", \"The Samshing Pumpkins\", \"The smashing pumkins\", \"Smashing pumpkins\", \"Day for Night (Smashing Pumpkins album)\", \"The smashing pumpkins\", \"Bernadette O'Brien\", \"Billy Corgan and the Spirits in the Sky\", \"Smashing Pumpkins (band)\"]", "[\"Underwater vehicles\", \"Diesel submarine\", \"Submariners\", \"SUBMARINES\", \"Diesel-electric submarine\", \"Submarines in world war 2\", \"Patrol submarine\", \"Pig boat\", \"Submarine\", \"Submarines in World War II\", \"Military submarine\", \"Diesel submarines\", \"Fast-attack submarine\", \"Underwater boat\", \"Submarines\", \"Fast attack Submarine\"]", "[\"Dusk biter\", \"Mosquito bite\", \"Misquitos\", \"Nipper (insect)\", \"Mosquitos\", \"Macchar\", \"Mosquitoes\", \"Wriggler (mosquito larva)\", \"Mosquito bites\", \"Mozze\", \"Mosquito\", \"Culicidae\", \"Mosquitoe\"]" ]
[ "The Chinese Year commencing in February 2016 is the year of which creature?", "In October 2009 it was reported that what were being burnt as fuel at a 'bioenergy' plant in Karlskoga, in the central Sweden to provide heat for the Vrmland region?", "Who is the presenter of TV programme Dragons Den?", "Which country occupies the islands called Euboea, Kefalonia, Khos, Zakynthos, Thassos, Lefkada, Karpathos and Kythira?", "O'Hare International Airport serves which city?", "In the 1940 film Fantasia, who was the Sorcerer's Apprentice?", "The TV documentary “Death of a Princess” caused a diplomatic rift between Britain and which other country?", "Brooks's dyak, Keast's tube-nosed and Sulawesi naked-backed are fruit bats native to which country, an archipelago of thousands of islands?", "In which country is 'Romansh' and official language?", "Little boy and fat man were names for what?", "In craps what is the first throw of the dice called", "In which city did Rosa Parks refuse to obey a bus drivers order to give up her seat for a white passenger on December 1, 1955, becoming an important symbol of the modern Civil Rights Movement?", "\"Which band put out a single in 1996 called \"\"Tonight Tonight\"\"?\"", "In which sphere was John Phillip Holland a pioneer?", "Zika disease, identified 1947 and epidemic in S America commencing 2015, is mainly transmitted by infected?" ]
15
[ 33975, 33976, 33977, 33978, 33979, 33980, 33981, 33982, 33983, 33984, 33985, 33986, 33987, 33988, 33989 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which American President used the slogan 'It's Morning Again In America' for his 1984 Presidential campaign?\nQuestion 2: Naypyidaw is the capital of which Asian country?\nQuestion 3: Which is the third most populous city in Wales after Cardiff and Swansea?\nQuestion 4: What sort of machine was invented in 1879 by the American James Ritty?\nQuestion 5: In which Shakespeare play does Dogberry appear?\nQuestion 6: Jacob Black, Edward Cullen, and Bella Swan are characters in what fictional book series?\nQuestion 7: What unit of currency does the country of Switzerland use?\nQuestion 8: What famed daredevil, who failed in a 1974 motorcycle jump, is listed in the Guinness Book of World Records as the survivor of \"most bones broken in a lifetime\"?\nQuestion 9: \"\"\"Nobody puts Baby in a corner\"\" is a famous line from which 1987 US film?\"\nQuestion 10: Kenneth Cobonpue from the Philippines is world famous in what?\nQuestion 11: Which author created the fictional detective C Auguste Dupin?\nQuestion 12: Pozole is a soup or stew which originated in which country?\nQuestion 13: Rafflesia Arnoldii, the world’s largest flower, is better known by what name?\nQuestion 14: How many gears do the motorcycles used in speedway have?\nQuestion 15: Which tree is sometimes known as the false plane?", "role": "user" } ]
["[\"President Regan\", \"Ronald Reagan's Alzheimer's letter\", \"Ronald W Reagan\", \"40th President of the United States\", \"Reagan\", \"Reaganian\", \"Ronald Reagon\", \"Reagen\", \"Ronnie Reagan\", \"Public image of Ronald Reagan\", \"Ronald Reagan presidential campaign, 1976\", \"Ronald Reagan\", \"Reagan, Ronald\", \"Reagan, Ronald Wilson\", \"President Reagan\", \"RONALD REAGAN\", \"Reagan (president)\", \"Health of Ronald Reagan\", \"President Ronald Reagan\", \"Ronald Reagan Centennial Commission Act\", \"Ronald reagan\", \"Reaganesque\", \"Reaganite\", \"Ronald Raegen\", \"Ronald regean\", \"Ronald Wilson Reagan\", \"Ronald Regan\", \"Ronald Reagan Centennial Commission\", \"Dutch Reagan\", \"Ronaldus Magnus\", \"Ronald Reagen\", \"Cultural and political image of Ronald Reagan\", \"Ronal Reagan\", \"Reagan Ronald\", \"Ronald Raegan\", \"Ronald W. Reagan\"]", "[\"Economic sanctions against Myanmar\", \"Economic sanctions against Burma\", \"ISO 3166-1:MM\", \"Birman Empire\", \"Etymology of Burma\", \"Republic of The Union of Myanmar\", \"Pyidaunzu Thanm\\u0103da My\\u0103ma Nainngandaw\", \"Mianmar\", \"Borders of Burma\", \"Myanmar (Burma)\", \"Mayanmar\", \"\\u1019\\u103c\\u1014\\u103a\\u1019\\u102c\\u1015\\u103c\\u100a\\u103a\", \"Pyi-daung-zu Myan-ma Naing-ngan-daw\", \"Myammar\", \"Burma/Myanmar\", \"Burmese Republic\", \"Burma-Myanmar\", \"Burma (Myanmar)\", \"Union of Myanmar\", \"\\u1015\\u103c\\u100a\\u103a\\u1011\\u1031\\u102c\\u1004\\u103a\\u1005\\u102f \\u101e\\u1019\\u1039\\u1019\\u1010 \\u1019\\u103c\\u1014\\u103a\\u1019\\u102c\\u1014\\u102d\\u102f\\u1004\\u103a\\u1004\\u1036\\u1010\\u1031\\u102c\\u103a\", \"Sanctions against Burma\", \"Myanmar (formerly Burma)\", \"Birma\", \"\\u1015\\u103c\\u100a\\u103a\\u1011\\u1031\\u102c\\u1004\\u103a\\u1005\\u102f \\u101e\\u1019\\u1039\\u1019\\u1010 \\u1019\\u103c\\u1014\\u103a\\u1019\\u102c\\u1014\\u102d\\u102f\\u1004\\u103a\\u1004\\u1036\\u1010\\u1031\\u102c\", \"Birmanie\", \"Myanmar/(Burma)\", \"Burma\", \"Myanmar/Burma\", \"Myanmar\", \"Myanmer\", \"Socialist Republic of the Union of Burma\", \"Republic of the Union of Myanmar\", \"Eastern Burma\", \"Union of burma\", \"Myanma\", \"Birmania\"]", "[\"Newport (disambiguation)\", \"Newport, England\", \"New Port (disambiguation)\", \"Newport, United Kingdom\", \"New Port\", \"Newport, England (disambiguation)\", \"Newport\", \"Newport (England)\", \"Newport (UK Parliament constituency)\", \"Newport, Wales (disambiguation)\"]", "[\"Cash registers\", \"Till (cash)\", \"Cash Drawer\", \"Till (commerce)\", \"Cash drawer\", \"Electronic Cash Register\", \"Electronic cash register\", \"Cash Register\", \"Cash register\", \"Cash drawers\"]", "[\"Governor Leonato\", \"Borachio\", \"Much Ado About Nothing (title)\", \"Much Ado about Nothing\", \"MAAN\", \"Much Ado About Nothing\", \"Bendick and Beatrice\", \"Benedick\", \"Much ado about nothing\", \"Much adoe about nothing\", \"Much Adoe About Nothing\", \"Conrade\"]", "[\"EENT\", \"Evening Civil Twilight\", \"Astronomical twilight\", \"Twiligh\", \"Beginning morning nautical twilight\", \"EECT\", \"BMNT\", \"Nautical twilight\", \"End of evening nautical twilight\", \"End of evening civil twilight\", \"BMCT\", \"Twighlight\", \"Twillight\", \"Twilight\", \"Civil twilight\", \"Twilight glow\"]", "[\"Frank\", \"Frank (album)\", \"The Frank\", \"FRANK\", \"F R A N K\", \"Frank (disambiguation)\"]", "[\"Evel Kneavel\", \"Evel Knievel\", \"Evil Knievel\", \"Evel Knieval\", \"Kneevel\", \"Evel kinevil\", \"Evil Kneival\", \"Evil Knivel\", \"Evel knievel\", \"Evil Kneivel\", \"Kneivel\", \"Eval Kineval\", \"Evel Kneival\", \"Evel Knievil\", \"Evil kinevil\", \"Robert Craig Knievel\", \"Evel Kneavle\", \"Eval Knieval\", \"Eval Kneavel\", \"Eval kaneval\", \"Evel Kneivel\", \"Evil Kneaval\", \"Evel Knevel\"]", "[\"Jimmy Castle\", \"Dirty Dancing (1987 film)\", \"Dirty dancing\", \"Dirty Dancing (2014 film)\", \"Dirty Dancing (film)\", \"Dirty Dancing (2013 film)\", \"Dirty Dancing\"]", "[\"Furniture industry\", \"Oak furniture\", \"Office furniture\", \"Bedroom set (group)\", \"Furniture design\", \"Home furnishing\", \"Furniture Industry\", \"Home furnishings\", \"Furniture Design\", \"Forniture\", \"Home Furnishings\", \"Household Furniture\", \"Furniture\"]", "[\"Edgar alen poe\", \"Edgar Allan Poe\", \"Ea poe\", \"Edgar allen poe\", \"Edgar Allen Poe\", \"The Life of Edgar Allan Poe\", \"Poean\", \"Poe, Edgar Allen\", \"Edgar A. Poe\", \"Edgar Allan Poe and the Stories He Has Written\", \"Edgar Allan Poe's literary influence\", \"Edger Allen Poe\", \"Edgar allan poe\", \"E.A. Poe\", \"Literary influence of Edgar Allan Poe\", \"A Bostonian\", \"E A Poe\", \"EDGAR ALLEN POE\", \"Poesque\", \"Henri Le Rennet\", \"Eddy is no more\", \"E. A. Poe\", \"EA Poe\", \"Edgar Alan Poe\", \"Edgar Allan Po\", \"Poe\", \"Edgar Allan Poe's Tales of Mystery and Terror\"]", "[\"Mexican Republic\", \"MEXICO\", \"Estados Unidos de M\\u00e9xico\", \"Sierra de la Estrella\", \"Mexico (country)\", \"Mexic\\u00f3\", \"The United Mexican States\", \"Estados Unidos de Mexico\", \"Central Mexico\", \"ISO 3166-1:MX\", \"Mexiko\", \"M\\u00e9jico\", \"Mexique\", \"Mexican United States\", \"Mexican'\", \"The United State of Mexico\", \"Mountains of Mexico\", \"Old Mexico\", \"United states of mexico\", \"EUM\", \"Messico\", \"Mejico\", \"The United States of Mexicans\", \"Untied Mexican States\", \"M\\u00e9xico\", \"Etymology of Mexico\", \"Meixcan\", \"Estados Unidos Mexicanos\", \"Mexic\", \"Mexxico\", \"Mexican Union\", \"The United States of Mexico\", \"United State of Mexico\", \"Mexico\", \"Republic of Mexico\", \"Mexican Federal Republic\", \"United Mexican States\", \"Mexican coast\", \"Mehico\", \"United States of Mexicans\", \"United States of Mexico\"]", "[\"Corpse flower\", \"Corpse flower (disambiguation)\", \"Corpse Flower\", \"Giant corpse flower\"]", "[\"1\", \"one\", \"One\"]", "[\"Sycamore\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"President Regan\", \"Ronald Reagan's Alzheimer's letter\", \"Ronald W Reagan\", \"40th President of the United States\", \"Reagan\", \"Reaganian\", \"Ronald Reagon\", \"Reagen\", \"Ronnie Reagan\", \"Public image of Ronald Reagan\", \"Ronald Reagan presidential campaign, 1976\", \"Ronald Reagan\", \"Reagan, Ronald\", \"Reagan, Ronald Wilson\", \"President Reagan\", \"RONALD REAGAN\", \"Reagan (president)\", \"Health of Ronald Reagan\", \"President Ronald Reagan\", \"Ronald Reagan Centennial Commission Act\", \"Ronald reagan\", \"Reaganesque\", \"Reaganite\", \"Ronald Raegen\", \"Ronald regean\", \"Ronald Wilson Reagan\", \"Ronald Regan\", \"Ronald Reagan Centennial Commission\", \"Dutch Reagan\", \"Ronaldus Magnus\", \"Ronald Reagen\", \"Cultural and political image of Ronald Reagan\", \"Ronal Reagan\", \"Reagan Ronald\", \"Ronald Raegan\", \"Ronald W. Reagan\"]", "[\"Economic sanctions against Myanmar\", \"Economic sanctions against Burma\", \"ISO 3166-1:MM\", \"Birman Empire\", \"Etymology of Burma\", \"Republic of The Union of Myanmar\", \"Pyidaunzu Thanm\\u0103da My\\u0103ma Nainngandaw\", \"Mianmar\", \"Borders of Burma\", \"Myanmar (Burma)\", \"Mayanmar\", \"\\u1019\\u103c\\u1014\\u103a\\u1019\\u102c\\u1015\\u103c\\u100a\\u103a\", \"Pyi-daung-zu Myan-ma Naing-ngan-daw\", \"Myammar\", \"Burma/Myanmar\", \"Burmese Republic\", \"Burma-Myanmar\", \"Burma (Myanmar)\", \"Union of Myanmar\", \"\\u1015\\u103c\\u100a\\u103a\\u1011\\u1031\\u102c\\u1004\\u103a\\u1005\\u102f \\u101e\\u1019\\u1039\\u1019\\u1010 \\u1019\\u103c\\u1014\\u103a\\u1019\\u102c\\u1014\\u102d\\u102f\\u1004\\u103a\\u1004\\u1036\\u1010\\u1031\\u102c\\u103a\", \"Sanctions against Burma\", \"Myanmar (formerly Burma)\", \"Birma\", \"\\u1015\\u103c\\u100a\\u103a\\u1011\\u1031\\u102c\\u1004\\u103a\\u1005\\u102f \\u101e\\u1019\\u1039\\u1019\\u1010 \\u1019\\u103c\\u1014\\u103a\\u1019\\u102c\\u1014\\u102d\\u102f\\u1004\\u103a\\u1004\\u1036\\u1010\\u1031\\u102c\", \"Birmanie\", \"Myanmar/(Burma)\", \"Burma\", \"Myanmar/Burma\", \"Myanmar\", \"Myanmer\", \"Socialist Republic of the Union of Burma\", \"Republic of the Union of Myanmar\", \"Eastern Burma\", \"Union of burma\", \"Myanma\", \"Birmania\"]", "[\"Newport (disambiguation)\", \"Newport, England\", \"New Port (disambiguation)\", \"Newport, United Kingdom\", \"New Port\", \"Newport, England (disambiguation)\", \"Newport\", \"Newport (England)\", \"Newport (UK Parliament constituency)\", \"Newport, Wales (disambiguation)\"]", "[\"Cash registers\", \"Till (cash)\", \"Cash Drawer\", \"Till (commerce)\", \"Cash drawer\", \"Electronic Cash Register\", \"Electronic cash register\", \"Cash Register\", \"Cash register\", \"Cash drawers\"]", "[\"Governor Leonato\", \"Borachio\", \"Much Ado About Nothing (title)\", \"Much Ado about Nothing\", \"MAAN\", \"Much Ado About Nothing\", \"Bendick and Beatrice\", \"Benedick\", \"Much ado about nothing\", \"Much adoe about nothing\", \"Much Adoe About Nothing\", \"Conrade\"]", "[\"EENT\", \"Evening Civil Twilight\", \"Astronomical twilight\", \"Twiligh\", \"Beginning morning nautical twilight\", \"EECT\", \"BMNT\", \"Nautical twilight\", \"End of evening nautical twilight\", \"End of evening civil twilight\", \"BMCT\", \"Twighlight\", \"Twillight\", \"Twilight\", \"Civil twilight\", \"Twilight glow\"]", "[\"Frank\", \"Frank (album)\", \"The Frank\", \"FRANK\", \"F R A N K\", \"Frank (disambiguation)\"]", "[\"Evel Kneavel\", \"Evel Knievel\", \"Evil Knievel\", \"Evel Knieval\", \"Kneevel\", \"Evel kinevil\", \"Evil Kneival\", \"Evil Knivel\", \"Evel knievel\", \"Evil Kneivel\", \"Kneivel\", \"Eval Kineval\", \"Evel Kneival\", \"Evel Knievil\", \"Evil kinevil\", \"Robert Craig Knievel\", \"Evel Kneavle\", \"Eval Knieval\", \"Eval Kneavel\", \"Eval kaneval\", \"Evel Kneivel\", \"Evil Kneaval\", \"Evel Knevel\"]", "[\"Jimmy Castle\", \"Dirty Dancing (1987 film)\", \"Dirty dancing\", \"Dirty Dancing (2014 film)\", \"Dirty Dancing (film)\", \"Dirty Dancing (2013 film)\", \"Dirty Dancing\"]", "[\"Furniture industry\", \"Oak furniture\", \"Office furniture\", \"Bedroom set (group)\", \"Furniture design\", \"Home furnishing\", \"Furniture Industry\", \"Home furnishings\", \"Furniture Design\", \"Forniture\", \"Home Furnishings\", \"Household Furniture\", \"Furniture\"]", "[\"Edgar alen poe\", \"Edgar Allan Poe\", \"Ea poe\", \"Edgar allen poe\", \"Edgar Allen Poe\", \"The Life of Edgar Allan Poe\", \"Poean\", \"Poe, Edgar Allen\", \"Edgar A. Poe\", \"Edgar Allan Poe and the Stories He Has Written\", \"Edgar Allan Poe's literary influence\", \"Edger Allen Poe\", \"Edgar allan poe\", \"E.A. Poe\", \"Literary influence of Edgar Allan Poe\", \"A Bostonian\", \"E A Poe\", \"EDGAR ALLEN POE\", \"Poesque\", \"Henri Le Rennet\", \"Eddy is no more\", \"E. A. Poe\", \"EA Poe\", \"Edgar Alan Poe\", \"Edgar Allan Po\", \"Poe\", \"Edgar Allan Poe's Tales of Mystery and Terror\"]", "[\"Mexican Republic\", \"MEXICO\", \"Estados Unidos de M\\u00e9xico\", \"Sierra de la Estrella\", \"Mexico (country)\", \"Mexic\\u00f3\", \"The United Mexican States\", \"Estados Unidos de Mexico\", \"Central Mexico\", \"ISO 3166-1:MX\", \"Mexiko\", \"M\\u00e9jico\", \"Mexique\", \"Mexican United States\", \"Mexican'\", \"The United State of Mexico\", \"Mountains of Mexico\", \"Old Mexico\", \"United states of mexico\", \"EUM\", \"Messico\", \"Mejico\", \"The United States of Mexicans\", \"Untied Mexican States\", \"M\\u00e9xico\", \"Etymology of Mexico\", \"Meixcan\", \"Estados Unidos Mexicanos\", \"Mexic\", \"Mexxico\", \"Mexican Union\", \"The United States of Mexico\", \"United State of Mexico\", \"Mexico\", \"Republic of Mexico\", \"Mexican Federal Republic\", \"United Mexican States\", \"Mexican coast\", \"Mehico\", \"United States of Mexicans\", \"United States of Mexico\"]", "[\"Corpse flower\", \"Corpse flower (disambiguation)\", \"Corpse Flower\", \"Giant corpse flower\"]", "[\"1\", \"one\", \"One\"]", "[\"Sycamore\"]" ]
[ "Which American President used the slogan 'It's Morning Again In America' for his 1984 Presidential campaign?", "Naypyidaw is the capital of which Asian country?", "Which is the third most populous city in Wales after Cardiff and Swansea?", "What sort of machine was invented in 1879 by the American James Ritty?", "In which Shakespeare play does Dogberry appear?", "Jacob Black, Edward Cullen, and Bella Swan are characters in what fictional book series?", "What unit of currency does the country of Switzerland use?", "What famed daredevil, who failed in a 1974 motorcycle jump, is listed in the Guinness Book of World Records as the survivor of \"most bones broken in a lifetime\"?", "\"\"\"Nobody puts Baby in a corner\"\" is a famous line from which 1987 US film?\"", "Kenneth Cobonpue from the Philippines is world famous in what?", "Which author created the fictional detective C Auguste Dupin?", "Pozole is a soup or stew which originated in which country?", "Rafflesia Arnoldii, the world’s largest flower, is better known by what name?", "How many gears do the motorcycles used in speedway have?", "Which tree is sometimes known as the false plane?" ]
15
[ 57615, 57616, 57617, 57618, 57619, 57620, 57621, 57622, 57623, 57624, 57625, 57626, 57627, 57628, 57629 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: January 3, 1938 saw Franklin D. Roosevelt found the charity March of Dimes. What epidemic disease was it targeting?\nQuestion 2: Who was the Greek equivalent of the Roman god Vulcan?\nQuestion 3: Who is the English logician who devised an algebraic system that has since been adopted for the analysis of digital electronic circuitry?\nQuestion 4: \"When this great artist was once criticized for creating unrealistic art, he asked his accuser \"\"Can you show me some realistic art?\"\" The man showed him a photograph of his wife. The artist observed: \"\"So your wife is two inches tall, two-dimensional, with no arms and no legs, and no colour but only shades of gray?\"\" Who is this artist who went through a 'Blue Period' and a 'Rose Period'?\"\nQuestion 5: Which city will host the 2016 Olympic Games?\nQuestion 6: Who had a number one in 2000 with Black Coffee\nQuestion 7: The Iris has a thick-stemmed root instead of a bulb.By what name is this 'root' known?\nQuestion 8: Which is said to be the oldest book in the Bible?\nQuestion 9: Who was the first chemist to be Britain's Prime Minister?\nQuestion 10: Which ancient European period came before the Iron Age?\nQuestion 11: Which Avro delta wing bomber entered service in the RAF in 1956 and was retired in 1984?\nQuestion 12: Where did the biggest naval battle of the Second World War take place between the USA and Japan, from 24th to 26th October 1944?\nQuestion 13: Who wrote the major choral work 'All Night Vigil', better known as the 'Vespers' which was sung at his funeral in 1943?\nQuestion 14: A lazaretto which can be an isolated island or a ship at anchor near a harbor is used for what purpose for maritime travelers?\nQuestion 15: What sort of creature is a 'Blue Tongue'?", "role": "user" } ]
["[\"Acute poliomyelitis\", \"Abortive poliomyelitis\", \"Polio\", \"Heine-Medin's disease\", \"Poliomyelitis, bulbar\", \"Debility of the lower extremities\", \"Poliomyletis\", \"Acute anterior poliomyelitis\", \"Heine-Medin disease\", \"Bulbar poliomyelitis\", \"Infantile Paralysis\", \"Paralytic polio\", \"Poliomyelitiss\", \"Paralytic poliomyelitis\", \"Poliomyelitis\", \"Poliomyelitis, paralytic\", \"Bulbar polio\", \"Poliomylitis\", \"Infantile paralysis\"]", "[\"Heph\\u00e6stus\", \"Hephaistos\", \"Heph\\u00e6stos\", \"H\\u00eaphaistos\", \"HEPHAESTUS\", \"Hephaestus\", \"Hephaestos\", \"Haphaestos\", \"Hephestus\", \"Hephastus\", \"Haephestus\", \"Palaimonius\"]", "[\"Boole\", \"George Boole\", \"George boole\", \"George Bool\"]", "[\"Pablo Diego Jose Francisco de Paula Juan Nepomuceno Maria de los Remedios Cipriano de la Santisima Trinidad Clito Ruiz y Picasso\", \"Pablo Diego Jos\\u00e9 Francisco de Paula Juan Nepomuceno Crispin Crispiniano de la Santisima Trinidad Ruiz Blasco Picasso\", \"Pablo Diego Jos\\u00e9 Santiago Francisco de Paula Juan Nepomuceno Crisp\\u00edn Crispiniano de los Remedios Cipriano de la Sant\\u00edsima Trinidad Ruiz Picasso\", \"Pablo Diego Jose Santiago Francisco de Paula Juan Nepomuceno Crispin Crispiniano de los Remedios Cipriano de la Santisima Trinidad Ruiz Picasso\", \"Pablo picasso\", \"Pablo Piccaso\", \"Pablo Diego Jose Santiago Francisco de Paula Juan Nepomuceno Crispin Crispiniano de los Remedios Cipriano de la Santisima Trinidad Ruiz Blasco y Picasso\", \"Piccasso\", \"The Blue Period\", \"Pablo Ruiz Picasso\", \"Picassoan\", \"Picasso\", \"Pablo Diego Jos\\u00e9 Francisco de Paula Juan Nepomuceno Mar\\u00eda de los Remedios Crisp\\u00edn Crispiniano de la Sant\\u00edsima Trinidad Ruiz y Picasso\", \"Pablo Picasso\", \"Mar\\u00eda Picasso y L\\u00f3pez\", \"Picaso\", \"Pablo-Picasso\", \"Pablo Ruiz y Picasso\", \"Pablo Diego Jose Francisco de Paula Juan Nepomuceno Maria de los Remedios Crispin Crispiniano de la Santisima Trinidad Ruiz y Picasso\", \"Maria Picasso y Lopez\", \"Picassoid\", \"Pablo Diego Jose Francisco de Paula Juan Nepomuceno Maria de los Remedios Cipriano de la Santisima Trinidad Martyr Patricio Clito Ruiz y Picasso\", \"Paul Picasso\", \"Pablo Diego Jose Francisco de Paula Juan Nepomuceno de los Remedios Cipriano de la Santisma Trinidad Ruiz y Picasso\", \"Pablo Picaso\", \"Pablo Ru\\u00edz Picasso\", \"Pablo Ruiz Y Picasso\", \"Pablo Diego Jose Francisco de Paula Juan Nepomuceno Maria de los Remedios Cipriano de la Santisima Trinidad Ruiz y Picasso\", \"Pablo Diego Jos\\u00e9 Francisco de Paula Juan Nepomuceno Mar\\u00eda de los Remedios Cipriano de la Sant\\u00edsima Trinidad Clito\", \"Picassoesque\", \"Pablo Diego Jos\\u00e9 Francisco de Paula Juan Nepomuceno Mar\\u00eda de los Remedios Cipriano de la Sant\\u00edsima Trinidad Clito Ruiz y Picasso\", \"Pablo Diego Jos\\u00e9 Francisco de Paula Juan Nepomuceno Mar\\u00eda de los Remedios Cipriano de la Sant\\u00edsima Trinidad Martyr Patricio Clito Ruiz y Picasso\", \"Pablo Diego Jos\\u00e9 Santiago Francisco de Paula Juan Nepomuceno Crisp\\u00edn Crispiniano de los Remedios Cipriano de la Sant\\u00edsima Trinidad Ruiz Blasco y Picasso\", \"Bijiasuo\", \"Pablo Diego Jos\\u00e9 Francisco de Paula Juan Nepomuceno Mar\\u00eda de los Remedios Cipriano de la Sant\\u00edsima Trinidad Ruiz y Picasso\", \"Picassian\", \"Pablo Diego Jos\\u00e9 Francisco de Paula Juan Nepomuceno Mar\\u00eda de los Remedios Cipriano de la Sant\\u00edsima Trinidad Martyr Patricio Clito Ru\\u00edz y Picasso\"]", "[\"S\\u00e3o Sebasti\\u00e3o do Rio de Janeiro\", \"BRRIO\", \"Rio de Janiero\", \"UN/LOCODE:BRRIO\", \"R\\u00edo de Jeneiro\", \"Rio di Janeiro\", \"Rio de Janeiro (city)\", \"Rio, Brazil\", \"Rio de Janero\", \"Rio de Janeiro (Brazil)\", \"Rio Janeiro\", \"R\\u00edo de Janeiro, Brazil\", \"Rio de janeiro\", \"Rio de Janeiro city\", \"R\\u00edo de Janeiro\", \"R. Janeiro\", \"Rio-de-Janeiro\", \"Rio de janero\", \"R Janeiro\", \"Rio de Jainero\", \"River of January\", \"Rio de Janeiro\", \"Rio de Janeiro, Brazil\", \"Rio de Janerio\", \"Sao Sebastiao do Rio de Janeiro\", \"Rio de Janiero, Brazil\", \"Rio de Janeiro, RJ\", \"Rio De Janiero\", \"Rio de Janeiro City\", \"Rio De Janeiro\", \"Rio De Janeiro, Brazil\", \"The Marvelous City\", \"Rio de Janeiro, Rio de Janeiro\", \"Rio de janerio\", \"January River\"]", "[\"%60Id kull-il-Qiddisin\", \"All Saint's\", \"All Saints (disambiguation)\", \"All saints\", \"All saints (disambiguation)\", \"All Saints\", \"Allholland day\", \"All Saints (album)\"]", "[\"Rhizomatous\", \"Creeping rootstalks\", \"Rizome\", \"Botanical rhizome\", \"Rizhome\", \"Rootstalk\", \"Rhizomatic\", \"Rhizomes\", \"RHIZOME\", \"Rhizoma\", \"Rhizome\"]", "[\"Vacancy (economics)\", \"Job change\", \"Day job\", \"Job\", \"JOB\", \"Job (role)\", \"Demand for additional workers\", \"Dayjob\", \"Job opening\"]", "[\"Baroness Margaret Thatcher\", \"Lady Thatcher\", \"Margret thatcher\", \"The Baroness Thatcher\", \"Margret Thatcher\", \"The Lady Thatcher\", \"Margaret Tatcher\", \"Margaret Thatcher\", \"Mrs T\", \"Mrs Thatcher\", \"Margaret Hilda Thatcher, Baroness Thatcher\", \"Mrs. T\", \"Baroness Thatcher of Kesteven\", \"Margaret Thatcer\", \"Margaret Thatcher's\", \"Mrs Finchley\", \"Prime Minister Margaret Thatcher\", \"Thatcherian\", \"Margaret Thacher\", \"Margaret Thatcher bibliography\", \"Margaret Thatcher Day\", \"M thatcher\", \"Lady T\", \"Maggie Thatcher\", \"Margaret Hilda Thatcher\", \"Milk snatcher\", \"Baroness The Margaret Thatcher\", \"Margaret Thatcher, Baroness Thatcher\", \"Margaret Hilda Roberts Thatcher\", \"Margeret Thatcher\", \"Margareth Thatcher\", \"Mrs Denis Thatcher\", \"Margaret Hilda Roberts\", \"Mrs. Thatcher\", \"Milk Snatcher\", \"Margaret Thatcher Library\", \"Margaret thatcher\", \"Baroness Thatcher\", \"Margeret thatcher\"]", "[\"Bronze age\", \"Early bronze age\", \"Bronze Ages\", \"East Asian Bronze Age\", \"Early Bronze Age III\", \"Middle bronze age\", \"Early Bronze Age I\", \"Chinese Bronze Age\", \"Late Bronze Age\", \"Bronze Age in China\", \"Paul Reinecke\", \"Bronze-Age\", \"Late bronze age\", \"Early Bronze Age\", \"Bronze Age China\", \"Bronze-age\", \"Bronze Age\", \"Early Bronze Age II\", \"Early Bronze Age IV\", \"Bronze A1\", \"Middle Bronze Age I\", \"Middle Bronze Age\"]", "[\"The Vulcan\", \"Vulcan (disambiguation)\", \"Vulcan\"]", "[\"Leyte Gulf\", \"LEYTE GULF\"]", "[\"Sergei Vasilevich Rachmaninov\", \"Sergey Vasil'yevich Rakhmaninov\", \"Rahmaninov\", \"Sergey Rachmaninoff\", \"\\u0420\\u0430\\u0445\\u043c\\u0430\\u0301\\u043d\\u0438\\u043d\\u043e\\u0432\", \"Sergey Vasilyevich Rachmaninov\", \"Rachmanioff\", \"Serge Rachmaninoff\", \"Rachmaninov, Sergei\", \"Rakhmaninow\", \"Rakhmaninov\", \"Rachmoninoff\", \"Sergei Vasilievich Rachmaninoff\", \"Rachmaninov, Sergei Vasilievich\", \"Sergei Vassilyevich Rachmaninov\", \"\\u0421\\u0435\\u0440\\u0433\\u0435\\u0439 \\u0412\\u0430\\u0441\\u0438\\u043b\\u044c\\u0435\\u0432\\u0438\\u0447 \\u0420\\u0430\\u0445\\u043c\\u0430\\u043d\\u0438\\u043d\\u043e\\u0432\", \"Rachmoninof\", \"Rachmanninov\", \"Rachmaninoff, Sergei\", \"Youth of Sergei Rachmaninoff\", \"Trio Elegiaque\", \"Rachmoninov\", \"Rachmanninof\", \"Sergey Rachmaninov\", \"Sergei Rachmanioff\", \"Life of Sergei Rachmaninov\", \"Sergi Rachmaninov\", \"Sergue\\u00ef Rachmaninoff\", \"Sergey Rakhmaninov\", \"Sergey Vasil\\u2019yevich Rakhmaninov\", \"Rachmanianof\", \"Sergei Vasilyevich Rachmaninoff\", \"Sergei Rachmaninov\", \"Rachmaninoff\", \"\\u0421\\u0435\\u0440\\u0433\\u0435\\u0301\\u0439 \\u0412\\u0430\\u0441\\u0438\\u0301\\u043b\\u044c\\u0435\\u0432\\u0438\\u0447 \\u0420\\u0430\\u0445\\u043c\\u0430\\u0301\\u043d\\u0438\\u043d\\u043e\\u0432\", \"\\u0420\\u0430\\u0445\\u043c\\u0430\\u043d\\u0438\\u043d\\u043e\\u0432\", \"Rachmaninoff, Sergei Vasilievich\", \"\\u0421\\u0435\\u0440\\u0433\\u0435\\u0439 \\u0420\\u0430\\u0445\\u043c\\u0430\\u043d\\u0438\\u043d\\u043e\\u0432\", \"Sergei Rachmaninoff\", \"Life of Sergei Rachmaninoff\", \"Sergei Rahmaninov\", \"Rachmaninoff's\", \"Sergei Vasilyevich Rachmaninov\", \"Sergue\\u00ef Rachmaninov\", \"Rahmaninoff\", \"Sergei Wassilievitch Rachmaninoff\", \"Rachmaninof\", \"Sergej Rachmaninov\", \"Sergej Rachmaninow\", \"Rachmanianoff\", \"Rakhmaninoff\", \"Sergei Vasilievich Rachmaninov\", \"Sergey Vasilyevich Rachmaninoff\", \"Sergie Rachmaninoff\", \"Rachmaninow\", \"Rachmaninov\"]", "[\"Quarantine station\", \"Quarantine Act 1710\", \"Quarantine\", \"Quaranteen\", \"Quarantined\", \"Quarantining\", \"Quarentine\", \"Quarantine flag\"]", "[\"Lizard Peninsula\", \"Lizard, Cornwall\", \"The Lizard\", \"The Lizard (village)\", \"West Lizard SSSI\", \"East Lizard Heathlands\", \"LIZARD\", \"The Lizard Penninsula\", \"Winnianton\", \"Lizard peninsula\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Acute poliomyelitis\", \"Abortive poliomyelitis\", \"Polio\", \"Heine-Medin's disease\", \"Poliomyelitis, bulbar\", \"Debility of the lower extremities\", \"Poliomyletis\", \"Acute anterior poliomyelitis\", \"Heine-Medin disease\", \"Bulbar poliomyelitis\", \"Infantile Paralysis\", \"Paralytic polio\", \"Poliomyelitiss\", \"Paralytic poliomyelitis\", \"Poliomyelitis\", \"Poliomyelitis, paralytic\", \"Bulbar polio\", \"Poliomylitis\", \"Infantile paralysis\"]", "[\"Heph\\u00e6stus\", \"Hephaistos\", \"Heph\\u00e6stos\", \"H\\u00eaphaistos\", \"HEPHAESTUS\", \"Hephaestus\", \"Hephaestos\", \"Haphaestos\", \"Hephestus\", \"Hephastus\", \"Haephestus\", \"Palaimonius\"]", "[\"Boole\", \"George Boole\", \"George boole\", \"George Bool\"]", "[\"Pablo Diego Jose Francisco de Paula Juan Nepomuceno Maria de los Remedios Cipriano de la Santisima Trinidad Clito Ruiz y Picasso\", \"Pablo Diego Jos\\u00e9 Francisco de Paula Juan Nepomuceno Crispin Crispiniano de la Santisima Trinidad Ruiz Blasco Picasso\", \"Pablo Diego Jos\\u00e9 Santiago Francisco de Paula Juan Nepomuceno Crisp\\u00edn Crispiniano de los Remedios Cipriano de la Sant\\u00edsima Trinidad Ruiz Picasso\", \"Pablo Diego Jose Santiago Francisco de Paula Juan Nepomuceno Crispin Crispiniano de los Remedios Cipriano de la Santisima Trinidad Ruiz Picasso\", \"Pablo picasso\", \"Pablo Piccaso\", \"Pablo Diego Jose Santiago Francisco de Paula Juan Nepomuceno Crispin Crispiniano de los Remedios Cipriano de la Santisima Trinidad Ruiz Blasco y Picasso\", \"Piccasso\", \"The Blue Period\", \"Pablo Ruiz Picasso\", \"Picassoan\", \"Picasso\", \"Pablo Diego Jos\\u00e9 Francisco de Paula Juan Nepomuceno Mar\\u00eda de los Remedios Crisp\\u00edn Crispiniano de la Sant\\u00edsima Trinidad Ruiz y Picasso\", \"Pablo Picasso\", \"Mar\\u00eda Picasso y L\\u00f3pez\", \"Picaso\", \"Pablo-Picasso\", \"Pablo Ruiz y Picasso\", \"Pablo Diego Jose Francisco de Paula Juan Nepomuceno Maria de los Remedios Crispin Crispiniano de la Santisima Trinidad Ruiz y Picasso\", \"Maria Picasso y Lopez\", \"Picassoid\", \"Pablo Diego Jose Francisco de Paula Juan Nepomuceno Maria de los Remedios Cipriano de la Santisima Trinidad Martyr Patricio Clito Ruiz y Picasso\", \"Paul Picasso\", \"Pablo Diego Jose Francisco de Paula Juan Nepomuceno de los Remedios Cipriano de la Santisma Trinidad Ruiz y Picasso\", \"Pablo Picaso\", \"Pablo Ru\\u00edz Picasso\", \"Pablo Ruiz Y Picasso\", \"Pablo Diego Jose Francisco de Paula Juan Nepomuceno Maria de los Remedios Cipriano de la Santisima Trinidad Ruiz y Picasso\", \"Pablo Diego Jos\\u00e9 Francisco de Paula Juan Nepomuceno Mar\\u00eda de los Remedios Cipriano de la Sant\\u00edsima Trinidad Clito\", \"Picassoesque\", \"Pablo Diego Jos\\u00e9 Francisco de Paula Juan Nepomuceno Mar\\u00eda de los Remedios Cipriano de la Sant\\u00edsima Trinidad Clito Ruiz y Picasso\", \"Pablo Diego Jos\\u00e9 Francisco de Paula Juan Nepomuceno Mar\\u00eda de los Remedios Cipriano de la Sant\\u00edsima Trinidad Martyr Patricio Clito Ruiz y Picasso\", \"Pablo Diego Jos\\u00e9 Santiago Francisco de Paula Juan Nepomuceno Crisp\\u00edn Crispiniano de los Remedios Cipriano de la Sant\\u00edsima Trinidad Ruiz Blasco y Picasso\", \"Bijiasuo\", \"Pablo Diego Jos\\u00e9 Francisco de Paula Juan Nepomuceno Mar\\u00eda de los Remedios Cipriano de la Sant\\u00edsima Trinidad Ruiz y Picasso\", \"Picassian\", \"Pablo Diego Jos\\u00e9 Francisco de Paula Juan Nepomuceno Mar\\u00eda de los Remedios Cipriano de la Sant\\u00edsima Trinidad Martyr Patricio Clito Ru\\u00edz y Picasso\"]", "[\"S\\u00e3o Sebasti\\u00e3o do Rio de Janeiro\", \"BRRIO\", \"Rio de Janiero\", \"UN/LOCODE:BRRIO\", \"R\\u00edo de Jeneiro\", \"Rio di Janeiro\", \"Rio de Janeiro (city)\", \"Rio, Brazil\", \"Rio de Janero\", \"Rio de Janeiro (Brazil)\", \"Rio Janeiro\", \"R\\u00edo de Janeiro, Brazil\", \"Rio de janeiro\", \"Rio de Janeiro city\", \"R\\u00edo de Janeiro\", \"R. Janeiro\", \"Rio-de-Janeiro\", \"Rio de janero\", \"R Janeiro\", \"Rio de Jainero\", \"River of January\", \"Rio de Janeiro\", \"Rio de Janeiro, Brazil\", \"Rio de Janerio\", \"Sao Sebastiao do Rio de Janeiro\", \"Rio de Janiero, Brazil\", \"Rio de Janeiro, RJ\", \"Rio De Janiero\", \"Rio de Janeiro City\", \"Rio De Janeiro\", \"Rio De Janeiro, Brazil\", \"The Marvelous City\", \"Rio de Janeiro, Rio de Janeiro\", \"Rio de janerio\", \"January River\"]", "[\"%60Id kull-il-Qiddisin\", \"All Saint's\", \"All Saints (disambiguation)\", \"All saints\", \"All saints (disambiguation)\", \"All Saints\", \"Allholland day\", \"All Saints (album)\"]", "[\"Rhizomatous\", \"Creeping rootstalks\", \"Rizome\", \"Botanical rhizome\", \"Rizhome\", \"Rootstalk\", \"Rhizomatic\", \"Rhizomes\", \"RHIZOME\", \"Rhizoma\", \"Rhizome\"]", "[\"Vacancy (economics)\", \"Job change\", \"Day job\", \"Job\", \"JOB\", \"Job (role)\", \"Demand for additional workers\", \"Dayjob\", \"Job opening\"]", "[\"Baroness Margaret Thatcher\", \"Lady Thatcher\", \"Margret thatcher\", \"The Baroness Thatcher\", \"Margret Thatcher\", \"The Lady Thatcher\", \"Margaret Tatcher\", \"Margaret Thatcher\", \"Mrs T\", \"Mrs Thatcher\", \"Margaret Hilda Thatcher, Baroness Thatcher\", \"Mrs. T\", \"Baroness Thatcher of Kesteven\", \"Margaret Thatcer\", \"Margaret Thatcher's\", \"Mrs Finchley\", \"Prime Minister Margaret Thatcher\", \"Thatcherian\", \"Margaret Thacher\", \"Margaret Thatcher bibliography\", \"Margaret Thatcher Day\", \"M thatcher\", \"Lady T\", \"Maggie Thatcher\", \"Margaret Hilda Thatcher\", \"Milk snatcher\", \"Baroness The Margaret Thatcher\", \"Margaret Thatcher, Baroness Thatcher\", \"Margaret Hilda Roberts Thatcher\", \"Margeret Thatcher\", \"Margareth Thatcher\", \"Mrs Denis Thatcher\", \"Margaret Hilda Roberts\", \"Mrs. Thatcher\", \"Milk Snatcher\", \"Margaret Thatcher Library\", \"Margaret thatcher\", \"Baroness Thatcher\", \"Margeret thatcher\"]", "[\"Bronze age\", \"Early bronze age\", \"Bronze Ages\", \"East Asian Bronze Age\", \"Early Bronze Age III\", \"Middle bronze age\", \"Early Bronze Age I\", \"Chinese Bronze Age\", \"Late Bronze Age\", \"Bronze Age in China\", \"Paul Reinecke\", \"Bronze-Age\", \"Late bronze age\", \"Early Bronze Age\", \"Bronze Age China\", \"Bronze-age\", \"Bronze Age\", \"Early Bronze Age II\", \"Early Bronze Age IV\", \"Bronze A1\", \"Middle Bronze Age I\", \"Middle Bronze Age\"]", "[\"The Vulcan\", \"Vulcan (disambiguation)\", \"Vulcan\"]", "[\"Leyte Gulf\", \"LEYTE GULF\"]", "[\"Sergei Vasilevich Rachmaninov\", \"Sergey Vasil'yevich Rakhmaninov\", \"Rahmaninov\", \"Sergey Rachmaninoff\", \"\\u0420\\u0430\\u0445\\u043c\\u0430\\u0301\\u043d\\u0438\\u043d\\u043e\\u0432\", \"Sergey Vasilyevich Rachmaninov\", \"Rachmanioff\", \"Serge Rachmaninoff\", \"Rachmaninov, Sergei\", \"Rakhmaninow\", \"Rakhmaninov\", \"Rachmoninoff\", \"Sergei Vasilievich Rachmaninoff\", \"Rachmaninov, Sergei Vasilievich\", \"Sergei Vassilyevich Rachmaninov\", \"\\u0421\\u0435\\u0440\\u0433\\u0435\\u0439 \\u0412\\u0430\\u0441\\u0438\\u043b\\u044c\\u0435\\u0432\\u0438\\u0447 \\u0420\\u0430\\u0445\\u043c\\u0430\\u043d\\u0438\\u043d\\u043e\\u0432\", \"Rachmoninof\", \"Rachmanninov\", \"Rachmaninoff, Sergei\", \"Youth of Sergei Rachmaninoff\", \"Trio Elegiaque\", \"Rachmoninov\", \"Rachmanninof\", \"Sergey Rachmaninov\", \"Sergei Rachmanioff\", \"Life of Sergei Rachmaninov\", \"Sergi Rachmaninov\", \"Sergue\\u00ef Rachmaninoff\", \"Sergey Rakhmaninov\", \"Sergey Vasil\\u2019yevich Rakhmaninov\", \"Rachmanianof\", \"Sergei Vasilyevich Rachmaninoff\", \"Sergei Rachmaninov\", \"Rachmaninoff\", \"\\u0421\\u0435\\u0440\\u0433\\u0435\\u0301\\u0439 \\u0412\\u0430\\u0441\\u0438\\u0301\\u043b\\u044c\\u0435\\u0432\\u0438\\u0447 \\u0420\\u0430\\u0445\\u043c\\u0430\\u0301\\u043d\\u0438\\u043d\\u043e\\u0432\", \"\\u0420\\u0430\\u0445\\u043c\\u0430\\u043d\\u0438\\u043d\\u043e\\u0432\", \"Rachmaninoff, Sergei Vasilievich\", \"\\u0421\\u0435\\u0440\\u0433\\u0435\\u0439 \\u0420\\u0430\\u0445\\u043c\\u0430\\u043d\\u0438\\u043d\\u043e\\u0432\", \"Sergei Rachmaninoff\", \"Life of Sergei Rachmaninoff\", \"Sergei Rahmaninov\", \"Rachmaninoff's\", \"Sergei Vasilyevich Rachmaninov\", \"Sergue\\u00ef Rachmaninov\", \"Rahmaninoff\", \"Sergei Wassilievitch Rachmaninoff\", \"Rachmaninof\", \"Sergej Rachmaninov\", \"Sergej Rachmaninow\", \"Rachmanianoff\", \"Rakhmaninoff\", \"Sergei Vasilievich Rachmaninov\", \"Sergey Vasilyevich Rachmaninoff\", \"Sergie Rachmaninoff\", \"Rachmaninow\", \"Rachmaninov\"]", "[\"Quarantine station\", \"Quarantine Act 1710\", \"Quarantine\", \"Quaranteen\", \"Quarantined\", \"Quarantining\", \"Quarentine\", \"Quarantine flag\"]", "[\"Lizard Peninsula\", \"Lizard, Cornwall\", \"The Lizard\", \"The Lizard (village)\", \"West Lizard SSSI\", \"East Lizard Heathlands\", \"LIZARD\", \"The Lizard Penninsula\", \"Winnianton\", \"Lizard peninsula\"]" ]
[ "January 3, 1938 saw Franklin D. Roosevelt found the charity March of Dimes. What epidemic disease was it targeting?", "Who was the Greek equivalent of the Roman god Vulcan?", "Who is the English logician who devised an algebraic system that has since been adopted for the analysis of digital electronic circuitry?", "\"When this great artist was once criticized for creating unrealistic art, he asked his accuser \"\"Can you show me some realistic art?\"\" The man showed him a photograph of his wife. The artist observed: \"\"So your wife is two inches tall, two-dimensional, with no arms and no legs, and no colour but only shades of gray?\"\" Who is this artist who went through a 'Blue Period' and a 'Rose Period'?\"", "Which city will host the 2016 Olympic Games?", "Who had a number one in 2000 with Black Coffee", "The Iris has a thick-stemmed root instead of a bulb.By what name is this 'root' known?", "Which is said to be the oldest book in the Bible?", "Who was the first chemist to be Britain's Prime Minister?", "Which ancient European period came before the Iron Age?", "Which Avro delta wing bomber entered service in the RAF in 1956 and was retired in 1984?", "Where did the biggest naval battle of the Second World War take place between the USA and Japan, from 24th to 26th October 1944?", "Who wrote the major choral work 'All Night Vigil', better known as the 'Vespers' which was sung at his funeral in 1943?", "A lazaretto which can be an isolated island or a ship at anchor near a harbor is used for what purpose for maritime travelers?", "What sort of creature is a 'Blue Tongue'?" ]
15
[ 83490, 83491, 83492, 83493, 83494, 83495, 83496, 83497, 83498, 83499, 83500, 83501, 83502, 83503, 83504 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: On which African country's flag would you see the emblem of the 'soapstone bird'?\nQuestion 2: Which actress played Miss Moneypenny in the James Bond films fourteen times, from Dr. No (1962) until her final performance of the character in A View to a Kill (1985).\nQuestion 3: Which computer game takes place in Liberty City, Vice City and San Andreas, which suffer from rampant crime, feuding between crime syndicates, random acts of violence from street gangs, organized thievery and murder, and corrupt city officials and police?\nQuestion 4: \"\"\"Gone in 60 Seconds\"\" features what car with the nickname of \"\"Eleanor\"\"?\"\nQuestion 5: What was the apt name of the largest armoured vehicle that the Germans had in World War II?\nQuestion 6: Each September at Abbots Bromley in Staffordshire , men perform an ancient animal dance holding what ?\nQuestion 7: What nickname was given to the New York Yankees baseball team of the late 1920s, in particular to the first six hitters in the 1927 team lineup?\nQuestion 8: Which Stoke City, Blackpool and England player was the first European Footballer of the Year in 1956?\nQuestion 9: What name, that of a mythological creature, is given to the smallest species of owl?\nQuestion 10: Which American car manufacturer is named after the founder of Detroit?\nQuestion 11: In Shakespeare's play where were The Two Gentlemen from\nQuestion 12: Which city, whose name means 'fortification at Eidyn', was the first to host the Commonwealth Games twice?\nQuestion 13: Which of the Marx brother's original name was Adolph?\nQuestion 14: Who preceded George W Bush as president of the USA?\nQuestion 15: What is the name of the process, in which a fluid passes through a semi-permeable membrane, from a weaker to a stronger solution?", "role": "user" } ]
["[\"Zimbabwean cultural practices\", \"People of Zimbabwe\", \"Zimbabwae\", \"Zimbabwean legends\", \"Name of Zimbabwe\", \"Zimbabwe\", \"ISO 3166-1:ZW\", \"Health care in Zimbabwe\", \"Republic of Zimbabwe\", \"Cuisine of Zimbabwe\", \"ZWE\", \"ZIMBABWE\", \"Zimbabwean\", \"Republic Zimbabwe\", \"Zimbobwe\", \"Zimbabwean cuisine\", \"Republic Of Zimbabwe\", \"Zimbabwei\", \"Zimbabwian\", \"Etymology of Zimbabwe\", \"Chimpabwe\", \"Zimbawean\"]", "[\"Lois Maxwell\"]", "[\"Grand Theft Auto (disambiguation)\", \"Grand Theft Auto\", \"Grand theft auto\"]", "[\"Ronaele\", \"Mustang SVT Cobra R\", \"S-197\", \"Ford Mustang Automatic\", \"1972 Ford Mustang\", \"The Ford Mustang\", \"Ford Mustang GT Coupe\", \"Ronaele Mustang\", \"Ford Mustang\", \"Mustang GT\", \"Mustang (Ford automobile)\", \"Ford Mustang GT\", \"Ford Mustang GT Convertible\"]", "[\"Elefant\", \"Elephant tank\", \"Panzerjager Tiger (P)\", \"ELEFANT\", \"Jagdpanzer Tiger (P)\", \"Panzerjaeger Tiger (P)\", \"Elefant Tank\", \"Ferdinand (Tank hunter)\", \"Panzerj\\u00e4ger Tiger (P)\"]", "[\"ANTLERS\", \"The Antlers\", \"Antler (disambiguation)\"]", "[\"1927 Yankees\", \"Murderous row\", \"Murderer's row\", \"Murderer's Row\", \"Murderers Row\", \"Murderers' Row\"]", "[\"Stan Matthews\", \"Stanley Matthews (football player)\", \"Stanley Matthews\", \"Matthews, Sir Stanley\", \"Sir Stan\", \"Wizard of Dribble\", \"Sir Stan Matthews\", \"Sir Stanley Matthews\"]", "[\"Socorro Elf Owl\", \"Elf Owl\", \"Elf owl\", \"Micrathene\", \"ELF OWL\", \"Micrathene whitneyi\", \"Socorro elf owl\"]", "[\"Cadillick\", \"Cadillac Automobile Company\", \"Cadillac Motor Company\", \"Cadallac\", \"Cadilac\", \"Cadillac\", \"Cadillacs\", \"Cadillac (automobile)\", \"Cadillac automobile\"]", "[\"San Michele Extra\", \"UN/LOCODE:ITVRN\", \"Commune of Verona\", \"Waelsch-Bern\", \"Walsch-Bern\", \"Vetona\", \"City of Verona\", \"Verona, Italy\", \"Welschbern\", \"W\\u00e4lsch-Bern\", \"Verona\", \"City Of Verona\"]", "[\"Dun Eideann\", \"Burgh of Edinburgh\", \"Auld Reekie\", \"Edinburgh, City of (council area)\", \"Capital of Scotland\", \"Inner Edinburgh\", \"Old and New Towns of Edinburgh\", \"Edinbra\", \"Edinburgh (Scotland)\", \"Areas of edinburgh\", \"Din Eidyn\", \"Edin-burgh\", \"D\\u00f9n \\u00c8ideann\", \"EDINBURGH\", \"Edinburgh art\", \"Edingburgh\", \"Athens of the north\", \"Dunedin, Scotland\", \"Edinburgh City Region\", \"Caer Eiddyn\", \"Capital city of scotland\", \"Edimburgh\", \"Dun Edin\", \"Edinburgh, United Kingdom\", \"Edinborough\", \"UN/LOCODE:GBEDI\", \"Suburbs of Edinburgh\", \"The weather in Edinburgh\", \"City of Edinburgh, Scotland\", \"Edinburgh, UK\", \"Edinburgh\", \"Eiddyn\", \"D\\u00f9n \\u00c9ideann\", \"Edimburgo\", \"Southside, Edinburgh\", \"Embro\", \"Edinburgh Navigator\", \"Edinburgh (district)\", \"City of Edinburgh\", \"Eidyn\", \"Geography of Edinburgh\", \"Edinbourgh\", \"Embra\", \"List of Edinburgh suburbs\", \"Areas of Edinburgh\", \"List of places in Edinburgh\", \"Capital of scotland\", \"Edinburgh, Scotland\", \"Edinburrie\", \"City of Edinburgh (council area)\", \"Edinbrough\", \"Edinburgh Inspiring Capital\", \"City of Edinburgh (local government district, Lothian region)\"]", "[\"Harpo\", \"Harpo (disambiguation)\"]", "[\"US President Bill Clinton\", \"Buddy (Clinton's dog)\", \"William Jefferson Blythe III\", \"President Bill Clinton\", \"Bill Clinton's Post Presidency\", \"Bill Blythe IV\", \"42nd President of the United States\", \"Clintonesque\", \"Klin-ton\", \"Willy Clinton\", \"Bill Klinton\", \"William Jefferson Blythe IV\", \"Bill Clinton%5C\", \"Bill clinton\", \"Clinton, Bill\", \"The MTV President\", \"Bill Clinton's sex scandals\", \"William Jefferson Clinton\", \"William Blythe III\", \"Billy Clinton\", \"William clinton\", \"MTV president\", \"Bill Jefferson Clinton\", \"BillClinton\", \"William J. Blythe III\", \"President Clinton\", \"William J Clinton\", \"Virginia Clinton Kelly\", \"Bubba Clinton\", \"Bill Clinton\", \"Bull Clinton\", \"WilliamJeffersonClinton\", \"William J. Blythe\", \"William Clinton\", \"MTV President\", \"Billl Clinton\", \"Billll Clinton\", \"Bill J. Clinton\", \"Virginia Clinton\", \"William J. Clinton\", \"Clinton Gore Administration\", \"Bill Clinton's Post-Presidency\", \"William Jefferson (Bill) Clinton\", \"Virginia Cassidy Blythe\", \"Willam Jefferson Blythe III\", \"Virginia Kelly\", \"William Jefferson %22Bill%22 Clinton\", \"William %22Bill%22 Clinton\", \"Bil Clinton\", \"@billclinton\"]", "[\"Osmotic\", \"Osmotic gradient\", \"Osmitic pressure\", \"Osmosis in plant cells\", \"Pressure barrier osmosis\", \"Osmosis demonstration\", \"Exosmosis\", \"Endosmosis\", \"OSMOSIS\", \"Effects of osmosis\", \"Electroneutral exchange\", \"Endosmose\", \"Osmosis\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Zimbabwean cultural practices\", \"People of Zimbabwe\", \"Zimbabwae\", \"Zimbabwean legends\", \"Name of Zimbabwe\", \"Zimbabwe\", \"ISO 3166-1:ZW\", \"Health care in Zimbabwe\", \"Republic of Zimbabwe\", \"Cuisine of Zimbabwe\", \"ZWE\", \"ZIMBABWE\", \"Zimbabwean\", \"Republic Zimbabwe\", \"Zimbobwe\", \"Zimbabwean cuisine\", \"Republic Of Zimbabwe\", \"Zimbabwei\", \"Zimbabwian\", \"Etymology of Zimbabwe\", \"Chimpabwe\", \"Zimbawean\"]", "[\"Lois Maxwell\"]", "[\"Grand Theft Auto (disambiguation)\", \"Grand Theft Auto\", \"Grand theft auto\"]", "[\"Ronaele\", \"Mustang SVT Cobra R\", \"S-197\", \"Ford Mustang Automatic\", \"1972 Ford Mustang\", \"The Ford Mustang\", \"Ford Mustang GT Coupe\", \"Ronaele Mustang\", \"Ford Mustang\", \"Mustang GT\", \"Mustang (Ford automobile)\", \"Ford Mustang GT\", \"Ford Mustang GT Convertible\"]", "[\"Elefant\", \"Elephant tank\", \"Panzerjager Tiger (P)\", \"ELEFANT\", \"Jagdpanzer Tiger (P)\", \"Panzerjaeger Tiger (P)\", \"Elefant Tank\", \"Ferdinand (Tank hunter)\", \"Panzerj\\u00e4ger Tiger (P)\"]", "[\"ANTLERS\", \"The Antlers\", \"Antler (disambiguation)\"]", "[\"1927 Yankees\", \"Murderous row\", \"Murderer's row\", \"Murderer's Row\", \"Murderers Row\", \"Murderers' Row\"]", "[\"Stan Matthews\", \"Stanley Matthews (football player)\", \"Stanley Matthews\", \"Matthews, Sir Stanley\", \"Sir Stan\", \"Wizard of Dribble\", \"Sir Stan Matthews\", \"Sir Stanley Matthews\"]", "[\"Socorro Elf Owl\", \"Elf Owl\", \"Elf owl\", \"Micrathene\", \"ELF OWL\", \"Micrathene whitneyi\", \"Socorro elf owl\"]", "[\"Cadillick\", \"Cadillac Automobile Company\", \"Cadillac Motor Company\", \"Cadallac\", \"Cadilac\", \"Cadillac\", \"Cadillacs\", \"Cadillac (automobile)\", \"Cadillac automobile\"]", "[\"San Michele Extra\", \"UN/LOCODE:ITVRN\", \"Commune of Verona\", \"Waelsch-Bern\", \"Walsch-Bern\", \"Vetona\", \"City of Verona\", \"Verona, Italy\", \"Welschbern\", \"W\\u00e4lsch-Bern\", \"Verona\", \"City Of Verona\"]", "[\"Dun Eideann\", \"Burgh of Edinburgh\", \"Auld Reekie\", \"Edinburgh, City of (council area)\", \"Capital of Scotland\", \"Inner Edinburgh\", \"Old and New Towns of Edinburgh\", \"Edinbra\", \"Edinburgh (Scotland)\", \"Areas of edinburgh\", \"Din Eidyn\", \"Edin-burgh\", \"D\\u00f9n \\u00c8ideann\", \"EDINBURGH\", \"Edinburgh art\", \"Edingburgh\", \"Athens of the north\", \"Dunedin, Scotland\", \"Edinburgh City Region\", \"Caer Eiddyn\", \"Capital city of scotland\", \"Edimburgh\", \"Dun Edin\", \"Edinburgh, United Kingdom\", \"Edinborough\", \"UN/LOCODE:GBEDI\", \"Suburbs of Edinburgh\", \"The weather in Edinburgh\", \"City of Edinburgh, Scotland\", \"Edinburgh, UK\", \"Edinburgh\", \"Eiddyn\", \"D\\u00f9n \\u00c9ideann\", \"Edimburgo\", \"Southside, Edinburgh\", \"Embro\", \"Edinburgh Navigator\", \"Edinburgh (district)\", \"City of Edinburgh\", \"Eidyn\", \"Geography of Edinburgh\", \"Edinbourgh\", \"Embra\", \"List of Edinburgh suburbs\", \"Areas of Edinburgh\", \"List of places in Edinburgh\", \"Capital of scotland\", \"Edinburgh, Scotland\", \"Edinburrie\", \"City of Edinburgh (council area)\", \"Edinbrough\", \"Edinburgh Inspiring Capital\", \"City of Edinburgh (local government district, Lothian region)\"]", "[\"Harpo\", \"Harpo (disambiguation)\"]", "[\"US President Bill Clinton\", \"Buddy (Clinton's dog)\", \"William Jefferson Blythe III\", \"President Bill Clinton\", \"Bill Clinton's Post Presidency\", \"Bill Blythe IV\", \"42nd President of the United States\", \"Clintonesque\", \"Klin-ton\", \"Willy Clinton\", \"Bill Klinton\", \"William Jefferson Blythe IV\", \"Bill Clinton%5C\", \"Bill clinton\", \"Clinton, Bill\", \"The MTV President\", \"Bill Clinton's sex scandals\", \"William Jefferson Clinton\", \"William Blythe III\", \"Billy Clinton\", \"William clinton\", \"MTV president\", \"Bill Jefferson Clinton\", \"BillClinton\", \"William J. Blythe III\", \"President Clinton\", \"William J Clinton\", \"Virginia Clinton Kelly\", \"Bubba Clinton\", \"Bill Clinton\", \"Bull Clinton\", \"WilliamJeffersonClinton\", \"William J. Blythe\", \"William Clinton\", \"MTV President\", \"Billl Clinton\", \"Billll Clinton\", \"Bill J. Clinton\", \"Virginia Clinton\", \"William J. Clinton\", \"Clinton Gore Administration\", \"Bill Clinton's Post-Presidency\", \"William Jefferson (Bill) Clinton\", \"Virginia Cassidy Blythe\", \"Willam Jefferson Blythe III\", \"Virginia Kelly\", \"William Jefferson %22Bill%22 Clinton\", \"William %22Bill%22 Clinton\", \"Bil Clinton\", \"@billclinton\"]", "[\"Osmotic\", \"Osmotic gradient\", \"Osmitic pressure\", \"Osmosis in plant cells\", \"Pressure barrier osmosis\", \"Osmosis demonstration\", \"Exosmosis\", \"Endosmosis\", \"OSMOSIS\", \"Effects of osmosis\", \"Electroneutral exchange\", \"Endosmose\", \"Osmosis\"]" ]
[ "On which African country's flag would you see the emblem of the 'soapstone bird'?", "Which actress played Miss Moneypenny in the James Bond films fourteen times, from Dr. No (1962) until her final performance of the character in A View to a Kill (1985).", "Which computer game takes place in Liberty City, Vice City and San Andreas, which suffer from rampant crime, feuding between crime syndicates, random acts of violence from street gangs, organized thievery and murder, and corrupt city officials and police?", "\"\"\"Gone in 60 Seconds\"\" features what car with the nickname of \"\"Eleanor\"\"?\"", "What was the apt name of the largest armoured vehicle that the Germans had in World War II?", "Each September at Abbots Bromley in Staffordshire , men perform an ancient animal dance holding what ?", "What nickname was given to the New York Yankees baseball team of the late 1920s, in particular to the first six hitters in the 1927 team lineup?", "Which Stoke City, Blackpool and England player was the first European Footballer of the Year in 1956?", "What name, that of a mythological creature, is given to the smallest species of owl?", "Which American car manufacturer is named after the founder of Detroit?", "In Shakespeare's play where were The Two Gentlemen from", "Which city, whose name means 'fortification at Eidyn', was the first to host the Commonwealth Games twice?", "Which of the Marx brother's original name was Adolph?", "Who preceded George W Bush as president of the USA?", "What is the name of the process, in which a fluid passes through a semi-permeable membrane, from a weaker to a stronger solution?" ]
15
[ 3780, 3781, 3782, 3783, 3784, 3785, 3786, 3787, 3788, 3789, 3790, 3791, 3792, 3793, 3794 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: The aquatics discipline at most Olympics and related events usually features diving, swimming, synchronized swimming and what other sport?\nQuestion 2: As on 2009, which American Football team has won the most Superbowls?\nQuestion 3: Buffalo, Bermuda, Fescue and Carpet are all types of what?\nQuestion 4: Who wrote the novel 'The Cement Garden'?\nQuestion 5: Which woman replaced George Stephenson on the £5 note in 2002?\nQuestion 6: What organ is foie gras made from?\nQuestion 7: Who was the first woman to be appointed Lord Warden of the Cinque Ports\nQuestion 8: In a suit of armour what body part do pieces called poleyns protect?\nQuestion 9: Coeliac disease is an autoimmune disorder caused by a reaction to which substance?\nQuestion 10: If you are suffering from singultus what is wrong with you\nQuestion 11: Who wrote several books featuring the heroine 'Worrals'?\nQuestion 12: Who achieved a certain level of international celebrity when his wife Lorena severed half his penis, tossing said member into a field, which was later surgically reattached?\nQuestion 13: The Academy Awards were last Sunday, with The King's Speech winning 4 out of 12. Since equaled by Titanic and The Lord of the Rings: The Return of the King, which film, written by a former governor of New Mexico, was the first to win 11 awards in 1959\nQuestion 14: Risotto is usually made with which type of rice?\nQuestion 15: Which political group imposed dictatoriship in France after the revolution?", "role": "user" } ]
["[\"Beach water polo\", \"Wingball\", \"Water polo goal\", \"Water polo clubs\", \"Water Polo\", \"H2o polo\", \"Waterpolo\", \"Water polo\", \"Water polo player\"]", "[\"Pittsburgh Reelers\", \"Pittsburgh steelers\", \"Pittsburgh Steeler\", \"Pittsburgh Pirates (NFL)\", \"Eli Rogers\", \"Pittsburgh Steelers\", \"Steely Mcbeam\", \"Pittsburg Steelers\", \"The Steelers\", \"Pittsburgh Pirates (football)\", \"Pittsburgh Steelers Stadiums\", \"Steely McBeam\", \"Stillers\", \"Steelers\", \"List of Pittsburgh Steelers players who have been MVP\", \"Pittsburgh Steelers stadiums\"]", "[\"Graminoids\", \"Grass blade\", \"Graminoid\", \"Grasses\", \"Tall Grass\", \"Graminid\", \"Sports turf\", \"Grass\"]", "[\"Ian Russell McEwan\", \"Ian Russell McEwan, CBE, FRSA, FRSL\", \"Ian Macabre\", \"Ian McEwan\", \"Ian Mcewen\", \"Ian Mcewan\", \"Ian mcewan\", \"IAN MCEWAN\"]", "[\"Mrs Elizabeth Fry\", \"Elizabeth Gurney Fry\", \"Elizabeth Fry\", \"Elizabeth Gurney\", \"Fry, Elizabeth (Gurney)\", \"Elizabeth (Gurney) Fry\"]", "[\"Impressio duodenalis\", \"Glisson's sheath\", \"Livers\", \"Fetal liver\", \"Impressio gastrica hepatis\", \"Impressio renalis hepatis\", \"Diaphragmatic surface of liver\", \"Human livers\", \"Suprarenal impression\", \"Impressio colica hepatis\", \"Gastric impression on the liver\", \"Duodenal impression\", \"Calves liver\", \"Colic impression on liver\", \"Capsula fibrosa perivascularis\", \"Renal impression on liver\", \"Gastric impression\", \"Liver\", \"Impressio suprarenalis hepatis\", \"Liver metabolism\", \"Visceral surface of liver\", \"Liver sauce\", \"Glissons capsule\", \"Duodenal impression on liver\", \"Impressio gastrica\", \"Impressio renalis\", \"Couinaud segment\", \"Liver capsule\", \"Impressio duodenalis hepatis\", \"Peritoneal attachments of liver\", \"Iecur\", \"Human liver\", \"Hepatic metabolism\", \"Hepatic\", \"Hepatic production\", \"Gastric impression on liver\", \"Colic impression\", \"Fibrous capsule of glisson\", \"Suprarenal impression on liver\", \"Lobus hepatis\", \"Impressio colica\", \"Hepar\", \"Glisson\\u2019s capsule\", \"Human Liver\", \"Glisson's capsule\", \"Jecur\", \"Liver lobe\", \"Liver Tissue Blood Flow\", \"Fibrous capsule of liver\", \"Renal impression\", \"Glissons sheath\", \"Impressio suprarenalis\", \"Fibrous capsule of Glisson\"]", "[\"Queen mum\", \"Queen Elizabeth the Queen Mother\", \"Her Majesty Queen Elizabeth, The Queen Mother\", \"QEQM\", \"Elizabeth, Queen Consort of George VI of England\", \"Elizabeth Bowes Lyon\", \"Her Majesty Queen Elizabeth the Queen Mother\", \"Queen Elizabeth, The Queen Mother\", \"Queen Mum\", \"Elizabeth Angela Marguerite Windsor\", \"Queen Elizabeth the Queen Mum\", \"Elizabeth Angela Marguerite Bowes-Lyon\", \"Elizabeth bowes-lyon\", \"Queen Elizabeth The Queen Mother\", \"Elizabeth, queen consort of George VI of Great Britain\", \"Her Majesty Queen Elizabeth The Queen Mother\", \"Queen Elizabeth, the Queen Mother\", \"The Queen Mother\", \"Elizabeth, the Queen Mother\", \"Coat of Arms of Queen Elizabeth, The Queen Mother\", \"Elizabeth, Queen Mother\", \"Lady Elizabeth Bowes-Lyon\", \"Elizabeth the Queen Mother\", \"Queen Elzabeth the Queen Mother\", \"Elizabeth Bowes-Lyon\", \"Queen Mother Elizabeth\"]", "[\"Knees\", \"Knee surgery\", \"Patellofemoral joint\", \"Bum knee\", \"Knee injury\", \"Medial patellar retinaculum\", \"KNIE\", \"Articulatio genu\", \"Knee joints\", \"Congenital knee dislocation\", \"Knee\", \"Knee-joint\", \"Congenital patellar dislocation\", \"The Knees\", \"Knee joint\", \"Articulatio genus\", \"Knee cartilage\", \"NKIE\", \"Tibiofemoral joint\", \"Tibiofemoral\"]", "[\"Glutin\", \"Gluten\", \"Gluton\", \"Glutinous\", \"Glutenous\", \"Wheaten cornflour\"]", "[\"Hickups\", \"Hichup\", \"Hiccup remedies\", \"Charles Osborne (hiccups)\", \"Hiccough\", \"Hiccups\", \"Hiccup reflex\", \"Hiccup\", \"Synchronous diaphragmatic flutter\", \"Hiccuping\", \"Hiccoughs\", \"Singuitus\", \"Hicough\", \"Hiccough reflex\", \"Hick-up\", \"Hiccupping\", \"Chronic hiccup\", \"Hickup\", \"Singultus\", \"Singulthus\", \"Hicup\"]", "[\"William Earl Johns\", \"Captain W. E. Johns\", \"WE Johns\", \"W E Johns\", \"Captain WE Johns\", \"W. E. Johns\", \"W.E. Johns\", \"William Johns\", \"CAPTAIN W.E. JOHNS\"]", "[\"Lorena Gallo\", \"Bobbitt Uncut\", \"Lorena Bobbitt\", \"Frankenpenis\", \"Loreena Bobbitt\", \"Bobbitize\", \"John Bobbit\", \"John Bobbitt (penile amputee)\", \"Lorena and john bobbit\", \"Bobbitts\", \"John and Loreena Bobbitt\", \"John Wayne Bobbitt\", \"John and Lorena Bobbitt\", \"John Wayne Bobbitt: Uncut\", \"Lorena Bobbit\", \"JOHN WAYNE BOBBIT uncut\", \"JWBU\", \"John bobbit\", \"Bobbitt trial\"]", "[\"Ben hur\", \"Ben-Hur (film)\", \"Ben hurr\", \"Ben-hur\", \"Ben-Hur (disambiguation)\", \"Ben Hurr\", \"Ben-Hur\", \"Ben Hur\"]", "[\"Arborio\", \"Arborio (disambiguation)\"]", "[\"Jacobin\", \"Jacobin club\", \"Jacobin clubs\", \"Jacobins\", \"JACOBINS\", \"Society of the Friends of the Constitution\", \"Jacobinical\", \"Jacobin democracy\", \"Jacobin (Jacobin Club)\", \"Soci\\u00e9t\\u00e9 des amis de la Constitution\", \"Jacobin Club\", \"Club des Jacobins\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Beach water polo\", \"Wingball\", \"Water polo goal\", \"Water polo clubs\", \"Water Polo\", \"H2o polo\", \"Waterpolo\", \"Water polo\", \"Water polo player\"]", "[\"Pittsburgh Reelers\", \"Pittsburgh steelers\", \"Pittsburgh Steeler\", \"Pittsburgh Pirates (NFL)\", \"Eli Rogers\", \"Pittsburgh Steelers\", \"Steely Mcbeam\", \"Pittsburg Steelers\", \"The Steelers\", \"Pittsburgh Pirates (football)\", \"Pittsburgh Steelers Stadiums\", \"Steely McBeam\", \"Stillers\", \"Steelers\", \"List of Pittsburgh Steelers players who have been MVP\", \"Pittsburgh Steelers stadiums\"]", "[\"Graminoids\", \"Grass blade\", \"Graminoid\", \"Grasses\", \"Tall Grass\", \"Graminid\", \"Sports turf\", \"Grass\"]", "[\"Ian Russell McEwan\", \"Ian Russell McEwan, CBE, FRSA, FRSL\", \"Ian Macabre\", \"Ian McEwan\", \"Ian Mcewen\", \"Ian Mcewan\", \"Ian mcewan\", \"IAN MCEWAN\"]", "[\"Mrs Elizabeth Fry\", \"Elizabeth Gurney Fry\", \"Elizabeth Fry\", \"Elizabeth Gurney\", \"Fry, Elizabeth (Gurney)\", \"Elizabeth (Gurney) Fry\"]", "[\"Impressio duodenalis\", \"Glisson's sheath\", \"Livers\", \"Fetal liver\", \"Impressio gastrica hepatis\", \"Impressio renalis hepatis\", \"Diaphragmatic surface of liver\", \"Human livers\", \"Suprarenal impression\", \"Impressio colica hepatis\", \"Gastric impression on the liver\", \"Duodenal impression\", \"Calves liver\", \"Colic impression on liver\", \"Capsula fibrosa perivascularis\", \"Renal impression on liver\", \"Gastric impression\", \"Liver\", \"Impressio suprarenalis hepatis\", \"Liver metabolism\", \"Visceral surface of liver\", \"Liver sauce\", \"Glissons capsule\", \"Duodenal impression on liver\", \"Impressio gastrica\", \"Impressio renalis\", \"Couinaud segment\", \"Liver capsule\", \"Impressio duodenalis hepatis\", \"Peritoneal attachments of liver\", \"Iecur\", \"Human liver\", \"Hepatic metabolism\", \"Hepatic\", \"Hepatic production\", \"Gastric impression on liver\", \"Colic impression\", \"Fibrous capsule of glisson\", \"Suprarenal impression on liver\", \"Lobus hepatis\", \"Impressio colica\", \"Hepar\", \"Glisson\\u2019s capsule\", \"Human Liver\", \"Glisson's capsule\", \"Jecur\", \"Liver lobe\", \"Liver Tissue Blood Flow\", \"Fibrous capsule of liver\", \"Renal impression\", \"Glissons sheath\", \"Impressio suprarenalis\", \"Fibrous capsule of Glisson\"]", "[\"Queen mum\", \"Queen Elizabeth the Queen Mother\", \"Her Majesty Queen Elizabeth, The Queen Mother\", \"QEQM\", \"Elizabeth, Queen Consort of George VI of England\", \"Elizabeth Bowes Lyon\", \"Her Majesty Queen Elizabeth the Queen Mother\", \"Queen Elizabeth, The Queen Mother\", \"Queen Mum\", \"Elizabeth Angela Marguerite Windsor\", \"Queen Elizabeth the Queen Mum\", \"Elizabeth Angela Marguerite Bowes-Lyon\", \"Elizabeth bowes-lyon\", \"Queen Elizabeth The Queen Mother\", \"Elizabeth, queen consort of George VI of Great Britain\", \"Her Majesty Queen Elizabeth The Queen Mother\", \"Queen Elizabeth, the Queen Mother\", \"The Queen Mother\", \"Elizabeth, the Queen Mother\", \"Coat of Arms of Queen Elizabeth, The Queen Mother\", \"Elizabeth, Queen Mother\", \"Lady Elizabeth Bowes-Lyon\", \"Elizabeth the Queen Mother\", \"Queen Elzabeth the Queen Mother\", \"Elizabeth Bowes-Lyon\", \"Queen Mother Elizabeth\"]", "[\"Knees\", \"Knee surgery\", \"Patellofemoral joint\", \"Bum knee\", \"Knee injury\", \"Medial patellar retinaculum\", \"KNIE\", \"Articulatio genu\", \"Knee joints\", \"Congenital knee dislocation\", \"Knee\", \"Knee-joint\", \"Congenital patellar dislocation\", \"The Knees\", \"Knee joint\", \"Articulatio genus\", \"Knee cartilage\", \"NKIE\", \"Tibiofemoral joint\", \"Tibiofemoral\"]", "[\"Glutin\", \"Gluten\", \"Gluton\", \"Glutinous\", \"Glutenous\", \"Wheaten cornflour\"]", "[\"Hickups\", \"Hichup\", \"Hiccup remedies\", \"Charles Osborne (hiccups)\", \"Hiccough\", \"Hiccups\", \"Hiccup reflex\", \"Hiccup\", \"Synchronous diaphragmatic flutter\", \"Hiccuping\", \"Hiccoughs\", \"Singuitus\", \"Hicough\", \"Hiccough reflex\", \"Hick-up\", \"Hiccupping\", \"Chronic hiccup\", \"Hickup\", \"Singultus\", \"Singulthus\", \"Hicup\"]", "[\"William Earl Johns\", \"Captain W. E. Johns\", \"WE Johns\", \"W E Johns\", \"Captain WE Johns\", \"W. E. Johns\", \"W.E. Johns\", \"William Johns\", \"CAPTAIN W.E. JOHNS\"]", "[\"Lorena Gallo\", \"Bobbitt Uncut\", \"Lorena Bobbitt\", \"Frankenpenis\", \"Loreena Bobbitt\", \"Bobbitize\", \"John Bobbit\", \"John Bobbitt (penile amputee)\", \"Lorena and john bobbit\", \"Bobbitts\", \"John and Loreena Bobbitt\", \"John Wayne Bobbitt\", \"John and Lorena Bobbitt\", \"John Wayne Bobbitt: Uncut\", \"Lorena Bobbit\", \"JOHN WAYNE BOBBIT uncut\", \"JWBU\", \"John bobbit\", \"Bobbitt trial\"]", "[\"Ben hur\", \"Ben-Hur (film)\", \"Ben hurr\", \"Ben-hur\", \"Ben-Hur (disambiguation)\", \"Ben Hurr\", \"Ben-Hur\", \"Ben Hur\"]", "[\"Arborio\", \"Arborio (disambiguation)\"]", "[\"Jacobin\", \"Jacobin club\", \"Jacobin clubs\", \"Jacobins\", \"JACOBINS\", \"Society of the Friends of the Constitution\", \"Jacobinical\", \"Jacobin democracy\", \"Jacobin (Jacobin Club)\", \"Soci\\u00e9t\\u00e9 des amis de la Constitution\", \"Jacobin Club\", \"Club des Jacobins\"]" ]
[ "The aquatics discipline at most Olympics and related events usually features diving, swimming, synchronized swimming and what other sport?", "As on 2009, which American Football team has won the most Superbowls?", "Buffalo, Bermuda, Fescue and Carpet are all types of what?", "Who wrote the novel 'The Cement Garden'?", "Which woman replaced George Stephenson on the £5 note in 2002?", "What organ is foie gras made from?", "Who was the first woman to be appointed Lord Warden of the Cinque Ports", "In a suit of armour what body part do pieces called poleyns protect?", "Coeliac disease is an autoimmune disorder caused by a reaction to which substance?", "If you are suffering from singultus what is wrong with you", "Who wrote several books featuring the heroine 'Worrals'?", "Who achieved a certain level of international celebrity when his wife Lorena severed half his penis, tossing said member into a field, which was later surgically reattached?", "The Academy Awards were last Sunday, with The King's Speech winning 4 out of 12. Since equaled by Titanic and The Lord of the Rings: The Return of the King, which film, written by a former governor of New Mexico, was the first to win 11 awards in 1959", "Risotto is usually made with which type of rice?", "Which political group imposed dictatoriship in France after the revolution?" ]
15
[ 78240, 78241, 78242, 78243, 78244, 78245, 78246, 78247, 78248, 78249, 78250, 78251, 78252, 78253, 78254 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Clove hitch, Sheepshank, Figure eight, and Bowline are?\nQuestion 2: The Hudson Strait separates mainland Canada from which island?\nQuestion 3: Who is the wife of singer Jamie Cullum?\nQuestion 4: Who starred with Jeff Daniels in the 1995 film Dumb and Dumber\nQuestion 5: What is the correct term for a period of play in polo?\nQuestion 6: Who was the tallest President of the USA in the 20th century?\nQuestion 7: How many players are on the field in a team during a game of Canadian Box Lacrosse?\nQuestion 8: In the southwest of the UK who or what is often referred to as a 'grockle?\nQuestion 9: A famous remark often attributed to Brian Eno is that while only a few thousand people bought a record of this band, almost every single one of the purchasers was inspired to start their own band. Which influential rock band was Eno referring to?\nQuestion 10: Hastings Banda was the first President of which African country?\nQuestion 11: Who composed the opera Otello?\nQuestion 12: Glenis the Guinea Pig is which rodent superstar's girlfriend?\nQuestion 13: What is the name of the Icelandic volcano which erupted in May 2011 causing disruption of flights around northern Europe?\nQuestion 14: The so-called “Curse of the Bambino” afflicted which team between 1918 and 2004?\nQuestion 15: Which sport is played with a goal 12 ft wide by 7ft high, with a maximum of 11 players from each team able to be on the field at any time?", "role": "user" } ]
["[\"Knots\", \"Knotwork\", \"Standing part\", \"Capsize (knot)\", \"Knot component\", \"Knotting\", \"List of trick knots\", \"Coil knots\", \"List of coil knots\", \"Working end\", \"Knots and Ropework\", \"Coil knot\", \"Nodation\", \"Knot\", \"End (knot)\", \"Trick knot\", \"Knot components\", \"Knot tying\"]", "[\"Baffin Island\", \"\\u157f\\u146d\\u1585\\u1456\\u14d7\\u1483\", \"Baffin Land\", \"Ile de Baffin\", \"BAFFIN ISLAND\", \"\\u00cele de Baffin\", \"Qikiqtaaluk\", \"Baffin island\", \"Baffin Islands\"]", "[\"SOPHIE DAHL\", \"Sophie Dahl\"]", "[\"Jim eugene carrey\", \"Jim carrey\", \"Carrey\", \"James Carrey\", \"Jim Carrey\", \"Jane Erin Carrey\", \"James Eugene Carrey\", \"Jim Carry\", \"Jane Carrey\", \"James eugene carrey\"]", "[\"Chukkars\", \"CHUKKA\", \"Chukka (disambiguation)\", \"Chukka\"]", "[\"Rebekah Baines\", \"President Lyndon B Johnson\", \"President Lyndon Baines Johnson\", \"Presidency of Lyndon Baines Johnson\", \"All I have I would have given gladly...\", \"President Lyndon B. Johnson\", \"Lyndon b. johnson\", \"L. Johnson Administration\", \"Johnson, Lyndon Baines\", \"President lbj\", \"Lyndon Johnson Administration\", \"Lindon B. Johnson\", \"L. B. J.\", \"Lyndon b johnson\", \"Lyndon B. Johnson Administration\", \"LBJ\", \"L.B.J.\", \"President LBJ\", \"Lyndon Johnson\", \"36th President of the United States\", \"L B J\", \"Lindon Johnson\", \"Howard University Speech\", \"Lyndon Banes Johnson\", \"Lyndon Baines Johnson Administration\", \"Lyndon B. Johnson\", \"President Lyndon Johnson\", \"Lyndon Baynes Johnson\", \"Lyndon johnson\", \"L. B. Johnson Administration\", \"Lyndon B Johnson\", \"Rebekah Baines Johnson\", \"Lyndon Baines Johnson\", \"Lbj\", \"Presidency of Lyndon B. Johnson\"]", "[\"Six\", \"six\", \"6\"]", "[\"Toursim\", \"Touristic\", \"Holiday maker\", \"Holidaymaker\", \"Tourist association\", \"Sight-seeing\", \"Tourisim\", \"Tourists\", \"Sight seeing\", \"Conscientious Tourism\", \"Tourist\", \"Weekend trip\", \"Travel industry\", \"Basic tourism topics\", \"Types of tourism\", \"Tourism industry\", \"Tourism\", \"Tourist-oriented business\", \"Educational tourism\", \"Conscious tourism\", \"Mass tourism\", \"International travel\", \"Gambling tourism\", \"Attractions\", \"VFR Tourism\", \"Tourism basic topics\", \"A TOURIST\", \"Holiday Maker\", \"Tourist industry\", \"History of tourism\", \"Leisure travel\", \"Sightseeing\"]", "[\"Velvet Underground\", \"The Velvet Underground\", \"Velvet underground\"]", "[\"Mala%3Fi\", \"Malawians\", \"Republic of Mala\\u0175i\", \"Malawi, Africa\", \"Republic of Malawi\", \"Administrative divisions of Malawi\", \"Malawi\", \"Republic Malawi\", \"ISO 3166-1:MW\", \"Religion in Malawi\", \"Malawian language\", \"Malawian\", \"Culture of Malawi\", \"Mala\\u0175i\", \"The Warm Heart of Africa\", \"Nyassaland\"]", "[\"G. Verdi\", \"Guiseppe Verdi\", \"Jos\\u00e9 Verdi\", \"Verdi Competition\", \"Guisippe Verdi\", \"Giuseppe Fortunino Francesco Verdi\", \"Giuseppe Fortuning Francesco Verdi\", \"Verdi's\", \"Guiseppe verdi\", \"G Verdi\", \"VERDI\", \"Giuseppe Verdi\", \"Giuseppe verdi\", \"Guiseppi Verdi\", \"Verdi\"]", "[\"Roland Rat's\"]", "[\"GRIMSVOTN\", \"Grimsvotn\", \"Grimsvoetn\", \"Gr\\u00edmsv\\u00f6tn\", \"Grimsvotn volcano\", \"Grimsv\\u00f6tn\", \"Iceland eruption\"]", "[\"Carlos Ahern\", \"Redsox\", \"RedSox\", \"Boston redsox\", \"The Boston Redsox\", \"Boston Americans\", \"Red socs\", \"Bosox\", \"Red Sox Bench Coach\", \"Boston Red Socks\", \"Red Sox First Base Coach\", \"Boston Red Sox\", \"Old Town Team\", \"Red Sox Hitting Coach\", \"Boston Red Sox roster\", \"Boston Red Sox (sports)\", \"Truck Day\", \"BoSox\", \"The red sox\", \"Redsocks\", \"Crimson hose\", \"Boston Pilgrams\", \"Bo-sox\", \"Boston Sox\", \"Boston Red Sox Roster\", \"Red sox\", \"Red Sox Pitching Coach\", \"Red Sox\", \"Red Sox Roster\", \"The Boston Red Sox\", \"The Boston Red Socks\", \"The Old Town Team\", \"Boston red sox\", \"Boston Redsox\", \"Talksox\", \"Boston Somersets\", \"New England Nine\", \"Boston Pilgrims\"]", "[\"Hockey positions\", \"Knee hockey\", \"Hockey team\", \"Hocky\", \"Hockey\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Knots\", \"Knotwork\", \"Standing part\", \"Capsize (knot)\", \"Knot component\", \"Knotting\", \"List of trick knots\", \"Coil knots\", \"List of coil knots\", \"Working end\", \"Knots and Ropework\", \"Coil knot\", \"Nodation\", \"Knot\", \"End (knot)\", \"Trick knot\", \"Knot components\", \"Knot tying\"]", "[\"Baffin Island\", \"\\u157f\\u146d\\u1585\\u1456\\u14d7\\u1483\", \"Baffin Land\", \"Ile de Baffin\", \"BAFFIN ISLAND\", \"\\u00cele de Baffin\", \"Qikiqtaaluk\", \"Baffin island\", \"Baffin Islands\"]", "[\"SOPHIE DAHL\", \"Sophie Dahl\"]", "[\"Jim eugene carrey\", \"Jim carrey\", \"Carrey\", \"James Carrey\", \"Jim Carrey\", \"Jane Erin Carrey\", \"James Eugene Carrey\", \"Jim Carry\", \"Jane Carrey\", \"James eugene carrey\"]", "[\"Chukkars\", \"CHUKKA\", \"Chukka (disambiguation)\", \"Chukka\"]", "[\"Rebekah Baines\", \"President Lyndon B Johnson\", \"President Lyndon Baines Johnson\", \"Presidency of Lyndon Baines Johnson\", \"All I have I would have given gladly...\", \"President Lyndon B. Johnson\", \"Lyndon b. johnson\", \"L. Johnson Administration\", \"Johnson, Lyndon Baines\", \"President lbj\", \"Lyndon Johnson Administration\", \"Lindon B. Johnson\", \"L. B. J.\", \"Lyndon b johnson\", \"Lyndon B. Johnson Administration\", \"LBJ\", \"L.B.J.\", \"President LBJ\", \"Lyndon Johnson\", \"36th President of the United States\", \"L B J\", \"Lindon Johnson\", \"Howard University Speech\", \"Lyndon Banes Johnson\", \"Lyndon Baines Johnson Administration\", \"Lyndon B. Johnson\", \"President Lyndon Johnson\", \"Lyndon Baynes Johnson\", \"Lyndon johnson\", \"L. B. Johnson Administration\", \"Lyndon B Johnson\", \"Rebekah Baines Johnson\", \"Lyndon Baines Johnson\", \"Lbj\", \"Presidency of Lyndon B. Johnson\"]", "[\"Six\", \"six\", \"6\"]", "[\"Toursim\", \"Touristic\", \"Holiday maker\", \"Holidaymaker\", \"Tourist association\", \"Sight-seeing\", \"Tourisim\", \"Tourists\", \"Sight seeing\", \"Conscientious Tourism\", \"Tourist\", \"Weekend trip\", \"Travel industry\", \"Basic tourism topics\", \"Types of tourism\", \"Tourism industry\", \"Tourism\", \"Tourist-oriented business\", \"Educational tourism\", \"Conscious tourism\", \"Mass tourism\", \"International travel\", \"Gambling tourism\", \"Attractions\", \"VFR Tourism\", \"Tourism basic topics\", \"A TOURIST\", \"Holiday Maker\", \"Tourist industry\", \"History of tourism\", \"Leisure travel\", \"Sightseeing\"]", "[\"Velvet Underground\", \"The Velvet Underground\", \"Velvet underground\"]", "[\"Mala%3Fi\", \"Malawians\", \"Republic of Mala\\u0175i\", \"Malawi, Africa\", \"Republic of Malawi\", \"Administrative divisions of Malawi\", \"Malawi\", \"Republic Malawi\", \"ISO 3166-1:MW\", \"Religion in Malawi\", \"Malawian language\", \"Malawian\", \"Culture of Malawi\", \"Mala\\u0175i\", \"The Warm Heart of Africa\", \"Nyassaland\"]", "[\"G. Verdi\", \"Guiseppe Verdi\", \"Jos\\u00e9 Verdi\", \"Verdi Competition\", \"Guisippe Verdi\", \"Giuseppe Fortunino Francesco Verdi\", \"Giuseppe Fortuning Francesco Verdi\", \"Verdi's\", \"Guiseppe verdi\", \"G Verdi\", \"VERDI\", \"Giuseppe Verdi\", \"Giuseppe verdi\", \"Guiseppi Verdi\", \"Verdi\"]", "[\"Roland Rat's\"]", "[\"GRIMSVOTN\", \"Grimsvotn\", \"Grimsvoetn\", \"Gr\\u00edmsv\\u00f6tn\", \"Grimsvotn volcano\", \"Grimsv\\u00f6tn\", \"Iceland eruption\"]", "[\"Carlos Ahern\", \"Redsox\", \"RedSox\", \"Boston redsox\", \"The Boston Redsox\", \"Boston Americans\", \"Red socs\", \"Bosox\", \"Red Sox Bench Coach\", \"Boston Red Socks\", \"Red Sox First Base Coach\", \"Boston Red Sox\", \"Old Town Team\", \"Red Sox Hitting Coach\", \"Boston Red Sox roster\", \"Boston Red Sox (sports)\", \"Truck Day\", \"BoSox\", \"The red sox\", \"Redsocks\", \"Crimson hose\", \"Boston Pilgrams\", \"Bo-sox\", \"Boston Sox\", \"Boston Red Sox Roster\", \"Red sox\", \"Red Sox Pitching Coach\", \"Red Sox\", \"Red Sox Roster\", \"The Boston Red Sox\", \"The Boston Red Socks\", \"The Old Town Team\", \"Boston red sox\", \"Boston Redsox\", \"Talksox\", \"Boston Somersets\", \"New England Nine\", \"Boston Pilgrims\"]", "[\"Hockey positions\", \"Knee hockey\", \"Hockey team\", \"Hocky\", \"Hockey\"]" ]
[ "Clove hitch, Sheepshank, Figure eight, and Bowline are?", "The Hudson Strait separates mainland Canada from which island?", "Who is the wife of singer Jamie Cullum?", "Who starred with Jeff Daniels in the 1995 film Dumb and Dumber", "What is the correct term for a period of play in polo?", "Who was the tallest President of the USA in the 20th century?", "How many players are on the field in a team during a game of Canadian Box Lacrosse?", "In the southwest of the UK who or what is often referred to as a 'grockle?", "A famous remark often attributed to Brian Eno is that while only a few thousand people bought a record of this band, almost every single one of the purchasers was inspired to start their own band. Which influential rock band was Eno referring to?", "Hastings Banda was the first President of which African country?", "Who composed the opera Otello?", "Glenis the Guinea Pig is which rodent superstar's girlfriend?", "What is the name of the Icelandic volcano which erupted in May 2011 causing disruption of flights around northern Europe?", "The so-called “Curse of the Bambino” afflicted which team between 1918 and 2004?", "Which sport is played with a goal 12 ft wide by 7ft high, with a maximum of 11 players from each team able to be on the field at any time?" ]
15
[ 125895, 125896, 125897, 125898, 125899, 125900, 125901, 125902, 125903, 125904, 125905, 125906, 125907, 125908, 125909 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: The Mason-Dixon Line, surveyed by Charles Mason and Jeremiah Dixon, which became a popular name for the dividing line between the slave and free states, is the boundary between which two states of the USA?\nQuestion 2: What did Edwin Land invent because of his daughters' wish for instant and 'snappy' results?\nQuestion 3: What was the first name of Anglo-Irish statesman and diplomat Downing, who Downing Street in London was named after?\nQuestion 4: What kind of flower is a Lady’s Slipper?\nQuestion 5: In the House of Commons, which word of three letters is used by members supporting a motion vote?\nQuestion 6: Who sailed round the world in the yacht Lively Lady?\nQuestion 7: In our solar system which is the largest planet?\nQuestion 8: Alaska, Laxton's progress and Mr Big are varieties of what?\nQuestion 9: Which national radio station broadcasts between 99.9 and 101.9 Mhz?\nQuestion 10: Which role as 'the other woman' won Glenn Close her first Oscar nomination?\nQuestion 11: On which Mediterranean Island is the city of Ajaccio?\nQuestion 12: Which American University is situated in Cambridge,Massachusetts?\nQuestion 13: Who won the Women's Cricket World Cup played at Sydney, Australia, in 2009?\nQuestion 14: How is the plant monstera deliciosa better known ?\nQuestion 15: What American, founder of the Standard Oil company, was the first American to amass $1 billion, and is generally thought to have been the richest man in history?", "role": "user" } ]
["[\"Pennsylvania and Maryland\"]", "[\"Kodamatic\", \"Kodak Colorburst\", \"Kodak Instant\", \"Polaroid photography\", \"Polaroid camera\", \"Instant camera\", \"Instant photography\", \"Polaroid Camera\"]", "[\"Gheevarghese\", \"Vargheese\", \"Ghevargheese\", \"George (disambiguation)\", \"Ghevarghese\", \"Gheevargheese\", \"George\", \"Vargis\", \"Geroge\", \"George's\", \"GEORGE\"]", "[\"Botanical orchids\", \"Orchid flower\", \"Botanical orchid\", \"Orchidaceae\", \"Orchid Family\", \"Orchird\", \"Orchid family\", \"Orchis family\", \"Orchids\", \"Orchid\"]", "[\"AYE\", \"Keppel Viaduct\", \"Ayer Rajah Expressway\"]", "[\"Alec rose\", \"Alec Rose\"]", "[\"Physical characteristics of Jupiter\", \"Sol 5\", \"Jupiter (astronomy)\", \"Weight of Jupiter\", \"Life on Jupiter\", \"Jupitor\", \"Planet Jupiter\", \"Wood Star\", \"Jupiter (Planet)\", \"Jovian diameter\", \"Jupiter!\", \"JUPITER\", \"Mass of Jupiter\", \"Astronomy Jupiter\", \"Zenography\", \"Jupiter (planet)\", \"Jupiter's\", \"\\u2643\", \"Sol-5\", \"Jovian orbit\", \"The mass of Jupiter\", \"Sun f\", \"Sol f\", \"Jupiter weight\", \"Jupiter(planet)\", \"The weight of Jupiter\", \"Sol V\", \"Jupiter's radio emissions\", \"Jupiter\", \"Jupiter radius\", \"Jupitero\"]", "[\"PEAS\", \"Pisum sativum\", \"Pea plant\", \"Garden pea\", \"Green peas\", \"P. sativum\", \"Peas\", \"Pea\", \"Peascods\", \"Green pea\", \"Green Pea\", \"Field peas\", \"Pea Plants\", \"Pea pod\", \"Pisum sativus\", \"Petit pois\"]", "[\"CLASSIC FM\", \"Classic FM (disambiguation)\", \"Classic FM\", \"ClassicFM\", \"Classic fm\"]", "[\"Bunny boiler\", \"Bunny boiling\", \"I Won't Be Ignored, Dan\", \"Fatal Attraction\", \"Bunny Boiler\"]", "[\"La Corse\", \"Corsica, France\", \"Corsica (Journal)\", \"Cyrnos\", \"Cyrnus\", \"Corsic\", \"Corse\", \"Korsika\", \"CORSICA\", \"Corsica\"]", "[\"Harvard University Crimson\", \"University of Harvard\", \"HARVARD\", \"Harvard University\", \"New College, Cambridge, Massachusetts\", \"Harvard U.\", \"Harvard.edu\", \"Harvard University Department of Psychology\", \"Haravrd\", \"Kremlin on the Charles\", \"Harvard\", \"Harvard University Concord Field Station\", \"Harvard university\", \"Harvard Univ.\", \"New College, Cambridge, MA\", \"Harvard.\", \"Harvard-Radcliffe TV\", \"Harward university\"]", "[\"Englnad\", \"The land of the Angles\", \"Sasainn\", \"England, U.K.\", \"Engla land\", \"England's\", \"Starks Field School\", \"Englaland\", \"English Nation\", \"Ingland\", \"Engelond\", \"Englistan\", \"Languages of England\", \"England, UK\", \"Name of England\", \"Auld enemy\", \"Sasana\", \"England, United Kingdom\", \"\\u00c6ngland\", \"Lloegr\", \"Land of the Angles\", \"Engla rice\", \"Aengland\", \"UK, (England)\", \"\\u00c6nglaland\", \"England\", \"Life in England\", \"Aenglaland\", \"ENGLAND\", \"Anglica\", \"Etymology of England\", \"Pow Sows\", \"\\u00c6ngla land\"]", "[\"Monster fruit\", \"Monstereo\", \"Ceriman\", \"Fruit Salad Plant\", \"Splitleaf philodendron\", \"Monsterio Delicio\", \"Swiss cheese plant\", \"Swiss Cheese Plant\", \"Split leaf philodendron\", \"SWISS CHEESE PLANT\", \"Windowleaf\", \"Monstera deliciosa\", \"Window leaf\", \"Mexican breadfruit\", \"Split-leaf Philodendron\", \"Zampa di leone\"]", "[\"John D. Rockefeller, Sr.\", \"John D Rockefeller\", \"John Davison Rockefeller Sr.\", \"John D. Rockefeller I\", \"John D. Rockefeller\", \"Cleveland Massacre\", \"J.D. Rockefeller\", \"J. D. Rockefeller\", \"John Davison Rockefeller\", \"First billionaire\", \"JD Rockefeller\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Pennsylvania and Maryland\"]", "[\"Kodamatic\", \"Kodak Colorburst\", \"Kodak Instant\", \"Polaroid photography\", \"Polaroid camera\", \"Instant camera\", \"Instant photography\", \"Polaroid Camera\"]", "[\"Gheevarghese\", \"Vargheese\", \"Ghevargheese\", \"George (disambiguation)\", \"Ghevarghese\", \"Gheevargheese\", \"George\", \"Vargis\", \"Geroge\", \"George's\", \"GEORGE\"]", "[\"Botanical orchids\", \"Orchid flower\", \"Botanical orchid\", \"Orchidaceae\", \"Orchid Family\", \"Orchird\", \"Orchid family\", \"Orchis family\", \"Orchids\", \"Orchid\"]", "[\"AYE\", \"Keppel Viaduct\", \"Ayer Rajah Expressway\"]", "[\"Alec rose\", \"Alec Rose\"]", "[\"Physical characteristics of Jupiter\", \"Sol 5\", \"Jupiter (astronomy)\", \"Weight of Jupiter\", \"Life on Jupiter\", \"Jupitor\", \"Planet Jupiter\", \"Wood Star\", \"Jupiter (Planet)\", \"Jovian diameter\", \"Jupiter!\", \"JUPITER\", \"Mass of Jupiter\", \"Astronomy Jupiter\", \"Zenography\", \"Jupiter (planet)\", \"Jupiter's\", \"\\u2643\", \"Sol-5\", \"Jovian orbit\", \"The mass of Jupiter\", \"Sun f\", \"Sol f\", \"Jupiter weight\", \"Jupiter(planet)\", \"The weight of Jupiter\", \"Sol V\", \"Jupiter's radio emissions\", \"Jupiter\", \"Jupiter radius\", \"Jupitero\"]", "[\"PEAS\", \"Pisum sativum\", \"Pea plant\", \"Garden pea\", \"Green peas\", \"P. sativum\", \"Peas\", \"Pea\", \"Peascods\", \"Green pea\", \"Green Pea\", \"Field peas\", \"Pea Plants\", \"Pea pod\", \"Pisum sativus\", \"Petit pois\"]", "[\"CLASSIC FM\", \"Classic FM (disambiguation)\", \"Classic FM\", \"ClassicFM\", \"Classic fm\"]", "[\"Bunny boiler\", \"Bunny boiling\", \"I Won't Be Ignored, Dan\", \"Fatal Attraction\", \"Bunny Boiler\"]", "[\"La Corse\", \"Corsica, France\", \"Corsica (Journal)\", \"Cyrnos\", \"Cyrnus\", \"Corsic\", \"Corse\", \"Korsika\", \"CORSICA\", \"Corsica\"]", "[\"Harvard University Crimson\", \"University of Harvard\", \"HARVARD\", \"Harvard University\", \"New College, Cambridge, Massachusetts\", \"Harvard U.\", \"Harvard.edu\", \"Harvard University Department of Psychology\", \"Haravrd\", \"Kremlin on the Charles\", \"Harvard\", \"Harvard University Concord Field Station\", \"Harvard university\", \"Harvard Univ.\", \"New College, Cambridge, MA\", \"Harvard.\", \"Harvard-Radcliffe TV\", \"Harward university\"]", "[\"Englnad\", \"The land of the Angles\", \"Sasainn\", \"England, U.K.\", \"Engla land\", \"England's\", \"Starks Field School\", \"Englaland\", \"English Nation\", \"Ingland\", \"Engelond\", \"Englistan\", \"Languages of England\", \"England, UK\", \"Name of England\", \"Auld enemy\", \"Sasana\", \"England, United Kingdom\", \"\\u00c6ngland\", \"Lloegr\", \"Land of the Angles\", \"Engla rice\", \"Aengland\", \"UK, (England)\", \"\\u00c6nglaland\", \"England\", \"Life in England\", \"Aenglaland\", \"ENGLAND\", \"Anglica\", \"Etymology of England\", \"Pow Sows\", \"\\u00c6ngla land\"]", "[\"Monster fruit\", \"Monstereo\", \"Ceriman\", \"Fruit Salad Plant\", \"Splitleaf philodendron\", \"Monsterio Delicio\", \"Swiss cheese plant\", \"Swiss Cheese Plant\", \"Split leaf philodendron\", \"SWISS CHEESE PLANT\", \"Windowleaf\", \"Monstera deliciosa\", \"Window leaf\", \"Mexican breadfruit\", \"Split-leaf Philodendron\", \"Zampa di leone\"]", "[\"John D. Rockefeller, Sr.\", \"John D Rockefeller\", \"John Davison Rockefeller Sr.\", \"John D. Rockefeller I\", \"John D. Rockefeller\", \"Cleveland Massacre\", \"J.D. Rockefeller\", \"J. D. Rockefeller\", \"John Davison Rockefeller\", \"First billionaire\", \"JD Rockefeller\"]" ]
[ "The Mason-Dixon Line, surveyed by Charles Mason and Jeremiah Dixon, which became a popular name for the dividing line between the slave and free states, is the boundary between which two states of the USA?", "What did Edwin Land invent because of his daughters' wish for instant and 'snappy' results?", "What was the first name of Anglo-Irish statesman and diplomat Downing, who Downing Street in London was named after?", "What kind of flower is a Lady’s Slipper?", "In the House of Commons, which word of three letters is used by members supporting a motion vote?", "Who sailed round the world in the yacht Lively Lady?", "In our solar system which is the largest planet?", "Alaska, Laxton's progress and Mr Big are varieties of what?", "Which national radio station broadcasts between 99.9 and 101.9 Mhz?", "Which role as 'the other woman' won Glenn Close her first Oscar nomination?", "On which Mediterranean Island is the city of Ajaccio?", "Which American University is situated in Cambridge,Massachusetts?", "Who won the Women's Cricket World Cup played at Sydney, Australia, in 2009?", "How is the plant monstera deliciosa better known ?", "What American, founder of the Standard Oil company, was the first American to amass $1 billion, and is generally thought to have been the richest man in history?" ]
15
[ 93735, 93736, 93737, 93738, 93739, 93740, 93741, 93742, 93743, 93744, 93745, 93746, 93747, 93748, 93749 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which country hosted the 1988 Summer Olympic Games?\nQuestion 2: \"The music soundscape of three out of the four \"\"Dirty Harry\"\" films is associated with what Argentine pianist, composer, arranger and conductor?\"\nQuestion 3: \"What Barry Manilow song was about a club that was the \"\"hottest spot north of Havana\"\"?\"\nQuestion 4: Who preceeded Herbert Hoover as President of the USA?\nQuestion 5: The German Deutschmark was comprised of one hundred what?\nQuestion 6: What type of snake is reputed to have been used by Cleopatra when committing suicide?\nQuestion 7: The German Deutschmark was comprised of one hundred what?\nQuestion 8: Which actor took the lead roles in the films, 'Blade Runner', 'The Hitcher', and 'Flesh And Blood'?\nQuestion 9: Panama disease affects which food crop?\nQuestion 10: What is the only ancient wonder of the world that still exists?\nQuestion 11: Who shot PM Spencer Perceval?\nQuestion 12: The American Academy of Arts and Sciences was founded in which city in 1780?\nQuestion 13: What is the name of the part of a sundial that casts the shadow?\nQuestion 14: What is the science of accurate time measurement called?\nQuestion 15: What influential show, which paved the way for the future of cooking shows on TV, was hosted by Julia Child?", "role": "user" } ]
["[\"Nam Chosun\", \"Korea, Republic Of\", \"So. Korea\", \"ISO 3166-1:KR\", \"R.O.K.\", \"Korea, Republic of\", \"Korea, South\", \"Daehan Minguk\", \"Republic Of Korea\", \"S. Korea\", \"R. Korea\", \"South Kroea\", \"South korea\", \"Republican Korea\", \"Korea (R.O.K.)\", \"The republic of korea\", \"Korea South\", \"ROK\", \"Daehanminkook\", \"\\ub0a8\\ud55c\", \"South Korea/Economy\", \"Daehanmingook\", \"Korea (South)\", \"Korea Republic\", \"SKorea\", \"S Korea\", \"\\u97d3\\u570b\", \"South-korea\", \"Republican Corea\", \"Republic of KOREA\", \"Corea Republic\", \"Daehanminkuk\", \"Korea (Republic of)\", \"Republic of korea\", \"Korea (ROK)\", \"South Koreans\", \"Free Korea\", \"Daehanminguk\", \"\\ub300\\ud55c\\ubbfc\\uad6d\", \"South Corea\", \"Modern Corea\", \"South corea\", \"Taehan-min'guk\", \"S.Korea\", \"\\u5927\\u97d3\\u6c11\\u570b\", \"South-Korea\", \"Republic of Corea\", \"S. Koreans\", \"S. Korean\", \"South Korean\", \"Korea (Seoul)\", \"Namjoseon\", \"Republic of Korea\", \"Korea, S\", \"Korean Republic\", \"Republic of South Korea\", \"South Korea\", \"\\ud55c\\uad6d\", \"Corean Republic\"]", "[\"Boris C. Schifrin\", \"B.C. Schifrin\", \"Lalo Schifrin\", \"Boris Claudio Schifrin\", \"B. C. Schifrin\", \"Lalo Schiffrin\"]", "[\"Copacabana\", \"Sacopenap\\u00e3\", \"Sacopenapa\", \"Copa cabana\", \"Copacabana (album)\", \"Copa Cabana\", \"Copacabana (film)\", \"Copaca bana\", \"Copacabana (disambiguation)\"]", "[\"J.C. Coolidge\", \"Calvin Coolidge\", \"John Calvin Coolidge\", \"JOHN CALVIN COOLIDGE\", \"Calvin coolidge\", \"J. Calvin Coolidge\", \"Calvin Coolidge, Jr\", \"Calvin Coolidge Jr.\", \"The business of America is business\", \"Calvin Cooldige\", \"President Calvin Coolidge\", \"Coolidge Administration\", \"Calvin Coolidge, Jr.\", \"John C. Coolidge\", \"Calvin Koolaid\", \"Calvin collidge\", \"John Calvin Coolidge, Jr.\", \"Silent cal\", \"J. Calvin Coolidge, Jr.\", \"John Calvin Coolidge Jr.\", \"Coolidge administration\", \"President Coolidge\", \"Presidency of Calvin Coolidge\", \"30th President of the United States\", \"JC Coolidge\", \"John C. Coolidge, Jr.\", \"John Coolidge, Jr.\"]", "[\"\\u20b0\", \"Pfennig\"]", "[\"An asp\", \"Asp (disambiguation)\", \"Asp (snake)\", \"Asp\", \"The asp\"]", "[\"\\u20b0\", \"Pfennig\"]", "[\"Rutger Oelsen Hauer\", \"All Those Moments\", \"Rutger Hauer\", \"Rutger Haeur\", \"Rutger Hower\", \"RUTGER HAUER\"]", "[\"Banana Trees\", \"Ndisi\", \"Purple bananas\", \"Dessert banana\", \"Banana plant\", \"Banana stalk carving\", \"Banana (fruit)\", \"Banana Tree\", \"Bannanna\", \"\\u0645\\u06c6\\u0632\", \"Banannas\", \"Banana\", \"Chocolate bananas\", \"Banana tree\", \"Banana trade\", \"Bannana\", \"Bananaa\", \"\\ud83c\\udf4c\", \"Bannanas\", \"Nendran banana\", \"Bananna\", \"Bananas\", \"Banana flower\", \"Banana cultivation\", \"Banaan\"]", "[\"Great Pyramid of Gizeh\", \"King's Chamber\", \"Great Pyramid of Giza\", \"Upuaut Project\", \"Great Pyramid of Khufu\", \"Pyramid of Khufu\", \"Gantenbrink's Door\", \"Pyramid of cheops\", \"Great pyramid at Giza\", \"Great Pyramid @ Giza\", \"Pyramid of Giza\", \"Pyramid of giza\", \"Great Pyramid at Giza\", \"The Great Pyramid of Giza\", \"The Great Pyramid\", \"Khufu's Pyramid\", \"The Great Pyramid at Giza\", \"Great pyramid of giza\", \"The Great Pyramid Of Giza\", \"Great Pyramid of Cheops\", \"Lady Arbuthnot's Chamber\", \"Cheop's pyramid\", \"Pyramid of Cheops\", \"Pyramid G1\", \"Great pyramid of Giza\", \"Upuaut-2\", \"Great Pyramid of Kafu\", \"Great Pyramid Of Giza\", \"Great pyramid\", \"Giza Pyramid\"]", "[\"JOHN BELLINGHAM\", \"John Bellingham\"]", "[\"City of Boston\", \"Boston,MA\", \"Economy of Boston\", \"Boston, Massachussets\", \"Boston's\", \"Boston, ma\", \"Boston, Massachusets\", \"Boston Massachusetts\", \"Boston, United States\", \"Wahstoron\\u00f2n:ke\", \"Boston, Massachusetts, USA\", \"Boston Mass\", \"Boston, Massachessets\", \"Boston, Massachussetts\", \"Boston, Massachusetts, US\", \"Bosotn\", \"The weather in Boston\", \"Boston,Massachusetts\", \"Boston, Mass\", \"Boston, Massachusettes\", \"Boston, Massachussettes\", \"Boston, Massachusetts\", \"The hub of the universe\", \"Boston mass\", \"Boston massachusetts\", \"Boston Weather\", \"Beantown\", \"Bofton\", \"Boston, USA\", \"Boston, mass\", \"Education in Boston\", \"Boston ma\", \"Boston, MA\", \"Boston, US\", \"Boston (Mass.)\", \"Boston MA\", \"Demographics of Boston\", \"Geography of Boston\", \"Religion in Boston\", \"Boston (MA)\", \"Capital of Massachusetts\", \"Puritan City\", \"Boston, Massachusetts, United States of America\", \"Politics of Boston\", \"Boston\", \"Boston, Mass.\", \"The Hub of the Universe\", \"Boston, Massachusetts, United States\", \"Bean Town\", \"Bawstun\", \"UN/LOCODE:USBOS\", \"Massachusetts/Boston\"]", "[\"Nomon\", \"Gnomonics\", \"Gnomonist\", \"Gnomon\"]", "[\"Chronometry\", \"Measurement of time\"]", "[\"The French Chef\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Nam Chosun\", \"Korea, Republic Of\", \"So. Korea\", \"ISO 3166-1:KR\", \"R.O.K.\", \"Korea, Republic of\", \"Korea, South\", \"Daehan Minguk\", \"Republic Of Korea\", \"S. Korea\", \"R. Korea\", \"South Kroea\", \"South korea\", \"Republican Korea\", \"Korea (R.O.K.)\", \"The republic of korea\", \"Korea South\", \"ROK\", \"Daehanminkook\", \"\\ub0a8\\ud55c\", \"South Korea/Economy\", \"Daehanmingook\", \"Korea (South)\", \"Korea Republic\", \"SKorea\", \"S Korea\", \"\\u97d3\\u570b\", \"South-korea\", \"Republican Corea\", \"Republic of KOREA\", \"Corea Republic\", \"Daehanminkuk\", \"Korea (Republic of)\", \"Republic of korea\", \"Korea (ROK)\", \"South Koreans\", \"Free Korea\", \"Daehanminguk\", \"\\ub300\\ud55c\\ubbfc\\uad6d\", \"South Corea\", \"Modern Corea\", \"South corea\", \"Taehan-min'guk\", \"S.Korea\", \"\\u5927\\u97d3\\u6c11\\u570b\", \"South-Korea\", \"Republic of Corea\", \"S. Koreans\", \"S. Korean\", \"South Korean\", \"Korea (Seoul)\", \"Namjoseon\", \"Republic of Korea\", \"Korea, S\", \"Korean Republic\", \"Republic of South Korea\", \"South Korea\", \"\\ud55c\\uad6d\", \"Corean Republic\"]", "[\"Boris C. Schifrin\", \"B.C. Schifrin\", \"Lalo Schifrin\", \"Boris Claudio Schifrin\", \"B. C. Schifrin\", \"Lalo Schiffrin\"]", "[\"Copacabana\", \"Sacopenap\\u00e3\", \"Sacopenapa\", \"Copa cabana\", \"Copacabana (album)\", \"Copa Cabana\", \"Copacabana (film)\", \"Copaca bana\", \"Copacabana (disambiguation)\"]", "[\"J.C. Coolidge\", \"Calvin Coolidge\", \"John Calvin Coolidge\", \"JOHN CALVIN COOLIDGE\", \"Calvin coolidge\", \"J. Calvin Coolidge\", \"Calvin Coolidge, Jr\", \"Calvin Coolidge Jr.\", \"The business of America is business\", \"Calvin Cooldige\", \"President Calvin Coolidge\", \"Coolidge Administration\", \"Calvin Coolidge, Jr.\", \"John C. Coolidge\", \"Calvin Koolaid\", \"Calvin collidge\", \"John Calvin Coolidge, Jr.\", \"Silent cal\", \"J. Calvin Coolidge, Jr.\", \"John Calvin Coolidge Jr.\", \"Coolidge administration\", \"President Coolidge\", \"Presidency of Calvin Coolidge\", \"30th President of the United States\", \"JC Coolidge\", \"John C. Coolidge, Jr.\", \"John Coolidge, Jr.\"]", "[\"\\u20b0\", \"Pfennig\"]", "[\"An asp\", \"Asp (disambiguation)\", \"Asp (snake)\", \"Asp\", \"The asp\"]", "[\"\\u20b0\", \"Pfennig\"]", "[\"Rutger Oelsen Hauer\", \"All Those Moments\", \"Rutger Hauer\", \"Rutger Haeur\", \"Rutger Hower\", \"RUTGER HAUER\"]", "[\"Banana Trees\", \"Ndisi\", \"Purple bananas\", \"Dessert banana\", \"Banana plant\", \"Banana stalk carving\", \"Banana (fruit)\", \"Banana Tree\", \"Bannanna\", \"\\u0645\\u06c6\\u0632\", \"Banannas\", \"Banana\", \"Chocolate bananas\", \"Banana tree\", \"Banana trade\", \"Bannana\", \"Bananaa\", \"\\ud83c\\udf4c\", \"Bannanas\", \"Nendran banana\", \"Bananna\", \"Bananas\", \"Banana flower\", \"Banana cultivation\", \"Banaan\"]", "[\"Great Pyramid of Gizeh\", \"King's Chamber\", \"Great Pyramid of Giza\", \"Upuaut Project\", \"Great Pyramid of Khufu\", \"Pyramid of Khufu\", \"Gantenbrink's Door\", \"Pyramid of cheops\", \"Great pyramid at Giza\", \"Great Pyramid @ Giza\", \"Pyramid of Giza\", \"Pyramid of giza\", \"Great Pyramid at Giza\", \"The Great Pyramid of Giza\", \"The Great Pyramid\", \"Khufu's Pyramid\", \"The Great Pyramid at Giza\", \"Great pyramid of giza\", \"The Great Pyramid Of Giza\", \"Great Pyramid of Cheops\", \"Lady Arbuthnot's Chamber\", \"Cheop's pyramid\", \"Pyramid of Cheops\", \"Pyramid G1\", \"Great pyramid of Giza\", \"Upuaut-2\", \"Great Pyramid of Kafu\", \"Great Pyramid Of Giza\", \"Great pyramid\", \"Giza Pyramid\"]", "[\"JOHN BELLINGHAM\", \"John Bellingham\"]", "[\"City of Boston\", \"Boston,MA\", \"Economy of Boston\", \"Boston, Massachussets\", \"Boston's\", \"Boston, ma\", \"Boston, Massachusets\", \"Boston Massachusetts\", \"Boston, United States\", \"Wahstoron\\u00f2n:ke\", \"Boston, Massachusetts, USA\", \"Boston Mass\", \"Boston, Massachessets\", \"Boston, Massachussetts\", \"Boston, Massachusetts, US\", \"Bosotn\", \"The weather in Boston\", \"Boston,Massachusetts\", \"Boston, Mass\", \"Boston, Massachusettes\", \"Boston, Massachussettes\", \"Boston, Massachusetts\", \"The hub of the universe\", \"Boston mass\", \"Boston massachusetts\", \"Boston Weather\", \"Beantown\", \"Bofton\", \"Boston, USA\", \"Boston, mass\", \"Education in Boston\", \"Boston ma\", \"Boston, MA\", \"Boston, US\", \"Boston (Mass.)\", \"Boston MA\", \"Demographics of Boston\", \"Geography of Boston\", \"Religion in Boston\", \"Boston (MA)\", \"Capital of Massachusetts\", \"Puritan City\", \"Boston, Massachusetts, United States of America\", \"Politics of Boston\", \"Boston\", \"Boston, Mass.\", \"The Hub of the Universe\", \"Boston, Massachusetts, United States\", \"Bean Town\", \"Bawstun\", \"UN/LOCODE:USBOS\", \"Massachusetts/Boston\"]", "[\"Nomon\", \"Gnomonics\", \"Gnomonist\", \"Gnomon\"]", "[\"Chronometry\", \"Measurement of time\"]", "[\"The French Chef\"]" ]
[ "Which country hosted the 1988 Summer Olympic Games?", "\"The music soundscape of three out of the four \"\"Dirty Harry\"\" films is associated with what Argentine pianist, composer, arranger and conductor?\"", "\"What Barry Manilow song was about a club that was the \"\"hottest spot north of Havana\"\"?\"", "Who preceeded Herbert Hoover as President of the USA?", "The German Deutschmark was comprised of one hundred what?", "What type of snake is reputed to have been used by Cleopatra when committing suicide?", "The German Deutschmark was comprised of one hundred what?", "Which actor took the lead roles in the films, 'Blade Runner', 'The Hitcher', and 'Flesh And Blood'?", "Panama disease affects which food crop?", "What is the only ancient wonder of the world that still exists?", "Who shot PM Spencer Perceval?", "The American Academy of Arts and Sciences was founded in which city in 1780?", "What is the name of the part of a sundial that casts the shadow?", "What is the science of accurate time measurement called?", "What influential show, which paved the way for the future of cooking shows on TV, was hosted by Julia Child?" ]
15
[ 21600, 21601, 21602, 21603, 21604, 21605, 21606, 21607, 21608, 21609, 21610, 21611, 21612, 21613, 21614 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: During which month of the year does Mexico celebrate its independence from Spain?\nQuestion 2: \"Who said on the morning of her execution \"\"I now know that patriotism is not enough\"\"?\"\nQuestion 3: March Bread is made or flavoured primarily by what?\nQuestion 4: What is the substance made from petroleum used for road surfacing, whose name derives from Greek meaning 'of foreign origin'?\nQuestion 5: What were the Commonwealth Games previously called\nQuestion 6: Which former West Indian fast bowler was nicknamed Whispering Death?\nQuestion 7: Now a prominent part of the advertising world, what color M&Ms were removed from circulation for 9 years during the 1970s, due to a health scare concerning food dye?\nQuestion 8: What beverage did the British Navy stop giving out with rations in 1970?\nQuestion 9: Who's missing: Enterprise, Columbia, Challenger, Discovery, Atlantis\nQuestion 10: On what type of surface is the Wimbledon tournament held?\nQuestion 11: In which century did the Montgolfier brothers succeed in launching the first manned ascent in a hot-air balloon?\nQuestion 12: The meat substitute product Quorn is made from?\nQuestion 13: What is the only New Testament Gospel that is not synoptic?\nQuestion 14: \"Who painted the famous painting known as \"\"The Night Watch\"\"?\"\nQuestion 15: Which member of the crow family has a grey head?", "role": "user" } ]
["[\"Setember\", \"Sept.\", \"7ber\", \"Sep.\", \"September\", \"\\u32c8\", \"Septilis\", \"Spetember\", \"September 31\", \"31 September\", \"Mean Fomhair\", \"Septemer\"]", "[\"Cavell, Edith Louisa\", \"Edith Louisa Cavell\", \"Edith Clavell\", \"The Edith Cavell Nursing Scholarship Fund\", \"Edith Cavell\", \"EDITH CAVELL\"]", "[\"Almond tree\", \"Luz (nut)\", \"Amygdalus amara\", \"Almond oil\", \"Marcona almonds\", \"Mandel (nut)\", \"Badam\", \"Almond Bitter Oil\", \"Prunus dulcis\", \"Almond trees\", \"Amygdalus communis\", \"Almendrado\", \"Amygdalus dulcis\", \"Marcona Almonds\", \"Prunus amygdalus dulcis\", \"Druparia amygdalus\", \"Marcona almond\", \"Marcona Almond\", \"Prunus amygdalus\", \"Almond extract\", \"Amygdalus fragilis\", \"Amygdalus sativa\", \"Baadaam\", \"Oil of bitter almond\", \"Toasted Almond\", \"Oleum amygdalae\", \"Bitter almonds\", \"Sweet almond oil\", \"Almond\", \"\\u0644\\u0648\\u0632\", \"Almonds\", \"Oil of Bitter Almonds\", \"Almond syrup\", \"Bitter almond\"]", "[\"Bitumen feedstock\", \"Rock asphalt\", \"Oiled (road)\", \"Asphalt\", \"Bituminous surfaced\", \"Bitumen\", \"Bituminous\", \"Oiled dirt\", \"Asphelt\", \"Slurry seal\", \"Ashfelt\", \"Oiled road\", \"Mastic roller hybrid\", \"Asphalt emulsion\", \"Asphalts\", \"Natural bitumen\", \"Asphaltum oil wells\", \"Ashphalt\", \"Oil (road)\"]", "[\"Flag of the commonwealth games federation\", \"Commonwealth Games Association\", \"Commenwelth Games\", \"Territories and Nations yet to send teams to the Commonwealth Games\", \"Commonwealth Games Council\", \"Flag of the Commonwealth Games Federation\", \"British Commonwealth Games\", \"Common wealth Games\", \"Commonwealth Games\", \"Empire and Commonwealth Games\", \"British Empire Games\", \"Common wealth games\", \"Commonwealth Games symbols\", \"List of Nations to compete at the Commonwealth Games\", \"British Empire and Commonwealth Games\", \"Commonwelth Games\", \"Empire Games\", \"Commonwealth Games Associations\", \"Commonwealth Summer Games\", \"Common Wealth games\", \"Commonwealth games\"]", "[\"Michael Holding\", \"Mike Holding\"]", "[\"Red (colour)\", \"Rgb(255, 0, 0)\", \"Incarnadining\", \"Rau\\u00f0ur\", \"Incarnadine\", \"Red (political adjective)\", \"FF0000\", \"Red Movement\", \"Red\", \"Red (Colour)\", \"Reddeners\", \"Reddest\", \"Reddened\", \"Redishly\", \"Firebrick red\", \"Reddens\", \"Reddener\", \"Color red\", \"Reddishness\", \"Redly\", \"Aztec red\", \"Red (color)\", \"(255, 0, 0)\", \"Raudur\", \"Color/red\", \"Redest\", \"Redishness\", \"Incarnadined\", \"Incarnadines\", \"Reddishly\", \"List of terms associated with the color red\", \"Redness\"]", "[\"Spiced Rum\", \"Spiced rum\", \"Rum\", \"Gunpowder Rum\", \"Rum (beverage)\", \"White rum\", \"Jamaica Spirits\", \"Ca\\u00f1a blanca\", \"Dark rum\", \"White Rum\", \"Cuban rum\", \"Jamaica Spirit\", \"Gold rum\", \"Cane spirit\", \"Light rum\", \"Black rum\", \"Rude rum\", \"Hard rum\", \"Overproof rum\", \"Coconut rum\"]", "[\"Endeavour\", \"Endeavors\", \"Endeavor (disambiguation)\", \"Endeavour (disambiguation)\", \"Endeavor\", \"Endeavours\"]", "[\"Graminoids\", \"Grass blade\", \"Graminoid\", \"Grasses\", \"Tall Grass\", \"Graminid\", \"Sports turf\", \"Grass\"]", "[\"Eigtheenth century\", \"XVIII Century\", \"Eighteenth-century\", \"18th Century\", \"The 18th century\", \"18th-century\", \"18th century AD\", \"Eighteenth century\", \"18th Century CE\", \"1700's\", \"Timeline of 18th century history\", \"Year in Review 18th Century\", \"18th century\", \"Eighteenth Century\", \"XVIII century\", \"18th century CE\", \"Early 18th century\", \"Late 18th century\"]", "[\"Fungus kingdom\", \"Fungal proteins\", \"Mycetes\", \"Antigens, fungal\", \"Mycetae\", \"Fungus Plants\", \"Fungal growth\", \"Eumycota\", \"Fungus\", \"Funghi\", \"Kingdom fungi\", \"Mycete\", \"Antibodies, fungal\", \"Fugus\", \"Fungi\", \"Mycota\", \"Fungis\", \"Fungii\", \"Multicellular fungi\", \"Fungal\", \"Fungal development\", \"Sexuality of fungi\", \"Fungi kingdom\", \"Eumycetes\"]", "[\"John (disambiguation)\", \"John (European rulers)\", \"%22John%22\", \"John (bishop)\", \"John (song)\", \"John\"]", "[\"Rembrandt\", \"Van Rejn\", \"Rembrandt Harmenszoon van Rijn\", \"Rembrandt van Riji\", \"Rembrandt Harmenzsoon van Rijn\", \"Reimbrond Vainrein\", \"Rembrand van Rijn\", \"Remberandt\", \"Rembrandt Harmenszoon Van Rijn\", \"Rembrant\", \"Rembrandt Harmensz. van Rijn\", \"Rembrandt Harmenszoon van Ryn\", \"Rembrandt van Rijn\", \"Rembrandt Van Rijn\", \"Rembrandt Harmensz van Rijn\", \"Rembrant van Rijn\", \"Rembrand\"]", "[\"Graculus\", \"Eurasian Jackdaw\", \"European Jackdaw\", \"Corvus monedula\", \"Monedula\", \"Eurasian jackdaw\", \"Coloeus monedula\", \"Western jackdaw\", \"Jackdaw\", \"Western Jackdaw\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Setember\", \"Sept.\", \"7ber\", \"Sep.\", \"September\", \"\\u32c8\", \"Septilis\", \"Spetember\", \"September 31\", \"31 September\", \"Mean Fomhair\", \"Septemer\"]", "[\"Cavell, Edith Louisa\", \"Edith Louisa Cavell\", \"Edith Clavell\", \"The Edith Cavell Nursing Scholarship Fund\", \"Edith Cavell\", \"EDITH CAVELL\"]", "[\"Almond tree\", \"Luz (nut)\", \"Amygdalus amara\", \"Almond oil\", \"Marcona almonds\", \"Mandel (nut)\", \"Badam\", \"Almond Bitter Oil\", \"Prunus dulcis\", \"Almond trees\", \"Amygdalus communis\", \"Almendrado\", \"Amygdalus dulcis\", \"Marcona Almonds\", \"Prunus amygdalus dulcis\", \"Druparia amygdalus\", \"Marcona almond\", \"Marcona Almond\", \"Prunus amygdalus\", \"Almond extract\", \"Amygdalus fragilis\", \"Amygdalus sativa\", \"Baadaam\", \"Oil of bitter almond\", \"Toasted Almond\", \"Oleum amygdalae\", \"Bitter almonds\", \"Sweet almond oil\", \"Almond\", \"\\u0644\\u0648\\u0632\", \"Almonds\", \"Oil of Bitter Almonds\", \"Almond syrup\", \"Bitter almond\"]", "[\"Bitumen feedstock\", \"Rock asphalt\", \"Oiled (road)\", \"Asphalt\", \"Bituminous surfaced\", \"Bitumen\", \"Bituminous\", \"Oiled dirt\", \"Asphelt\", \"Slurry seal\", \"Ashfelt\", \"Oiled road\", \"Mastic roller hybrid\", \"Asphalt emulsion\", \"Asphalts\", \"Natural bitumen\", \"Asphaltum oil wells\", \"Ashphalt\", \"Oil (road)\"]", "[\"Flag of the commonwealth games federation\", \"Commonwealth Games Association\", \"Commenwelth Games\", \"Territories and Nations yet to send teams to the Commonwealth Games\", \"Commonwealth Games Council\", \"Flag of the Commonwealth Games Federation\", \"British Commonwealth Games\", \"Common wealth Games\", \"Commonwealth Games\", \"Empire and Commonwealth Games\", \"British Empire Games\", \"Common wealth games\", \"Commonwealth Games symbols\", \"List of Nations to compete at the Commonwealth Games\", \"British Empire and Commonwealth Games\", \"Commonwelth Games\", \"Empire Games\", \"Commonwealth Games Associations\", \"Commonwealth Summer Games\", \"Common Wealth games\", \"Commonwealth games\"]", "[\"Michael Holding\", \"Mike Holding\"]", "[\"Red (colour)\", \"Rgb(255, 0, 0)\", \"Incarnadining\", \"Rau\\u00f0ur\", \"Incarnadine\", \"Red (political adjective)\", \"FF0000\", \"Red Movement\", \"Red\", \"Red (Colour)\", \"Reddeners\", \"Reddest\", \"Reddened\", \"Redishly\", \"Firebrick red\", \"Reddens\", \"Reddener\", \"Color red\", \"Reddishness\", \"Redly\", \"Aztec red\", \"Red (color)\", \"(255, 0, 0)\", \"Raudur\", \"Color/red\", \"Redest\", \"Redishness\", \"Incarnadined\", \"Incarnadines\", \"Reddishly\", \"List of terms associated with the color red\", \"Redness\"]", "[\"Spiced Rum\", \"Spiced rum\", \"Rum\", \"Gunpowder Rum\", \"Rum (beverage)\", \"White rum\", \"Jamaica Spirits\", \"Ca\\u00f1a blanca\", \"Dark rum\", \"White Rum\", \"Cuban rum\", \"Jamaica Spirit\", \"Gold rum\", \"Cane spirit\", \"Light rum\", \"Black rum\", \"Rude rum\", \"Hard rum\", \"Overproof rum\", \"Coconut rum\"]", "[\"Endeavour\", \"Endeavors\", \"Endeavor (disambiguation)\", \"Endeavour (disambiguation)\", \"Endeavor\", \"Endeavours\"]", "[\"Graminoids\", \"Grass blade\", \"Graminoid\", \"Grasses\", \"Tall Grass\", \"Graminid\", \"Sports turf\", \"Grass\"]", "[\"Eigtheenth century\", \"XVIII Century\", \"Eighteenth-century\", \"18th Century\", \"The 18th century\", \"18th-century\", \"18th century AD\", \"Eighteenth century\", \"18th Century CE\", \"1700's\", \"Timeline of 18th century history\", \"Year in Review 18th Century\", \"18th century\", \"Eighteenth Century\", \"XVIII century\", \"18th century CE\", \"Early 18th century\", \"Late 18th century\"]", "[\"Fungus kingdom\", \"Fungal proteins\", \"Mycetes\", \"Antigens, fungal\", \"Mycetae\", \"Fungus Plants\", \"Fungal growth\", \"Eumycota\", \"Fungus\", \"Funghi\", \"Kingdom fungi\", \"Mycete\", \"Antibodies, fungal\", \"Fugus\", \"Fungi\", \"Mycota\", \"Fungis\", \"Fungii\", \"Multicellular fungi\", \"Fungal\", \"Fungal development\", \"Sexuality of fungi\", \"Fungi kingdom\", \"Eumycetes\"]", "[\"John (disambiguation)\", \"John (European rulers)\", \"%22John%22\", \"John (bishop)\", \"John (song)\", \"John\"]", "[\"Rembrandt\", \"Van Rejn\", \"Rembrandt Harmenszoon van Rijn\", \"Rembrandt van Riji\", \"Rembrandt Harmenzsoon van Rijn\", \"Reimbrond Vainrein\", \"Rembrand van Rijn\", \"Remberandt\", \"Rembrandt Harmenszoon Van Rijn\", \"Rembrant\", \"Rembrandt Harmensz. van Rijn\", \"Rembrandt Harmenszoon van Ryn\", \"Rembrandt van Rijn\", \"Rembrandt Van Rijn\", \"Rembrandt Harmensz van Rijn\", \"Rembrant van Rijn\", \"Rembrand\"]", "[\"Graculus\", \"Eurasian Jackdaw\", \"European Jackdaw\", \"Corvus monedula\", \"Monedula\", \"Eurasian jackdaw\", \"Coloeus monedula\", \"Western jackdaw\", \"Jackdaw\", \"Western Jackdaw\"]" ]
[ "During which month of the year does Mexico celebrate its independence from Spain?", "\"Who said on the morning of her execution \"\"I now know that patriotism is not enough\"\"?\"", "March Bread is made or flavoured primarily by what?", "What is the substance made from petroleum used for road surfacing, whose name derives from Greek meaning 'of foreign origin'?", "What were the Commonwealth Games previously called", "Which former West Indian fast bowler was nicknamed Whispering Death?", "Now a prominent part of the advertising world, what color M&Ms were removed from circulation for 9 years during the 1970s, due to a health scare concerning food dye?", "What beverage did the British Navy stop giving out with rations in 1970?", "Who's missing: Enterprise, Columbia, Challenger, Discovery, Atlantis", "On what type of surface is the Wimbledon tournament held?", "In which century did the Montgolfier brothers succeed in launching the first manned ascent in a hot-air balloon?", "The meat substitute product Quorn is made from?", "What is the only New Testament Gospel that is not synoptic?", "\"Who painted the famous painting known as \"\"The Night Watch\"\"?\"", "Which member of the crow family has a grey head?" ]
15
[ 91830, 91831, 91832, 91833, 91834, 91835, 91836, 91837, 91838, 91839, 91840, 91841, 91842, 91843, 91844 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Seoul is the capital of South Korea. What is the capital of North Korea?\nQuestion 2: What city is the seat of the Netherlands' government?\nQuestion 3: Daniel Deronda was the last novel written by which English novelist?\nQuestion 4: Which French river flows into the sea at St. Nazaire and is famous for its chateaux?\nQuestion 5: Who was the first head of the Church of England?\nQuestion 6: Who once enjoyed eating human liver, fava beans, and a nice chianti?\nQuestion 7: By what name is the steam locomotive wheel arrangement of 4-6-2 known?\nQuestion 8: Which influential author of Economics: An Introductory Analysis, the largest-selling economics textbook of all time is also the first American to win the Nobel Prize for Economics?\nQuestion 9: Born on June 20, 1924, what fifth grade dropout went on to become the most decorated American soldier of WWII, before launching a successful movie career?\nQuestion 10: Which member of the trio ZZ Top does not have a chest-length beard, only a trimmed mustache?\nQuestion 11: What is it called when all the pins fall on the first bowl of an Indoor Bowling game ?\nQuestion 12: In 1964 who became the first black actor to win an Academy Award in the category ‘Best Actor in a leading Role’?\nQuestion 13: Which of Henry VIII wives haunts Hever Castle?\nQuestion 14: Zola Budd became famous as what?\nQuestion 15: How many carbon atoms make up a benzene molecule?", "role": "user" } ]
["[\"Pyonyang, Korea\", \"P\\u2019yongyang\", \"Piongyang\", \"\\ud3c9\\uc591\", \"Phiyang\", \"Kim Il-Sung City\", \"Pyungyang\", \"P\\u2019y\\u01d2ngyang\", \"Pyeong-yang\", \"Phyeongyang\", \"Pyong-yang\", \"Pkhenyan\", \"Pjongjang\", \"Pyeongyang Municipality\", \"Peyongyang\", \"Piarna\", \"Pyongyang's\", \"PyungYang\", \"Jerusalem of the East\", \"Pingrang\", \"P\\u00b4yongyang-si\", \"Pyongyang, Korea\", \"Pyeongyang\", \"Yyongyang\", \"Autonomous City of Pyeongyang\", \"Pyongyang-si\", \"Pyong Yang\", \"P'yongyang\", \"Pyeongyang Autonomous City\", \"Capital of North Korea\", \"PyongYang\", \"Heij\\u014d\", \"Phyengyang\", \"Sogyong\", \"Phy\\u014fngyang\", \"Pyongynag\", \"Municipality of Pyeongyang\", \"Pyonyang, North Korea\", \"P\\u2019y\\u014fngyang\", \"Pyongyang, North Korea\", \"P'y\\u014fngyang\", \"Pchjongjang\", \"P'y\\u014fngyang-si\", \"Pyongyang\", \"City of Pyeongyang\", \"Heijo\", \"S\\u014fgyong\", \"Phyongyang\", \"\\u5e73\\u58e4\"]", "[\"The hague\", \"Hague, Netherlands\", \"The Hauge\", \"UN/LOCODE:NLHAG\", \"'s-Gravenhage\", \"The haig\", \"Hague, The\", \"Den hague\", \"S%60Gravenshage\", \"Lahey\", \"S-Gravenhage\", \"'s Gravenhage\", \"Hague\", \"Den Hagg\", \"\\u2019s-Gravenhage\", \"Den Haag\", \"The Hague, Netherlands\", \"The Hague\", \"Gravenhage\", \"The Hague, The Netherlands\", \"Municipality of The Hague\", \"Den haag\"]", "[\"Mary Ann Evans\", \"Eliot, George\", \"Mary Ann Cross\", \"GEORGE ELIOT\", \"G. Eliot\", \"Marian Evans\", \"Mrs Cross\", \"George Eliot\", \"George (Marian Evans) Eliot\"]", "[\"River Loire\", \"Luara\", \"Montbrisn, Loire\", \"Montbrisn\", \"Loire River\", \"D\\u00e9partment of the Loire\", \"Loire (river)\", \"La Loire\", \"Loire river\", \"The Loire River\", \"Loire River (France)\", \"Loira\", \"The longest river in France\", \"Loire\"]", "[\"Henry VIII\", \"King henry 8\", \"King henry the eighth\", \"Henry viii of england\", \"Henry VIII the Musician\", \"King Henry VIII\", \"HenryVIII\", \"Henry VIII, King of England\", \"Henry the VIII\", \"Henry VIIi\", \"Heinrich VIII\", \"Ehnry viii\", \"Henry VIII of England\", \"Henry VIII, of England\", \"Henry VIII kids\", \"Henry VIII Tudor\", \"Henry 8\", \"Henry VIII of Ireland\", \"Henry Tudor VIII\", \"Henry viii\", \"Henry the Eighth\", \"King of England Henry VIII\", \"The Early Years of Henry VIII\", \"Bluff King Hal\", \"Henry, Duke of York\", \"Henry the eighth\", \"Henry the 8th\", \"King Henry VIII of England\", \"Henry \\u2167\", \"Henry 8th\", \"Henry VIII (England)\", \"King henry viii of england\", \"My Great Matter\", \"Henry VIII's compositions\", \"Bluff Hal\"]", "[\"Chesapeake ripper\", \"Hannibel lector\", \"Hannibal Lecter\", \"Hannibal Lector\", \"Hanibal Lecter\", \"Hannibel lecter\", \"Dr Lector\", \"Dr. Hannibal Lecktor\", \"Lecter\", \"Lecktor\", \"Alfredo Ball\\u00ed Trevi\\u00f1o\", \"Dr. Hannibal Lector\", \"Dr. Hannibal Lecter\", \"Chesapeake Ripper\", \"Dr. Gideon Quinn\", \"Hannibal Lecktor\", \"Hannibal the Cannibal\", \"Hannibal lecter\", \"Hannibal Letcher\", \"Dr. lecter\", \"Gideon Quinn\"]", "[\"Pacific Basin\", \"Oceanum pacificum\", \"Sea of Magellan\", \"Pacific region\", \"PAcific\", \"North Pacific Ocean\", \"Peaceful sea\", \"Eastern Pacific Ocean\", \"Mar del Sur\", \"South-Western Pacific\", \"West Pacific\", \"Eastern Pacific\", \"South Pacific Ocean\", \"North Pacific ocean\", \"South-western Pacific\", \"Pacific Ocean\", \"North Pacific fisheries\", \"Western Pacific Ocean\", \"Southern Pacific Ocean\", \"Pacific (ocean)\", \"Pacific basin\", \"Pacific Oceans\", \"North Pacific\", \"Pacific ocean\", \"Mid-Pacific\", \"Great South Sea\", \"Pacific\", \"Tepre Pacificum\", \"East Pacific\"]", "[\"PAUL SAMUELSON\", \"Samuelson, Paul Anthony\", \"P. samuelson\", \"Paul Samuelson\", \"Paul A Samuelson\", \"P. A. Samuelson\", \"Paul A. Samuelson\", \"Paul Anthony Samuelson\"]", "[\"Audie Murphy\", \"Audie Murphey\", \"Lt. Audie Murphy\", \"Audie L. Murphy\", \"Audie murphy legacy\", \"Audie Leon Murphy\", \"Audie Murphy legacy\"]", "[\"Frank Beard (drums and percussion)\"]", "[\"Striking\", \"Strikes\", \"STRIKE\", \"Strike\", \"Strike (film)\", \"Strike (disambiguation)\"]", "[\"Sidney poitier\", \"Sidney Potier\", \"Sydney poitier\", \"Sidney Poritier\", \"Sidney Portier\", \"Sidney Poitier\"]", "[\"Anne Boylen\", \"ANNE BOLEYN\", \"Anne Bullen\", \"Anne boelyn\", \"Anne Boullant\", \"Ann Boleyn\", \"Anne Boleyn, 1st Marchioness of Pembroke\", \"Anne Boelyn\", \"Ann Bullen\", \"Anne Boleyn\", \"Anna Bollina\", \"Queen Anne Boleyn\", \"Anne Bolyn\", \"Anne boleyn\", \"Anne bolyn\"]", "[\"Athelete\", \"Athlete (track and field)\", \"All-around athlete\", \"Sportsperson\", \"Athlete (athletics)\", \"Athletes\", \"Sports woman\", \"Sports player\", \"Sportspeople\", \"Athlete\", \"Afflete\", \"Sport star\", \"Sports person\", \"Sportswomen\", \"Sportspersons\", \"Athlet\\u00e6\", \"Sportswoman\", \"Athlete (sports)\", \"Sports star\", \"Sportsmen\", \"Sports personality\", \"Sports man\"]", "[\"Six\", \"six\", \"6\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Pyonyang, Korea\", \"P\\u2019yongyang\", \"Piongyang\", \"\\ud3c9\\uc591\", \"Phiyang\", \"Kim Il-Sung City\", \"Pyungyang\", \"P\\u2019y\\u01d2ngyang\", \"Pyeong-yang\", \"Phyeongyang\", \"Pyong-yang\", \"Pkhenyan\", \"Pjongjang\", \"Pyeongyang Municipality\", \"Peyongyang\", \"Piarna\", \"Pyongyang's\", \"PyungYang\", \"Jerusalem of the East\", \"Pingrang\", \"P\\u00b4yongyang-si\", \"Pyongyang, Korea\", \"Pyeongyang\", \"Yyongyang\", \"Autonomous City of Pyeongyang\", \"Pyongyang-si\", \"Pyong Yang\", \"P'yongyang\", \"Pyeongyang Autonomous City\", \"Capital of North Korea\", \"PyongYang\", \"Heij\\u014d\", \"Phyengyang\", \"Sogyong\", \"Phy\\u014fngyang\", \"Pyongynag\", \"Municipality of Pyeongyang\", \"Pyonyang, North Korea\", \"P\\u2019y\\u014fngyang\", \"Pyongyang, North Korea\", \"P'y\\u014fngyang\", \"Pchjongjang\", \"P'y\\u014fngyang-si\", \"Pyongyang\", \"City of Pyeongyang\", \"Heijo\", \"S\\u014fgyong\", \"Phyongyang\", \"\\u5e73\\u58e4\"]", "[\"The hague\", \"Hague, Netherlands\", \"The Hauge\", \"UN/LOCODE:NLHAG\", \"'s-Gravenhage\", \"The haig\", \"Hague, The\", \"Den hague\", \"S%60Gravenshage\", \"Lahey\", \"S-Gravenhage\", \"'s Gravenhage\", \"Hague\", \"Den Hagg\", \"\\u2019s-Gravenhage\", \"Den Haag\", \"The Hague, Netherlands\", \"The Hague\", \"Gravenhage\", \"The Hague, The Netherlands\", \"Municipality of The Hague\", \"Den haag\"]", "[\"Mary Ann Evans\", \"Eliot, George\", \"Mary Ann Cross\", \"GEORGE ELIOT\", \"G. Eliot\", \"Marian Evans\", \"Mrs Cross\", \"George Eliot\", \"George (Marian Evans) Eliot\"]", "[\"River Loire\", \"Luara\", \"Montbrisn, Loire\", \"Montbrisn\", \"Loire River\", \"D\\u00e9partment of the Loire\", \"Loire (river)\", \"La Loire\", \"Loire river\", \"The Loire River\", \"Loire River (France)\", \"Loira\", \"The longest river in France\", \"Loire\"]", "[\"Henry VIII\", \"King henry 8\", \"King henry the eighth\", \"Henry viii of england\", \"Henry VIII the Musician\", \"King Henry VIII\", \"HenryVIII\", \"Henry VIII, King of England\", \"Henry the VIII\", \"Henry VIIi\", \"Heinrich VIII\", \"Ehnry viii\", \"Henry VIII of England\", \"Henry VIII, of England\", \"Henry VIII kids\", \"Henry VIII Tudor\", \"Henry 8\", \"Henry VIII of Ireland\", \"Henry Tudor VIII\", \"Henry viii\", \"Henry the Eighth\", \"King of England Henry VIII\", \"The Early Years of Henry VIII\", \"Bluff King Hal\", \"Henry, Duke of York\", \"Henry the eighth\", \"Henry the 8th\", \"King Henry VIII of England\", \"Henry \\u2167\", \"Henry 8th\", \"Henry VIII (England)\", \"King henry viii of england\", \"My Great Matter\", \"Henry VIII's compositions\", \"Bluff Hal\"]", "[\"Chesapeake ripper\", \"Hannibel lector\", \"Hannibal Lecter\", \"Hannibal Lector\", \"Hanibal Lecter\", \"Hannibel lecter\", \"Dr Lector\", \"Dr. Hannibal Lecktor\", \"Lecter\", \"Lecktor\", \"Alfredo Ball\\u00ed Trevi\\u00f1o\", \"Dr. Hannibal Lector\", \"Dr. Hannibal Lecter\", \"Chesapeake Ripper\", \"Dr. Gideon Quinn\", \"Hannibal Lecktor\", \"Hannibal the Cannibal\", \"Hannibal lecter\", \"Hannibal Letcher\", \"Dr. lecter\", \"Gideon Quinn\"]", "[\"Pacific Basin\", \"Oceanum pacificum\", \"Sea of Magellan\", \"Pacific region\", \"PAcific\", \"North Pacific Ocean\", \"Peaceful sea\", \"Eastern Pacific Ocean\", \"Mar del Sur\", \"South-Western Pacific\", \"West Pacific\", \"Eastern Pacific\", \"South Pacific Ocean\", \"North Pacific ocean\", \"South-western Pacific\", \"Pacific Ocean\", \"North Pacific fisheries\", \"Western Pacific Ocean\", \"Southern Pacific Ocean\", \"Pacific (ocean)\", \"Pacific basin\", \"Pacific Oceans\", \"North Pacific\", \"Pacific ocean\", \"Mid-Pacific\", \"Great South Sea\", \"Pacific\", \"Tepre Pacificum\", \"East Pacific\"]", "[\"PAUL SAMUELSON\", \"Samuelson, Paul Anthony\", \"P. samuelson\", \"Paul Samuelson\", \"Paul A Samuelson\", \"P. A. Samuelson\", \"Paul A. Samuelson\", \"Paul Anthony Samuelson\"]", "[\"Audie Murphy\", \"Audie Murphey\", \"Lt. Audie Murphy\", \"Audie L. Murphy\", \"Audie murphy legacy\", \"Audie Leon Murphy\", \"Audie Murphy legacy\"]", "[\"Frank Beard (drums and percussion)\"]", "[\"Striking\", \"Strikes\", \"STRIKE\", \"Strike\", \"Strike (film)\", \"Strike (disambiguation)\"]", "[\"Sidney poitier\", \"Sidney Potier\", \"Sydney poitier\", \"Sidney Poritier\", \"Sidney Portier\", \"Sidney Poitier\"]", "[\"Anne Boylen\", \"ANNE BOLEYN\", \"Anne Bullen\", \"Anne boelyn\", \"Anne Boullant\", \"Ann Boleyn\", \"Anne Boleyn, 1st Marchioness of Pembroke\", \"Anne Boelyn\", \"Ann Bullen\", \"Anne Boleyn\", \"Anna Bollina\", \"Queen Anne Boleyn\", \"Anne Bolyn\", \"Anne boleyn\", \"Anne bolyn\"]", "[\"Athelete\", \"Athlete (track and field)\", \"All-around athlete\", \"Sportsperson\", \"Athlete (athletics)\", \"Athletes\", \"Sports woman\", \"Sports player\", \"Sportspeople\", \"Athlete\", \"Afflete\", \"Sport star\", \"Sports person\", \"Sportswomen\", \"Sportspersons\", \"Athlet\\u00e6\", \"Sportswoman\", \"Athlete (sports)\", \"Sports star\", \"Sportsmen\", \"Sports personality\", \"Sports man\"]", "[\"Six\", \"six\", \"6\"]" ]
[ "Seoul is the capital of South Korea. What is the capital of North Korea?", "What city is the seat of the Netherlands' government?", "Daniel Deronda was the last novel written by which English novelist?", "Which French river flows into the sea at St. Nazaire and is famous for its chateaux?", "Who was the first head of the Church of England?", "Who once enjoyed eating human liver, fava beans, and a nice chianti?", "By what name is the steam locomotive wheel arrangement of 4-6-2 known?", "Which influential author of Economics: An Introductory Analysis, the largest-selling economics textbook of all time is also the first American to win the Nobel Prize for Economics?", "Born on June 20, 1924, what fifth grade dropout went on to become the most decorated American soldier of WWII, before launching a successful movie career?", "Which member of the trio ZZ Top does not have a chest-length beard, only a trimmed mustache?", "What is it called when all the pins fall on the first bowl of an Indoor Bowling game ?", "In 1964 who became the first black actor to win an Academy Award in the category ‘Best Actor in a leading Role’?", "Which of Henry VIII wives haunts Hever Castle?", "Zola Budd became famous as what?", "How many carbon atoms make up a benzene molecule?" ]
15
[ 71055, 71056, 71057, 71058, 71059, 71060, 71061, 71062, 71063, 71064, 71065, 71066, 71067, 71068, 71069 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: \"Which hairdresser said, \"\"\"\"The only place where success comes before work is in the dictionary?\"\"\"\nQuestion 2: What is the better known name of the Mawlawi followers of Sufism who are known for their 'rotating' motion during a ceremony called Seema?\nQuestion 3: What is the fruit of the Phoenix genus of plants?\nQuestion 4: What boxer, nicknamed Boom Boom, faced off against Duk Koo Kim in 1982, earning the TKO in the 14th round, and it ended with Kim lapsing into a coma before dying 4 days later?\nQuestion 5: Jon Voight, Burt Reynolds, Ned Beatty and Ronny Cox play four friends in which 1972 film?\nQuestion 6: Which 2002 Martin Scorsese film, set in the Five Points district, is loosely based on a 1928 novel by Herbert Asbury?\nQuestion 7: How many square yards in a UK acre?\nQuestion 8: Which company originally produced the 'Matchbox' series of die cast toys?\nQuestion 9: How many furlongs in a mile?\nQuestion 10: ‘The Perfect Year’ and ‘Surrender’ are songs from which musical?\nQuestion 11: Who founded the Kelmscott Press in 1891?\nQuestion 12: What term is used to describe a wine with bold, brash and audacious flavours?\nQuestion 13: Which modern day country was known as Northern Rhodesia until 1964?\nQuestion 14: Pogonology is the study of what?\nQuestion 15: Morbilli is the technical term for which childhood illness?", "role": "user" } ]
["[\"Vidal sasson\", \"Vidal Sassoon: The Movie\", \"Vidal Sasoon\", \"Vidal Sassoon\", \"Vidal sassoon\"]", "[\"Mevlevi\", \"The whirling dervishes\", \"Dancing dervishes\", \"Mevlevi Order\", \"Mawlawi Order\", \"Mawlawiya\", \"Whirling dervishes\", \"Mawlawiyah\", \"Whirling Dervishes\", \"Mawlawiyyah\", \"Whirling dervish\", \"Whirling Dervish\"]", "[\"Dates\", \"Discovery date\", \"Date (disambiguation)\", \"Date\", \"D.A.T.E.\", \"Dated\", \"DATE\"]", "[\"Ray Mancini\", \"Ray 'Boom-Boom' Mancini\", \"Ray Boom-Boom' Mancini\", \"Boom Boom Mancini\"]", "[\"Bobby Trippe\", \"Lewis Medlock\", \"Drew Ballinger\", \"Deliverance\", \"Deliverance (1972 film)\"]", "[\"Gangs of New York\", \"Bill Cutting\", \"GangsofNewYork\", \"Gangs of new york\", \"Gangs Of New York\", \"The gangs of new york\", \"William %22Bill the Butcher%22 Cutting\", \"The Gangs of New York\", \"Gangs of NewYork\", \"Bill %22the Butcher%22 Cutting\", \"Amsterdam Vallon\", \"The Gangs Of New York\"]", "[\"4,840\", \"4840\", \"four thousand, eight hundred and forty\"]", "[\"Lesney\", \"Lesney Products\"]", "[\"8\", \"eight\", \"Eight\"]", "[\"West Sunset Boulevard\", \"SUNSET BOULEVARD\", \"Sunset Boulevard\", \"Sunset Blvd.\", \"Sunset Blvd\", \"Sunset Bulevard\"]", "[\"William Morris\", \"Kelmscott Press\", \"W. Morris\", \"William morris\", \"WILLIAM MORRIS\", \"Kelmscott Chaucer\", \"Morris, William\"]", "[\"Sassy\", \"Sassy (musician)\", \"Sassy (disambiguation)\"]", "[\"Zamibia\", \"People of Zambia\", \"Zambian cuisine\", \"Zambians\", \"Culture of Zambia\", \"Etymology of Zambia\", \"Zambia\", \"Health care in Zambia\", \"ISO 3166-1:ZM\", \"Republic Of Zambia\", \"Cuisine of Zambia\", \"Sport in Zambia\", \"ZAMBIA\", \"Republic of Zambia\", \"Zambian people\", \"Name of Zambia\"]", "[\"Beard\", \"Bearded\", \"Neard\", \"Manbeard\", \"BEARDS\", \"Pogonology\", \"Full beard\", \"Neckbeard\", \"\\u0627\\u0644\\u0631\\u062c\\u0644 \\u0628\\u0644\\u0627 \\u0634\\u0646\\u0628 \\u0643\\u0627\\u0644\\u0642\\u0637 \\u0628\\u0644\\u0627 \\u0630\\u0646\\u0628\", \"Neck beard\", \"Neck hair\", \"Beards\", \"Bearded people\", \"Five o'clock shadow\"]", "[\"Measles\", \"Measels\", \"Red measles\", \"First disease\", \"Morbilli\", \"Rubeola\", \"Measle\", \"Morbille\", \"Giant cell pneumonia\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Vidal sasson\", \"Vidal Sassoon: The Movie\", \"Vidal Sasoon\", \"Vidal Sassoon\", \"Vidal sassoon\"]", "[\"Mevlevi\", \"The whirling dervishes\", \"Dancing dervishes\", \"Mevlevi Order\", \"Mawlawi Order\", \"Mawlawiya\", \"Whirling dervishes\", \"Mawlawiyah\", \"Whirling Dervishes\", \"Mawlawiyyah\", \"Whirling dervish\", \"Whirling Dervish\"]", "[\"Dates\", \"Discovery date\", \"Date (disambiguation)\", \"Date\", \"D.A.T.E.\", \"Dated\", \"DATE\"]", "[\"Ray Mancini\", \"Ray 'Boom-Boom' Mancini\", \"Ray Boom-Boom' Mancini\", \"Boom Boom Mancini\"]", "[\"Bobby Trippe\", \"Lewis Medlock\", \"Drew Ballinger\", \"Deliverance\", \"Deliverance (1972 film)\"]", "[\"Gangs of New York\", \"Bill Cutting\", \"GangsofNewYork\", \"Gangs of new york\", \"Gangs Of New York\", \"The gangs of new york\", \"William %22Bill the Butcher%22 Cutting\", \"The Gangs of New York\", \"Gangs of NewYork\", \"Bill %22the Butcher%22 Cutting\", \"Amsterdam Vallon\", \"The Gangs Of New York\"]", "[\"4,840\", \"4840\", \"four thousand, eight hundred and forty\"]", "[\"Lesney\", \"Lesney Products\"]", "[\"8\", \"eight\", \"Eight\"]", "[\"West Sunset Boulevard\", \"SUNSET BOULEVARD\", \"Sunset Boulevard\", \"Sunset Blvd.\", \"Sunset Blvd\", \"Sunset Bulevard\"]", "[\"William Morris\", \"Kelmscott Press\", \"W. Morris\", \"William morris\", \"WILLIAM MORRIS\", \"Kelmscott Chaucer\", \"Morris, William\"]", "[\"Sassy\", \"Sassy (musician)\", \"Sassy (disambiguation)\"]", "[\"Zamibia\", \"People of Zambia\", \"Zambian cuisine\", \"Zambians\", \"Culture of Zambia\", \"Etymology of Zambia\", \"Zambia\", \"Health care in Zambia\", \"ISO 3166-1:ZM\", \"Republic Of Zambia\", \"Cuisine of Zambia\", \"Sport in Zambia\", \"ZAMBIA\", \"Republic of Zambia\", \"Zambian people\", \"Name of Zambia\"]", "[\"Beard\", \"Bearded\", \"Neard\", \"Manbeard\", \"BEARDS\", \"Pogonology\", \"Full beard\", \"Neckbeard\", \"\\u0627\\u0644\\u0631\\u062c\\u0644 \\u0628\\u0644\\u0627 \\u0634\\u0646\\u0628 \\u0643\\u0627\\u0644\\u0642\\u0637 \\u0628\\u0644\\u0627 \\u0630\\u0646\\u0628\", \"Neck beard\", \"Neck hair\", \"Beards\", \"Bearded people\", \"Five o'clock shadow\"]", "[\"Measles\", \"Measels\", \"Red measles\", \"First disease\", \"Morbilli\", \"Rubeola\", \"Measle\", \"Morbille\", \"Giant cell pneumonia\"]" ]
[ "\"Which hairdresser said, \"\"\"\"The only place where success comes before work is in the dictionary?\"\"\"", "What is the better known name of the Mawlawi followers of Sufism who are known for their 'rotating' motion during a ceremony called Seema?", "What is the fruit of the Phoenix genus of plants?", "What boxer, nicknamed Boom Boom, faced off against Duk Koo Kim in 1982, earning the TKO in the 14th round, and it ended with Kim lapsing into a coma before dying 4 days later?", "Jon Voight, Burt Reynolds, Ned Beatty and Ronny Cox play four friends in which 1972 film?", "Which 2002 Martin Scorsese film, set in the Five Points district, is loosely based on a 1928 novel by Herbert Asbury?", "How many square yards in a UK acre?", "Which company originally produced the 'Matchbox' series of die cast toys?", "How many furlongs in a mile?", "‘The Perfect Year’ and ‘Surrender’ are songs from which musical?", "Who founded the Kelmscott Press in 1891?", "What term is used to describe a wine with bold, brash and audacious flavours?", "Which modern day country was known as Northern Rhodesia until 1964?", "Pogonology is the study of what?", "Morbilli is the technical term for which childhood illness?" ]
15
[ 125925, 125926, 125927, 125928, 125929, 125930, 125931, 125932, 125933, 125934, 125935, 125936, 125937, 125938, 125939 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which group in 1994 released the live Album “Hell Freezes Over”?\nQuestion 2: The 2004 film 'The Aviator' starring Leonardo DiCaprio is a biopic of whom?\nQuestion 3: Which explorer discovered the Victoria falls on the River Zambezi?\nQuestion 4: Humus refers to the component in soil (earth) that is?\nQuestion 5: Which bank acquired the Woolwich Building Society in 2000?\nQuestion 6: What was Gulliver's ship called\nQuestion 7: Hydref is Welsh for which month of the year?\nQuestion 8: In the nursery rhyme, who saw the sparrow kill Cock Robin?\nQuestion 9: Which reality TV show was won by MC Harvey, Azra Akin and Terri Dwyer in 2003, and by Jarrod Batchelor, Shane Lynch and Lady Isabella Hervey in 2004?\nQuestion 10: In what modern-day country was the Second Boer War fought?\nQuestion 11: What is the more common name of the medical condition 'Otalgia'?\nQuestion 12: Brothers Harry, Samuel, Albert and Jack established which film company in 1923?\nQuestion 13: 'Stag' and 'Carib' beers are made in which country?\nQuestion 14: In golf the no 10 iron is usually called what?\nQuestion 15: Who created the comic strip ‘Blondie’, published in newspapers since 1930?", "role": "user" } ]
["[\"Eagle\", \"Aquilinae\", \"King of the Air\", \"King of the air\", \"Booted eagles (group)\", \"Kitpu\", \"Hawk eagle\", \"Eagle Spirit\", \"Eagle (symbolism)\", \"Eagles\", \"THE EAGLES\", \"Harpy (zoology)\", \"Hawk-eagle\"]", "[\"Citizen Hughes: The Power, the Money, and the Madness\", \"Howard Robard Hughes\", \"Howard Hughs\", \"Howard R. Hughes\", \"Howard Hughes\", \"Howard R. Hughes, Jr.\", \"William L. Durkin\", \"Howard hughes\", \"HOWARD HUGHES\", \"Howard Robard Hughes, Jr.\"]", "[\"Doctor Livingstone\", \"Dr. Livingston\", \"Dr. Livingstone, I presume%3F\", \"Livingstone, David\", \"David Livingstone\", \"Livingstone's Heart\", \"Livingstone, Dr.\", \"Dr. Livingstone\", \"Dr Livingstone\", \"D Livingstone\"]", "[\"Decomposed organic matter\"]", "[\"BARCLAYS PLC\", \"Barclay's Bank\", \"Barclays PLC (ADR)\", \"Barclays Bank\", \"Barclays Group US\", \"Barclay\\u2019s Bank\", \"Barclay Bank\", \"Barclays (DCO)\", \"Barclays, plc\", \"Barclay & Co.\", \"Barclays PLC\", \"Barclays American\", \"Barclays Bank Ltd\", \"Barclay's bank\", \"BarclaysAmerican\", \"Barclays Stockbrokers\", \"Barclays Bank of Delaware\", \"Barclays DCO\", \"Barclays Bank PLC\", \"Barclay's\", \"Barclays Bank Plc\", \"Barclays plc\", \"Barclays Plc\", \"Barclays Bank (DCO)\", \"Barclays Ventures\", \"Barclays.co.uk\", \"Barclays GEMS Asia-8 ETN\", \"Barclays Bank, PLC\", \"Barclays Bank International Limited\", \"Barclays Bank (Dominion, Colonial and Overseas)\", \"Barclays bank\", \"Barclays\", \"Barclays Bank plc\"]", "[\"Botswanan Antelopes\", \"Antelope\", \"Antilopina\", \"Antelopes\", \"Hybrid antelope\"]", "[\"Ocotber\", \"October\", \"8ber\", \"\\u32c9\", \"Oct.\", \"Roctober\"]", "[\"The Fly (film)\", \"Humanoid fly\", \"The Fly\", \"The Fly (disambiguation)\", \"The Fly (comics)\", \"The fly\"]", "[\"The Game(song)\", \"The game\", \"The Game (college football)\", \"The Game (television show)\", \"The Game (film)\", \"The Game (TV show)\", \"The Game (Song)\", \"The Game (novel)\", \"The Game (disambiguation)\", \"TheGame\", \"The Game (album)\", \"The Game (TV Show)\", \"The Games\", \"The Game (song)\", \"The Game (book)\", \"El Juego\", \"The game (disambiguation)\", \"The Game film\", \"The Game (movie)\", \"The game (film)\", \"The Game\", \"The Game (TV series)\", \"The game disambiguation\", \"%22The Game%22\", \"The Games (TV series)\"]", "[\"South africa\", \"South Africa's\", \"Southafrica\", \"Third Republic (South Africa)\", \"Republiek van Suid-Afrika\", \"Sou'frica\", \"Zuid Afrika\", \"Zuid-Afrika\", \"ISO 3166-1:ZA\", \"South-African\", \"S Africa\", \"Zuid Africa\", \"Mzansi\", \"Afrique du sud\", \"Zuidafrika\", \"Ningizimu Afrika\", \"Capital of South Africa\", \"Suid-Afrika\", \"South-Africa\", \"Rep. of SOUTH AFRICA\", \"The Republic of South Africa\", \"Suid Africa\", \"Azania/South Africa\", \"S Afr\", \"Saffa\", \"South African\", \"Seth efrika\", \"South Africa\", \"Soufrica\", \"Republic of south africa\", \"South Africa\\u00e0\", \"The Beloved Country\", \"S. Africa\", \"Rep. of South Africa\", \"South Africans\", \"Republic of South Africa\"]", "[\"Ear pain\", \"Earache\", \"Otalgia\", \"EARACHE\", \"Ipsilateral earache\", \"Ear ache\"]", "[\"Warner Bros. Inc.\", \"Warner Brothers Pictures, Inc\", \"Warner bros\", \"Warner Bro's\", \"Warner Bros. Studio\", \"Warner Brothers\", \"WB Shield\", \"Warner Brothers Recordings\", \"Warner Bros. Entertainment Company\", \"Wild Guns (film)\", \"Warner Brothers Entertainment\", \"Warner Brothers Corporation\", \"Warnerbros\", \"Warner Brothers Studio\", \"Warner Bros. Pictures Distribution\", \"Warner Bros. Entertainment Inc.\", \"Warner Bros. Entertainment, Inc.\", \"WB Studios\", \"Warmer Bros.\", \"Warner Bros. Pictures Inc.\", \"Warners\", \"Warner Brothers Inc.\", \"Warner Bros. Entertainment\", \"The Warner Brothers Studio\", \"Warner Bro\", \"Warner Bros. Pictures, Inc.\", \"Warner Bros.\", \"Warner Brothers Japan\", \"Warner Bros\", \"Warner Brothers Pictures\", \"Warner Bros. Pictures\", \"Warner Bros. Studios\", \"Warnerbros.com\", \"Warner Brothers Studios\", \"Warner Brothers International Television\"]", "[\"Island of Trinidad\", \"Trinidad (island)\", \"Trinadad\", \"Trinidad Island\", \"Trini\", \"Iere\", \"TRINIDAD\", \"Trinidad\"]", "[\"Wedge\", \"Wedges\", \"Wedge (disambiguation)\"]", "[\"Murat Bernard Young\", \"Chic Young\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Eagle\", \"Aquilinae\", \"King of the Air\", \"King of the air\", \"Booted eagles (group)\", \"Kitpu\", \"Hawk eagle\", \"Eagle Spirit\", \"Eagle (symbolism)\", \"Eagles\", \"THE EAGLES\", \"Harpy (zoology)\", \"Hawk-eagle\"]", "[\"Citizen Hughes: The Power, the Money, and the Madness\", \"Howard Robard Hughes\", \"Howard Hughs\", \"Howard R. Hughes\", \"Howard Hughes\", \"Howard R. Hughes, Jr.\", \"William L. Durkin\", \"Howard hughes\", \"HOWARD HUGHES\", \"Howard Robard Hughes, Jr.\"]", "[\"Doctor Livingstone\", \"Dr. Livingston\", \"Dr. Livingstone, I presume%3F\", \"Livingstone, David\", \"David Livingstone\", \"Livingstone's Heart\", \"Livingstone, Dr.\", \"Dr. Livingstone\", \"Dr Livingstone\", \"D Livingstone\"]", "[\"Decomposed organic matter\"]", "[\"BARCLAYS PLC\", \"Barclay's Bank\", \"Barclays PLC (ADR)\", \"Barclays Bank\", \"Barclays Group US\", \"Barclay\\u2019s Bank\", \"Barclay Bank\", \"Barclays (DCO)\", \"Barclays, plc\", \"Barclay & Co.\", \"Barclays PLC\", \"Barclays American\", \"Barclays Bank Ltd\", \"Barclay's bank\", \"BarclaysAmerican\", \"Barclays Stockbrokers\", \"Barclays Bank of Delaware\", \"Barclays DCO\", \"Barclays Bank PLC\", \"Barclay's\", \"Barclays Bank Plc\", \"Barclays plc\", \"Barclays Plc\", \"Barclays Bank (DCO)\", \"Barclays Ventures\", \"Barclays.co.uk\", \"Barclays GEMS Asia-8 ETN\", \"Barclays Bank, PLC\", \"Barclays Bank International Limited\", \"Barclays Bank (Dominion, Colonial and Overseas)\", \"Barclays bank\", \"Barclays\", \"Barclays Bank plc\"]", "[\"Botswanan Antelopes\", \"Antelope\", \"Antilopina\", \"Antelopes\", \"Hybrid antelope\"]", "[\"Ocotber\", \"October\", \"8ber\", \"\\u32c9\", \"Oct.\", \"Roctober\"]", "[\"The Fly (film)\", \"Humanoid fly\", \"The Fly\", \"The Fly (disambiguation)\", \"The Fly (comics)\", \"The fly\"]", "[\"The Game(song)\", \"The game\", \"The Game (college football)\", \"The Game (television show)\", \"The Game (film)\", \"The Game (TV show)\", \"The Game (Song)\", \"The Game (novel)\", \"The Game (disambiguation)\", \"TheGame\", \"The Game (album)\", \"The Game (TV Show)\", \"The Games\", \"The Game (song)\", \"The Game (book)\", \"El Juego\", \"The game (disambiguation)\", \"The Game film\", \"The Game (movie)\", \"The game (film)\", \"The Game\", \"The Game (TV series)\", \"The game disambiguation\", \"%22The Game%22\", \"The Games (TV series)\"]", "[\"South africa\", \"South Africa's\", \"Southafrica\", \"Third Republic (South Africa)\", \"Republiek van Suid-Afrika\", \"Sou'frica\", \"Zuid Afrika\", \"Zuid-Afrika\", \"ISO 3166-1:ZA\", \"South-African\", \"S Africa\", \"Zuid Africa\", \"Mzansi\", \"Afrique du sud\", \"Zuidafrika\", \"Ningizimu Afrika\", \"Capital of South Africa\", \"Suid-Afrika\", \"South-Africa\", \"Rep. of SOUTH AFRICA\", \"The Republic of South Africa\", \"Suid Africa\", \"Azania/South Africa\", \"S Afr\", \"Saffa\", \"South African\", \"Seth efrika\", \"South Africa\", \"Soufrica\", \"Republic of south africa\", \"South Africa\\u00e0\", \"The Beloved Country\", \"S. Africa\", \"Rep. of South Africa\", \"South Africans\", \"Republic of South Africa\"]", "[\"Ear pain\", \"Earache\", \"Otalgia\", \"EARACHE\", \"Ipsilateral earache\", \"Ear ache\"]", "[\"Warner Bros. Inc.\", \"Warner Brothers Pictures, Inc\", \"Warner bros\", \"Warner Bro's\", \"Warner Bros. Studio\", \"Warner Brothers\", \"WB Shield\", \"Warner Brothers Recordings\", \"Warner Bros. Entertainment Company\", \"Wild Guns (film)\", \"Warner Brothers Entertainment\", \"Warner Brothers Corporation\", \"Warnerbros\", \"Warner Brothers Studio\", \"Warner Bros. Pictures Distribution\", \"Warner Bros. Entertainment Inc.\", \"Warner Bros. Entertainment, Inc.\", \"WB Studios\", \"Warmer Bros.\", \"Warner Bros. Pictures Inc.\", \"Warners\", \"Warner Brothers Inc.\", \"Warner Bros. Entertainment\", \"The Warner Brothers Studio\", \"Warner Bro\", \"Warner Bros. Pictures, Inc.\", \"Warner Bros.\", \"Warner Brothers Japan\", \"Warner Bros\", \"Warner Brothers Pictures\", \"Warner Bros. Pictures\", \"Warner Bros. Studios\", \"Warnerbros.com\", \"Warner Brothers Studios\", \"Warner Brothers International Television\"]", "[\"Island of Trinidad\", \"Trinidad (island)\", \"Trinadad\", \"Trinidad Island\", \"Trini\", \"Iere\", \"TRINIDAD\", \"Trinidad\"]", "[\"Wedge\", \"Wedges\", \"Wedge (disambiguation)\"]", "[\"Murat Bernard Young\", \"Chic Young\"]" ]
[ "Which group in 1994 released the live Album “Hell Freezes Over”?", "The 2004 film 'The Aviator' starring Leonardo DiCaprio is a biopic of whom?", "Which explorer discovered the Victoria falls on the River Zambezi?", "Humus refers to the component in soil (earth) that is?", "Which bank acquired the Woolwich Building Society in 2000?", "What was Gulliver's ship called", "Hydref is Welsh for which month of the year?", "In the nursery rhyme, who saw the sparrow kill Cock Robin?", "Which reality TV show was won by MC Harvey, Azra Akin and Terri Dwyer in 2003, and by Jarrod Batchelor, Shane Lynch and Lady Isabella Hervey in 2004?", "In what modern-day country was the Second Boer War fought?", "What is the more common name of the medical condition 'Otalgia'?", "Brothers Harry, Samuel, Albert and Jack established which film company in 1923?", "'Stag' and 'Carib' beers are made in which country?", "In golf the no 10 iron is usually called what?", "Who created the comic strip ‘Blondie’, published in newspapers since 1930?" ]
15
[ 135120, 135121, 135122, 135123, 135124, 135125, 135126, 135127, 135128, 135129, 135130, 135131, 135132, 135133, 135134 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: January 28, 1841 marked the birth of the famous Welsh explorer Sir Henry Morton Stanley, most famous for his trek to find what famed Scottish explorer/missionary, who went missing in Africa for 6 years?\nQuestion 2: Bratwurst is a greatly varying German food made mainly of?\nQuestion 3: \"Whose epitaph by Johnson in Westminster Abbey reads in part \"\"Nihil quod tetigit non ornavit\"\" (\"\"He touched nothing without adding a lustre to it\"\"?\"\nQuestion 4: On what holiday is the Chicago River dyed green?\nQuestion 5: Which English town shares its name with the capital of the Caribbean island of Tobago?\nQuestion 6: With which film do you associate Lara's Theme?\nQuestion 7: What kind of mammal is a sika?\nQuestion 8: Whose real name was falsely stated to be Camille Javal ?\nQuestion 9: Sphalerite is the main ore of which metal?\nQuestion 10: Edward Somerset, Denis Papin, Thomas Newcomen and James Watt are known for work in relation to what?\nQuestion 11: Near which city is 'Fuhlsbuttel Airport'?\nQuestion 12: Which US singer released a 1962 album entitled ‘Pot Luck’?\nQuestion 13: \"In what activity might one attempt a \"\"Sicilian Defense\"\"?\"\nQuestion 14: The memoirs of Jennifer Worth form the basis of which BBC TV drama series?\nQuestion 15: In the Bible, who had sons called Ham, Shem and Japheth?", "role": "user" } ]
["[\"Doctor Livingstone\", \"Dr. Livingston\", \"Dr. Livingstone, I presume%3F\", \"Livingstone, David\", \"David Livingstone\", \"Livingstone's Heart\", \"Livingstone, Dr.\", \"Dr. Livingstone\", \"Dr Livingstone\", \"D Livingstone\"]", "[\"Lean Meat\", \"Lean meat\", \"Eating meat\", \"Meat\", \"Meat consumption\", \"Processed meats\", \"Processed meat\", \"Meats\", \"Meat science\", \"Boneless meat\", \"Meat eating\"]", "[\"O. Goldsmith\", \"Goldsmithian\", \"Oliver Goldsmith\", \"The Citizen of the World\", \"Inspired Idiot\"]", "[\"St. Patrick's Day parade\", \"St.Patrick's Day\", \"St Patrick's Day\", \"St. Patrick Day\", \"Green Ribbon Day\", \"St. Patricks Day\", \"Saint patricks day\", \"Patty's Day\", \"St. Patrick's Day\", \"Saint Patricks Day\", \"St. Patrick's Day Parade\", \"St. Patrick's Day parades\", \"St pattys day\", \"Patrick's day\", \"St Patrick's day\", \"St. Patrick\\u2019s Day\", \"St. Pat's Day\", \"Saint p day\", \"Saint Patrick's Day\", \"Saint Patrick's Day (religious)\", \"St Patrick Day\", \"St. Patricts day\", \"St. Patrick's day\", \"Saint Patrick\\u2019s Day\", \"St patrick's day\", \"St. Patricks's Day Parade\", \"St. paddy's day\", \"St patty day\", \"Parade of Patrick\", \"Paddy's Day\", \"St Patrick's Festival\", \"St. Paddy's Day\", \"St. Partick's Day\", \"St. Patty's Day\", \"St Patrick\\u2019s Day\", \"Saint patrick's day\", \"St. patricks day\", \"Saint Patrick's day traditions\", \"St Patricks Day\"]", "[\"Scarborough (Disambiguation)\", \"Scarboro\", \"Scarboro (disambiguation)\", \"SCARBOROUGH\", \"Scarborough\", \"Scarborough (disambiguation)\"]", "[\"Dr. Zhivago\", \"Dr zhivago\", \"Yuriatin\", \"Dr. Yuri Zhivago\", \"Doctor Zhivago (disambiguation)\", \"Dr. Zhivago (novel)\", \"Varykino\", \"\\u0414\\u043e\\u043a\\u0442\\u043e\\u0440 \\u0416\\u0438\\u0432\\u0430\\u0433\\u043e\", \"Yury Andreyevich Zhivago\", \"Zivago\", \"Doctor Zhivago\", \"DR ZHIVAGO\", \"Yury Zhivago\", \"Zhivago\", \"Yuryatin\", \"Doktor Zhivago\", \"Dr Zhivago\", \"Doctor zhivago\"]", "[\"Fawn\", \"Cervidae\", \"Stag like\", \"Fawn like\", \"Cervids\", \"Stag\", \"Stags\", \"The Deer\", \"Deer\", \"Fawnlike\", \"Hind (female deer)\", \"Cervine\", \"True deer\", \"Stag-like\", \"White deer\", \"Fauun\", \"Fawn-like\", \"Fawns\", \"Staglike\", \"Cervid\", \"Raghorn\"]", "[\"Brigitte Bardou\", \"Brigitte Bardot\", \"Brigitte Bardo\", \"BRIDGET BARDOT\", \"Brigit Bardot\", \"Brigitte Bardeaux\", \"Bridgette Bardot\", \"Bridget Bardot\", \"Brigitte Bardeau\", \"Brigitte Bardot Foundation\", \"Brigette Bardot\", \"Brigitte Bardot Foundation for the Welfare and Protection of Animals\", \"Brigitte Anne-Marie Bardot\"]", "[\"Zinc alloy\", \"Zinc supplementation\", \"Special high grade zinc\", \"Zinc pills\", \"Zinc\", \"Zinc metabolism\", \"Zinc (element)\", \"Zinc tablets\", \"Element 30\", \"Zinc Processing\", \"Zinc poisoning\", \"Zinc metallurgy\", \"Zinc concentrate\", \"Zn2+\", \"Mossy zinc\", \"Zinc ions\", \"Super high grade zinc\", \"Zinc alloys\", \"SHG zinc\", \"Zinc tiles\"]", "[\"Steam power\", \"Quadruple expansion engine\", \"Quadruple-expansion\", \"The steam engine\", \"Triple expansion steam engine\", \"Expansive working\", \"Quadruple-expansion steam engine\", \"Double-expansion steam engine\", \"Triple expansion\", \"Quadruple expansion\", \"Steam engine\", \"Triple-expansion engines\", \"Low pressure cylinder\", \"Steam machine\", \"Steam engines\", \"Quadruple expansion steam engine\", \"Triple expansion engine\", \"Steam propulsion\", \"Steam machines\", \"Steam Engine\", \"High pressure cylinder\", \"Quad expansion steam engine\", \"Double expansion engine\", \"Steam powered machinery\", \"Steam Engines\", \"Steam powered\", \"Steam-powered\", \"Steam-power\", \"Triple-expansion\", \"Steam-engine\", \"High-pressure steam engine\", \"Steam navigation\"]", "[\"DEHAM\", \"Hambro'\", \"Gambrivium\", \"HAMBURG\", \"Hamburg\", \"Hamborg\", \"Free City of Hamburg\", \"Hamburg (city)\", \"Hambourg\", \"Freie und Hansestadt Hamburg\", \"\\u1e24amburg\", \"Free un Hansestadt Hamborg\", \"Free and Hanseatic City of Hamburg\", \"Hanseatic city of Hamburg\", \"UN/LOCODE:DEHAM\", \"Hamburg (Germany)\", \"Hamburg (state)\", \"Treva\", \"Hamburg, Germany\"]", "[\"Elvis Aron Presley\", \"Oh, How I Love Jesus\", \"Elvis Presley's political beliefs\", \"He's Only a Prayer Away\", \"Jesse Garon Presley\", \"Elvis Pressly\", \"Elvis Pressley\", \"Elvis Aaron Pressly\", \"The King (entertainer)\", \"Elvis A. Presley\", \"Elvis prestly\", \"(Keep Your) Hands Off (Of It)\", \"Presleyesque\", \"It's No Fun Being Lonely\", \"Elvis Presley\", \"Mr. Aaron\", \"Ginger Alden\", \"Gladys Presley\", \"Political beliefs of elvis presley\", \"Cattle Call/Yodel\", \"Dainty Little Moonbeams\", \"Elvis The Pelvis\", \"I Asked the Lord\", \"Elvis discography\", \"Elvis\", \"Show Me Thy Ways, O, Lord\", \"Gladys Love Presley\", \"Jesse Presley\", \"Lovely Mamie\", \"Elvis presley\", \"Mary Lou Brown\", \"Elvis Presely\", \"Elvis Pres;ey\", \"Long, Lonely Highway\", \"Elvis aaron\", \"Death of Elvis Presley\", \"Elvis Presley discography\", \"Apron Strings\", \"Elvis Pres\", \"Frank Page (radio)\", \"Vernon Presley\", \"Little Mama\", \"Elvis Aron Pressley\", \"Gladys love presley\", \"Elivs\", \"Vernon Elvis Presley\", \"I Ain't About to Sing\", \"Elvis Aaron Presley\", \"Elvisesque\", \"Elvis Extravaganza\", \"Political beliefs of Elvis Presley\", \"Gladys Love Smith\", \"Elvis aron\", \"Elvis Presly\", \"Elvis Aaron Pressley\", \"Elvis presley discography\", \"Elvis Aron Pressly\", \"I Didn't Make It On Playing Guitar\", \"The King (actor-singer)\", \"Elvis Presley Discography\", \"Vernon and Gladys Presley\", \"Presley, Elvis\"]", "[\"Chess match\", \"\\u0160achmatai\", \"Sjakk\", \"Ajedrez\", \"Ahedres\", \"Ficheall\", \"Rank and file (chess)\", \"Chess Revers\", \"Chess\", \"Xadrez\", \"Chess publications\", \"Satran\\u00e7\", \"Western chess\", \"\\u0160achy\", \"\\u0428\\u0430\\u0445\\u0438\", \"Chess game\", \"European chess\", \"Chess psychology\", \"ChesS\", \"\\u015cako\", \"\\u0a38\\u0a3c\\u0a24\\u0a30\\u0a70\\u0a1c\", \"Chess games\", \"\\u0936\\u0924\\u0930\\u0902\\u091c\", \"Play chess\", \"Skaak\", \"Western Chess\", \"Orthochess\", \"Chesss\", \"Game of chess\", \"\\u0160ach\", \"Echedo\\u00f9\", \"\\u00c9checs\", \"\\u05e9\\u05d7\\u05de\\u05d8\", \"Chesse\", \"Scacci\", \"\\u0428\\u0430\\u0445\\u043c\\u0430\\u0442\", \"Escacs\", \"C\\u00f6g\", \"\\u015eah\", \"C\\u1edd vua\", \"International Chess\", \"Chess board game\", \"Chess Board Game\", \"\\u0428\\u0430\\u0445\\u043c\\u0430\\u0442\\u044b\", \"Game of Chess\", \"Skak\", \"\\u0634\\u0637\\u0631\\u0646\\u062c\", \"\\u0428\\u0430\\u0442\\u0430\\u0440\", \"Chess career\", \"\\u03a3\\u03ba\\u03ac\\u03ba\\u03b9\", \"\\u0160ahs\", \"Cheess\", \"Chess srategy and tactics\", \"Chess (game)\", \"Sk\\u00e1k\", \"International chess\"]", "[\"Call the Midwife\", \"CALL THE MIDWIFE\", \"Call the Midwife (TV series)\"]", "[\"Noah (Hebrew Bible)\", \"Noah\", \"No'ah\", \"Nuach\", \"Nooh\", \"Noahian\", \"No'a\", \"Noah and the Ark\", \"Noahtic\", \"Flood (Bible)\", \"\\u05e0\\u05d5\\u05b9\\u05d7\\u05b7\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Doctor Livingstone\", \"Dr. Livingston\", \"Dr. Livingstone, I presume%3F\", \"Livingstone, David\", \"David Livingstone\", \"Livingstone's Heart\", \"Livingstone, Dr.\", \"Dr. Livingstone\", \"Dr Livingstone\", \"D Livingstone\"]", "[\"Lean Meat\", \"Lean meat\", \"Eating meat\", \"Meat\", \"Meat consumption\", \"Processed meats\", \"Processed meat\", \"Meats\", \"Meat science\", \"Boneless meat\", \"Meat eating\"]", "[\"O. Goldsmith\", \"Goldsmithian\", \"Oliver Goldsmith\", \"The Citizen of the World\", \"Inspired Idiot\"]", "[\"St. Patrick's Day parade\", \"St.Patrick's Day\", \"St Patrick's Day\", \"St. Patrick Day\", \"Green Ribbon Day\", \"St. Patricks Day\", \"Saint patricks day\", \"Patty's Day\", \"St. Patrick's Day\", \"Saint Patricks Day\", \"St. Patrick's Day Parade\", \"St. Patrick's Day parades\", \"St pattys day\", \"Patrick's day\", \"St Patrick's day\", \"St. Patrick\\u2019s Day\", \"St. Pat's Day\", \"Saint p day\", \"Saint Patrick's Day\", \"Saint Patrick's Day (religious)\", \"St Patrick Day\", \"St. Patricts day\", \"St. Patrick's day\", \"Saint Patrick\\u2019s Day\", \"St patrick's day\", \"St. Patricks's Day Parade\", \"St. paddy's day\", \"St patty day\", \"Parade of Patrick\", \"Paddy's Day\", \"St Patrick's Festival\", \"St. Paddy's Day\", \"St. Partick's Day\", \"St. Patty's Day\", \"St Patrick\\u2019s Day\", \"Saint patrick's day\", \"St. patricks day\", \"Saint Patrick's day traditions\", \"St Patricks Day\"]", "[\"Scarborough (Disambiguation)\", \"Scarboro\", \"Scarboro (disambiguation)\", \"SCARBOROUGH\", \"Scarborough\", \"Scarborough (disambiguation)\"]", "[\"Dr. Zhivago\", \"Dr zhivago\", \"Yuriatin\", \"Dr. Yuri Zhivago\", \"Doctor Zhivago (disambiguation)\", \"Dr. Zhivago (novel)\", \"Varykino\", \"\\u0414\\u043e\\u043a\\u0442\\u043e\\u0440 \\u0416\\u0438\\u0432\\u0430\\u0433\\u043e\", \"Yury Andreyevich Zhivago\", \"Zivago\", \"Doctor Zhivago\", \"DR ZHIVAGO\", \"Yury Zhivago\", \"Zhivago\", \"Yuryatin\", \"Doktor Zhivago\", \"Dr Zhivago\", \"Doctor zhivago\"]", "[\"Fawn\", \"Cervidae\", \"Stag like\", \"Fawn like\", \"Cervids\", \"Stag\", \"Stags\", \"The Deer\", \"Deer\", \"Fawnlike\", \"Hind (female deer)\", \"Cervine\", \"True deer\", \"Stag-like\", \"White deer\", \"Fauun\", \"Fawn-like\", \"Fawns\", \"Staglike\", \"Cervid\", \"Raghorn\"]", "[\"Brigitte Bardou\", \"Brigitte Bardot\", \"Brigitte Bardo\", \"BRIDGET BARDOT\", \"Brigit Bardot\", \"Brigitte Bardeaux\", \"Bridgette Bardot\", \"Bridget Bardot\", \"Brigitte Bardeau\", \"Brigitte Bardot Foundation\", \"Brigette Bardot\", \"Brigitte Bardot Foundation for the Welfare and Protection of Animals\", \"Brigitte Anne-Marie Bardot\"]", "[\"Zinc alloy\", \"Zinc supplementation\", \"Special high grade zinc\", \"Zinc pills\", \"Zinc\", \"Zinc metabolism\", \"Zinc (element)\", \"Zinc tablets\", \"Element 30\", \"Zinc Processing\", \"Zinc poisoning\", \"Zinc metallurgy\", \"Zinc concentrate\", \"Zn2+\", \"Mossy zinc\", \"Zinc ions\", \"Super high grade zinc\", \"Zinc alloys\", \"SHG zinc\", \"Zinc tiles\"]", "[\"Steam power\", \"Quadruple expansion engine\", \"Quadruple-expansion\", \"The steam engine\", \"Triple expansion steam engine\", \"Expansive working\", \"Quadruple-expansion steam engine\", \"Double-expansion steam engine\", \"Triple expansion\", \"Quadruple expansion\", \"Steam engine\", \"Triple-expansion engines\", \"Low pressure cylinder\", \"Steam machine\", \"Steam engines\", \"Quadruple expansion steam engine\", \"Triple expansion engine\", \"Steam propulsion\", \"Steam machines\", \"Steam Engine\", \"High pressure cylinder\", \"Quad expansion steam engine\", \"Double expansion engine\", \"Steam powered machinery\", \"Steam Engines\", \"Steam powered\", \"Steam-powered\", \"Steam-power\", \"Triple-expansion\", \"Steam-engine\", \"High-pressure steam engine\", \"Steam navigation\"]", "[\"DEHAM\", \"Hambro'\", \"Gambrivium\", \"HAMBURG\", \"Hamburg\", \"Hamborg\", \"Free City of Hamburg\", \"Hamburg (city)\", \"Hambourg\", \"Freie und Hansestadt Hamburg\", \"\\u1e24amburg\", \"Free un Hansestadt Hamborg\", \"Free and Hanseatic City of Hamburg\", \"Hanseatic city of Hamburg\", \"UN/LOCODE:DEHAM\", \"Hamburg (Germany)\", \"Hamburg (state)\", \"Treva\", \"Hamburg, Germany\"]", "[\"Elvis Aron Presley\", \"Oh, How I Love Jesus\", \"Elvis Presley's political beliefs\", \"He's Only a Prayer Away\", \"Jesse Garon Presley\", \"Elvis Pressly\", \"Elvis Pressley\", \"Elvis Aaron Pressly\", \"The King (entertainer)\", \"Elvis A. Presley\", \"Elvis prestly\", \"(Keep Your) Hands Off (Of It)\", \"Presleyesque\", \"It's No Fun Being Lonely\", \"Elvis Presley\", \"Mr. Aaron\", \"Ginger Alden\", \"Gladys Presley\", \"Political beliefs of elvis presley\", \"Cattle Call/Yodel\", \"Dainty Little Moonbeams\", \"Elvis The Pelvis\", \"I Asked the Lord\", \"Elvis discography\", \"Elvis\", \"Show Me Thy Ways, O, Lord\", \"Gladys Love Presley\", \"Jesse Presley\", \"Lovely Mamie\", \"Elvis presley\", \"Mary Lou Brown\", \"Elvis Presely\", \"Elvis Pres;ey\", \"Long, Lonely Highway\", \"Elvis aaron\", \"Death of Elvis Presley\", \"Elvis Presley discography\", \"Apron Strings\", \"Elvis Pres\", \"Frank Page (radio)\", \"Vernon Presley\", \"Little Mama\", \"Elvis Aron Pressley\", \"Gladys love presley\", \"Elivs\", \"Vernon Elvis Presley\", \"I Ain't About to Sing\", \"Elvis Aaron Presley\", \"Elvisesque\", \"Elvis Extravaganza\", \"Political beliefs of Elvis Presley\", \"Gladys Love Smith\", \"Elvis aron\", \"Elvis Presly\", \"Elvis Aaron Pressley\", \"Elvis presley discography\", \"Elvis Aron Pressly\", \"I Didn't Make It On Playing Guitar\", \"The King (actor-singer)\", \"Elvis Presley Discography\", \"Vernon and Gladys Presley\", \"Presley, Elvis\"]", "[\"Chess match\", \"\\u0160achmatai\", \"Sjakk\", \"Ajedrez\", \"Ahedres\", \"Ficheall\", \"Rank and file (chess)\", \"Chess Revers\", \"Chess\", \"Xadrez\", \"Chess publications\", \"Satran\\u00e7\", \"Western chess\", \"\\u0160achy\", \"\\u0428\\u0430\\u0445\\u0438\", \"Chess game\", \"European chess\", \"Chess psychology\", \"ChesS\", \"\\u015cako\", \"\\u0a38\\u0a3c\\u0a24\\u0a30\\u0a70\\u0a1c\", \"Chess games\", \"\\u0936\\u0924\\u0930\\u0902\\u091c\", \"Play chess\", \"Skaak\", \"Western Chess\", \"Orthochess\", \"Chesss\", \"Game of chess\", \"\\u0160ach\", \"Echedo\\u00f9\", \"\\u00c9checs\", \"\\u05e9\\u05d7\\u05de\\u05d8\", \"Chesse\", \"Scacci\", \"\\u0428\\u0430\\u0445\\u043c\\u0430\\u0442\", \"Escacs\", \"C\\u00f6g\", \"\\u015eah\", \"C\\u1edd vua\", \"International Chess\", \"Chess board game\", \"Chess Board Game\", \"\\u0428\\u0430\\u0445\\u043c\\u0430\\u0442\\u044b\", \"Game of Chess\", \"Skak\", \"\\u0634\\u0637\\u0631\\u0646\\u062c\", \"\\u0428\\u0430\\u0442\\u0430\\u0440\", \"Chess career\", \"\\u03a3\\u03ba\\u03ac\\u03ba\\u03b9\", \"\\u0160ahs\", \"Cheess\", \"Chess srategy and tactics\", \"Chess (game)\", \"Sk\\u00e1k\", \"International chess\"]", "[\"Call the Midwife\", \"CALL THE MIDWIFE\", \"Call the Midwife (TV series)\"]", "[\"Noah (Hebrew Bible)\", \"Noah\", \"No'ah\", \"Nuach\", \"Nooh\", \"Noahian\", \"No'a\", \"Noah and the Ark\", \"Noahtic\", \"Flood (Bible)\", \"\\u05e0\\u05d5\\u05b9\\u05d7\\u05b7\"]" ]
[ "January 28, 1841 marked the birth of the famous Welsh explorer Sir Henry Morton Stanley, most famous for his trek to find what famed Scottish explorer/missionary, who went missing in Africa for 6 years?", "Bratwurst is a greatly varying German food made mainly of?", "\"Whose epitaph by Johnson in Westminster Abbey reads in part \"\"Nihil quod tetigit non ornavit\"\" (\"\"He touched nothing without adding a lustre to it\"\"?\"", "On what holiday is the Chicago River dyed green?", "Which English town shares its name with the capital of the Caribbean island of Tobago?", "With which film do you associate Lara's Theme?", "What kind of mammal is a sika?", "Whose real name was falsely stated to be Camille Javal ?", "Sphalerite is the main ore of which metal?", "Edward Somerset, Denis Papin, Thomas Newcomen and James Watt are known for work in relation to what?", "Near which city is 'Fuhlsbuttel Airport'?", "Which US singer released a 1962 album entitled ‘Pot Luck’?", "\"In what activity might one attempt a \"\"Sicilian Defense\"\"?\"", "The memoirs of Jennifer Worth form the basis of which BBC TV drama series?", "In the Bible, who had sons called Ham, Shem and Japheth?" ]
15
[ 14730, 14731, 14732, 14733, 14734, 14735, 14736, 14737, 14738, 14739, 14740, 14741, 14742, 14743, 14744 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Who got to no. 6 with ‘Games People Play’ in 1969?\nQuestion 2: Name the 2009 animated movie from the IMDB plot summary: “The most delicious event since macaroni met cheese. Inspired by the beloved children’s book, the film focuses on a town where food falls from the sky like rain.”\nQuestion 3: Which movement was thought to be responsible for the kidnapping of Western hostages in Lebanon in the 890s?\nQuestion 4: Which city was founded by Sir Stamford Raffles as a trading settlement in 1819?\nQuestion 5: What volcano in Washinton state erupted in 1980, killing 57 people?\nQuestion 6: Which English composer produced the operas 'Artaxerxes', 'Love in a Village' and the 'Fairy Prince' in the decade 1761 to 1771?\nQuestion 7: An oenophile is a connoisseur of what?\nQuestion 8: In which Dickens novel would you find the Barnacle family?\nQuestion 9: What is the name of the house in Cluedo in which the murder takes place\nQuestion 10: Who was the President of the USA at the outbreak of the First World War?\nQuestion 11: What is the title of a 1968 hit single by The Scaffold which is a modernisation of an older folk song called The Ballad of Lydia Pinkham’?\nQuestion 12: At Dettingen in 1743 who was the last British monarch to lead his troops into battle?\nQuestion 13: Into which body of water does the River Nene drain?\nQuestion 14: British athlete Dai Green competes in which track event?\nQuestion 15: President Lyndon B. Johnson nominated the first African American judge to the US Supreme Court. Who was it?", "role": "user" } ]
["[\"Joe South\", \"Don't It Make You Wanna Go Home\", \"JOE SOUTH\", \"Joseph Souter\"]", "[\"Cwacom\", \"Cloudy with a Chance of Meatballs\", \"Steve the Monkey\", \"Cloudy with a chance of meatballs\", \"Cloudy With A Chance Of Meatballs\"]", "[\"Khizbollah\", \"Herzbollah\", \"Organization of the Oppressed on Earth\", \"Hesbolla\", \"Hezboolah\", \"The Hezbollah External Security Organization\", \"Hezbollah\", \"Organization of Right Against Wrong\", \"Hezb Allah\", \"Hezbulla\", \"Hezbollah External Security Organisation\", \"Hezzbollah\", \"Hizbula - Moslem religion social and terror organization\", \"Hezbula\", \"\\u1e24izbu-ll\\u0101h\", \"Hizbulla\", \"Hizbalah\", \"Hizb Allah\", \"Hizbolla\", \"Hisbollah\", \"HezbAllah\", \"Hezbolla\", \"Party of God\", \"Huzbollah\", \"Hez b'Allah\", \"Hizbu'llah\", \"Hizbullah\", \"Hezbola\", \"Party of God (Lebanon)\", \"Hizb'allah\", \"Hesbollah\", \"Hizbollah\", \"Hezballah\", \"Revolutionary Justice Organization\", \"Hizballah's External Security Organisation\", \"Hizbu-llah\", \"Party of Allah\", \"Hezbollah (Lebanon)\", \"Hizballa\", \"Hizballah\", \"Hezbolah\", \"Hezballa\", \"Hezbullah\", \"Hesbola\"]", "[\"Singapore City (disambiguation)\", \"Singapore basic facts\", \"\\u65b0\\u52a0\\u5761\\u5171\\u548c\\u56fd\", \"Singy\", \"Statistics of Singapore\", \"Cingkappur\", \"Cingkappur Kudiyaracu\", \"Republic of Singapore\", \"UN/LOCODE:SGSIN\", \"Capital of Singapore\", \"S'porean\", \"X\\u012bnji\\u0101p\\u014d G\\u00f2ngh\\u00e9gu\\u00f3\", \"Singapore (Country)\", \"Asia/Singapore\", \"Singapore as a regional and global hub\", \"Singapore\", \"Light of the South\", \"Republik Singapura\", \"Singapore Kudiyarasu\", \"Republic Of Singapore\", \"\\u0b9a\\u0bbf\\u0b99\\u0bcd\\u0b95\\u0baa\\u0bcd\\u0baa\\u0bc2\\u0bb0\\u0bcd \\u0b95\\u0bc1\\u0b9f\\u0bbf\\u0baf\\u0bb0\\u0b9a\\u0bc1\", \"S'pore\", \"Singapore, Singapore\", \"SG100\", \"\\u0b9a\\u0bbf\\u0b99\\u0bcd\\u0b95\\u0baa\\u0bcd\\u0baa\\u0bc2\\u0bb0\\u0bcd\", \"Xinjiapo Gongheguo\", \"Hsin-chia-p'o Kung-ho-kuo\", \"Singa Pura\", \"Sing a pore\", \"Hsin-chia-p'o\", \"Singapor\", \"Xinjiapo\", \"HUB in a Singapore context\", \"The Manchester of the East\", \"ISO 3166-1:SG\", \"Xin Jia Po\", \"Xinjiapo G\\u00f2ngh\\u00e9g\\u00fao\", \"City of Singapore\", \"Singapour\", \"Lion City\", \"Etymology of Singapore\", \"SINGAPORE\", \"X\\u012bnji\\u0101p\\u014d\", \"Sinjiapo\", \"\\u65b0\\u52a0\\u5761\", \"\\u65b0\\u52a0\\u5761\\u5171\\u548c\\u570b\", \"Signapore\", \"Singpore\", \"Singapore City\", \"Manchester of the East\"]", "[\"Goat Rocks Dome\", \"Mt St. Helens\", \"Mount St. Helen's\", \"Mt st helens\", \"Mount Saint Hellens\", \"Mt saint helens\", \"Mount Saint Helen's\", \"Eruption of Mt. St. Helens\", \"Loowit\", \"Mount Saint Helens\", \"Mt. St. Helen's\", \"Mount St. Hellens\", \"Mt. Saint Helen's\", \"Mount St Helens\", \"Mt St Helens\", \"Mt Saint Helens\", \"Mt. St Helens\", \"Mount St. Halenas\", \"Mount St. Helens, Washington\", \"Mount St. Helens\", \"Mount St. Helens explosion\", \"Goat Rocks dome\", \"Mount st helen\", \"Mt. Saint Helens\", \"Lawetlat'la\", \"Mt. St. Helens\", \"Mount St. Helens eruption\", \"Mount st helens eruption\"]", "[\"Dr Arne\", \"THOMAS ARNE\", \"T. A. Arne\", \"Thomas Augustine Arne\", \"Thomas Arne\"]", "[\"Wines\", \"Vinous\", \"Grape wine\", \"Kha'y\", \"Wine trade\", \"\\u015eARAP\", \"Sacre Bleu Wine\", \"Herbal wine\", \"SARAP\", \"Vin Rouge\", \"Cooking Wine\", \"Fine wine\", \"Food wine\", \"Wine\"]", "[\"Little Doritt\", \"Little Dorritt\", \"Little Dorrit\", \"Little Dorrit (novel)\"]", "[\"Arlington Grange\"]", "[\"Thomas W. Wilson\", \"President wilson\", \"Wilson, Woodrow\", \"Thomas Woodrow Wilson\", \"Woodrow wilson\", \"Presidency of Woodrow Wilson\", \"President Woodrow Wilson\", \"President Wilson's\", \"T Woodrow Wilson\", \"W. Wilson\", \"Woodrow Wilson's\", \"Woodrow Wilson\", \"Wildrow Woodson\", \"President Wilson\", \"28th President of the United States\", \"T. Woodrow Wilson\"]", "[\"Lydia E. Pinkham\", \"Lydia Pinkham\", \"Lydia Estes Pinkham\", \"Lydia E. Pinkham's Vegetable Compound\", \"Lilly the pink\", \"Lily the Pink\", \"Medicinal compound\", \"Lily The Pink\"]", "[\"George 2\", \"George II (disambiguation)\", \"George the Second\", \"George II\", \"George the 2nd\", \"King George II\", \"George Ii\", \"King george ii\", \"George ii\"]", "[\"Wash River\", \"The wash\", \"The Wash\"]", "[\"Hurdles\", \"Hurdler\", \"Hurdle racing\", \"High hurdles\", \"300m intermediate hurdles\", \"Sprint hurdling\", \"50 m hurdles\", \"Hurdling\", \"55 m hurdles\", \"Hurdlers\", \"Meter hurdle\", \"Hurdle Race\", \"Sprint hurdles\"]", "[\"Thoroughgood Marshall\", \"Thurgood Marshal\", \"Marshall, Thurgood\", \"Justice Thurgood Marshall\", \"Thurgood Marshall\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Joe South\", \"Don't It Make You Wanna Go Home\", \"JOE SOUTH\", \"Joseph Souter\"]", "[\"Cwacom\", \"Cloudy with a Chance of Meatballs\", \"Steve the Monkey\", \"Cloudy with a chance of meatballs\", \"Cloudy With A Chance Of Meatballs\"]", "[\"Khizbollah\", \"Herzbollah\", \"Organization of the Oppressed on Earth\", \"Hesbolla\", \"Hezboolah\", \"The Hezbollah External Security Organization\", \"Hezbollah\", \"Organization of Right Against Wrong\", \"Hezb Allah\", \"Hezbulla\", \"Hezbollah External Security Organisation\", \"Hezzbollah\", \"Hizbula - Moslem religion social and terror organization\", \"Hezbula\", \"\\u1e24izbu-ll\\u0101h\", \"Hizbulla\", \"Hizbalah\", \"Hizb Allah\", \"Hizbolla\", \"Hisbollah\", \"HezbAllah\", \"Hezbolla\", \"Party of God\", \"Huzbollah\", \"Hez b'Allah\", \"Hizbu'llah\", \"Hizbullah\", \"Hezbola\", \"Party of God (Lebanon)\", \"Hizb'allah\", \"Hesbollah\", \"Hizbollah\", \"Hezballah\", \"Revolutionary Justice Organization\", \"Hizballah's External Security Organisation\", \"Hizbu-llah\", \"Party of Allah\", \"Hezbollah (Lebanon)\", \"Hizballa\", \"Hizballah\", \"Hezbolah\", \"Hezballa\", \"Hezbullah\", \"Hesbola\"]", "[\"Singapore City (disambiguation)\", \"Singapore basic facts\", \"\\u65b0\\u52a0\\u5761\\u5171\\u548c\\u56fd\", \"Singy\", \"Statistics of Singapore\", \"Cingkappur\", \"Cingkappur Kudiyaracu\", \"Republic of Singapore\", \"UN/LOCODE:SGSIN\", \"Capital of Singapore\", \"S'porean\", \"X\\u012bnji\\u0101p\\u014d G\\u00f2ngh\\u00e9gu\\u00f3\", \"Singapore (Country)\", \"Asia/Singapore\", \"Singapore as a regional and global hub\", \"Singapore\", \"Light of the South\", \"Republik Singapura\", \"Singapore Kudiyarasu\", \"Republic Of Singapore\", \"\\u0b9a\\u0bbf\\u0b99\\u0bcd\\u0b95\\u0baa\\u0bcd\\u0baa\\u0bc2\\u0bb0\\u0bcd \\u0b95\\u0bc1\\u0b9f\\u0bbf\\u0baf\\u0bb0\\u0b9a\\u0bc1\", \"S'pore\", \"Singapore, Singapore\", \"SG100\", \"\\u0b9a\\u0bbf\\u0b99\\u0bcd\\u0b95\\u0baa\\u0bcd\\u0baa\\u0bc2\\u0bb0\\u0bcd\", \"Xinjiapo Gongheguo\", \"Hsin-chia-p'o Kung-ho-kuo\", \"Singa Pura\", \"Sing a pore\", \"Hsin-chia-p'o\", \"Singapor\", \"Xinjiapo\", \"HUB in a Singapore context\", \"The Manchester of the East\", \"ISO 3166-1:SG\", \"Xin Jia Po\", \"Xinjiapo G\\u00f2ngh\\u00e9g\\u00fao\", \"City of Singapore\", \"Singapour\", \"Lion City\", \"Etymology of Singapore\", \"SINGAPORE\", \"X\\u012bnji\\u0101p\\u014d\", \"Sinjiapo\", \"\\u65b0\\u52a0\\u5761\", \"\\u65b0\\u52a0\\u5761\\u5171\\u548c\\u570b\", \"Signapore\", \"Singpore\", \"Singapore City\", \"Manchester of the East\"]", "[\"Goat Rocks Dome\", \"Mt St. Helens\", \"Mount St. Helen's\", \"Mt st helens\", \"Mount Saint Hellens\", \"Mt saint helens\", \"Mount Saint Helen's\", \"Eruption of Mt. St. Helens\", \"Loowit\", \"Mount Saint Helens\", \"Mt. St. Helen's\", \"Mount St. Hellens\", \"Mt. Saint Helen's\", \"Mount St Helens\", \"Mt St Helens\", \"Mt Saint Helens\", \"Mt. St Helens\", \"Mount St. Halenas\", \"Mount St. Helens, Washington\", \"Mount St. Helens\", \"Mount St. Helens explosion\", \"Goat Rocks dome\", \"Mount st helen\", \"Mt. Saint Helens\", \"Lawetlat'la\", \"Mt. St. Helens\", \"Mount St. Helens eruption\", \"Mount st helens eruption\"]", "[\"Dr Arne\", \"THOMAS ARNE\", \"T. A. Arne\", \"Thomas Augustine Arne\", \"Thomas Arne\"]", "[\"Wines\", \"Vinous\", \"Grape wine\", \"Kha'y\", \"Wine trade\", \"\\u015eARAP\", \"Sacre Bleu Wine\", \"Herbal wine\", \"SARAP\", \"Vin Rouge\", \"Cooking Wine\", \"Fine wine\", \"Food wine\", \"Wine\"]", "[\"Little Doritt\", \"Little Dorritt\", \"Little Dorrit\", \"Little Dorrit (novel)\"]", "[\"Arlington Grange\"]", "[\"Thomas W. Wilson\", \"President wilson\", \"Wilson, Woodrow\", \"Thomas Woodrow Wilson\", \"Woodrow wilson\", \"Presidency of Woodrow Wilson\", \"President Woodrow Wilson\", \"President Wilson's\", \"T Woodrow Wilson\", \"W. Wilson\", \"Woodrow Wilson's\", \"Woodrow Wilson\", \"Wildrow Woodson\", \"President Wilson\", \"28th President of the United States\", \"T. Woodrow Wilson\"]", "[\"Lydia E. Pinkham\", \"Lydia Pinkham\", \"Lydia Estes Pinkham\", \"Lydia E. Pinkham's Vegetable Compound\", \"Lilly the pink\", \"Lily the Pink\", \"Medicinal compound\", \"Lily The Pink\"]", "[\"George 2\", \"George II (disambiguation)\", \"George the Second\", \"George II\", \"George the 2nd\", \"King George II\", \"George Ii\", \"King george ii\", \"George ii\"]", "[\"Wash River\", \"The wash\", \"The Wash\"]", "[\"Hurdles\", \"Hurdler\", \"Hurdle racing\", \"High hurdles\", \"300m intermediate hurdles\", \"Sprint hurdling\", \"50 m hurdles\", \"Hurdling\", \"55 m hurdles\", \"Hurdlers\", \"Meter hurdle\", \"Hurdle Race\", \"Sprint hurdles\"]", "[\"Thoroughgood Marshall\", \"Thurgood Marshal\", \"Marshall, Thurgood\", \"Justice Thurgood Marshall\", \"Thurgood Marshall\"]" ]
[ "Who got to no. 6 with ‘Games People Play’ in 1969?", "Name the 2009 animated movie from the IMDB plot summary: “The most delicious event since macaroni met cheese. Inspired by the beloved children’s book, the film focuses on a town where food falls from the sky like rain.”", "Which movement was thought to be responsible for the kidnapping of Western hostages in Lebanon in the 890s?", "Which city was founded by Sir Stamford Raffles as a trading settlement in 1819?", "What volcano in Washinton state erupted in 1980, killing 57 people?", "Which English composer produced the operas 'Artaxerxes', 'Love in a Village' and the 'Fairy Prince' in the decade 1761 to 1771?", "An oenophile is a connoisseur of what?", "In which Dickens novel would you find the Barnacle family?", "What is the name of the house in Cluedo in which the murder takes place", "Who was the President of the USA at the outbreak of the First World War?", "What is the title of a 1968 hit single by The Scaffold which is a modernisation of an older folk song called The Ballad of Lydia Pinkham’?", "At Dettingen in 1743 who was the last British monarch to lead his troops into battle?", "Into which body of water does the River Nene drain?", "British athlete Dai Green competes in which track event?", "President Lyndon B. Johnson nominated the first African American judge to the US Supreme Court. Who was it?" ]
15
[ 97830, 97831, 97832, 97833, 97834, 97835, 97836, 97837, 97838, 97839, 97840, 97841, 97842, 97843, 97844 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: His father was an MP. His mother was an MEP. His wife is a Prime Minister. Who was elected MP for Aberavon in the 2015 General Election?\nQuestion 2: There is one family of mammals that contains only two species: the Okapi and which other?\nQuestion 3: Which 1942 film starring Tim Holt, Joseph Cotton, Ray Collins, Agnes Moorehead, Dolores Costello and Richard Bennett was adapted by Orson Welles from a novel by Booth Tarkington?\nQuestion 4: What is the capital of Cameroon?\nQuestion 5: Mary Baker Eddy founded which religion?\nQuestion 6: O R Tambo airport serves which South African city?\nQuestion 7: In a standard game of chess, how many queens does each player start with?\nQuestion 8: What was the name of the pilot of Enola Gay, the bomber that dropped the atomic bomb on Hiroshima?\nQuestion 9: The novel ‘The Hound of the Baskervilles’, by Arthur Conan Doyle, is set on which English moor?\nQuestion 10: Who wrote and starred in the TV series Q7 and Q8?\nQuestion 11: What is a French word meaning false or fake?\nQuestion 12: Which anniversary is celebrated upon 25 years of marriage?\nQuestion 13: Who was the author of 1990 novel 'House of Cards'?\nQuestion 14: Battement tendu, Grand écart, Entrechat, Hortensia, and Sissonne are terms in what art form?\nQuestion 15: In August 1960 Chad, in Central Africa, became independent from which country?", "role": "user" } ]
["[\"The Honourable Stephen Kinnock\", \"Stephen Nathan Kinnock\", \"Stephen Kinnock\", \"STEPHEN KINNOCK\"]", "[\"GIRAFFE\", \"GIRAFFE Radar\"]", "[\"The Magnificant Ambersons\", \"Magnificent Ambersons\", \"The Magnificent Ambersons\"]", "[\"Jaunde Station\", \"Younde\", \"Capital of Cameroon\", \"Yaounde, Cameroon\", \"YAOUNDE\", \"Yound\\u00e9\", \"Jeundo\", \"Yaound\\u00e9, Cameroon\", \"Jaunde\", \"Yaounde\", \"Epsumb\", \"Yaunde Station\", \"Yaund\\u00e9 Station\", \"Yaound\\u00e9\"]", "[\"Lundman v. McKown\", \"Christ, scientist\", \"Scientific Statement of Being\", \"Christian Scientists\", \"Christian scientists\", \"Christian Science Board of Directors\", \"Christian Science Church\", \"Scientist Church of Christ\", \"Church of jesus christ, scientist\", \"The Church of Christ, Scientist\", \"Christian Science healing\", \"Christian scientist\", \"Christian Science\", \"The Christian Science Church\", \"Christian Scientist\", \"Christ Scientist\", \"Christian science\"]", "[\"Joberg\", \"Johannesburg\", \"Johannasberg\", \"Johannesburg, Southafrica\", \"Johannes-burg\", \"Johannesb'g\", \"JOHANNESBURG\", \"Yohannesburg\", \"Johannesburg, South Africa\", \"EGoli\", \"Johannesbourg\", \"Jhb\", \"Johansberg\", \"Johannesburg, Gauteng\", \"Jo'Bourg\", \"Johannesburg Civic Theatre\", \"Jozi\", \"Johannesburg, Transvaal\", \"Johannesgurg\", \"Joburg\", \"Johanessburg\", \"Visitor attractions in Johannesburg\", \"Jo'burg\", \"UN/LOCODE:ZAJNB\", \"Johanesburg\"]", "[\"1\", \"one\", \"One\"]", "[\"PAUL TIBBETS\", \"Paul W. Tibbets Jr\", \"Paul W. Tibbets Jr.\", \"Paul Warfield Tibbets, Jr.\", \"Enola Gay Tibbets\", \"Paul Warfield Tibbets\", \"Paul Tibbets Jr.\", \"Paul W. Tibbets, Jr.\", \"Paul Tibbets\", \"Paul Tibbetts\", \"Paul W. Tibbets\", \"Paul Warfield Tibbets, Jr\"]", "[\"Dartmoor\", \"Dartmoor National Park\", \"Okehayes Nursery\", \"Dartymoor\", \"Dartmoor National park\"]", "[\"Terence Alan Patrick Se\\u00e1n Milligan KBE\", \"Spike Milligan\", \"Terence Alan Patrick Se\\u00e1n Milligan\", \"SPIKE MILLIGAN\", \"Spike milligan\", \"Terence Alan Patrick Se\\u00e1n Milligan, KBE\"]", "[\"Faux\", \"FAUX\"]", "[\"ATC code D08AL30\", \"Ag+\", \"Element 47\", \"Argentical\", \"Silvermounted\", \"Silver mounted\", \"Silvern\", \"Silveriness\", \"Silverily\", \"\\ud83d\\udf1b\", \"Silver ions\", \"Argentate\", \"Native silver\", \"Argentic\", \"Element XLVII\", \"Argentically\", \"Silver processing\", \"Argentous\", \"Silver\", \"Silver compounds\", \"7440-22-4\", \"Silver (element)\", \"ATCvet code QD08AL30\", \"Silver-mounted\", \"E174\", \"Timcanpi\", \"Silverly\", \"Silverness\", \"Argentum\", \"Silver metallurgy\", \"Edible silver\", \"Silver (metal)\"]", "[\"Michael Dobbs (author)\", \"Lord Dobbs\", \"Michael Dobbs (UK author)\", \"Michael Dobbs, Baron Dobbs\", \"Michael Dobbs\", \"House of Cards (novel)\", \"Baron Dobbs\", \"Michael Dobbs (British author)\"]", "[\"Ballet\", \"Ballet competitions\", \"Ballet schools\", \"Balet, India\", \"Balletti\", \"Ballet dancing\", \"1938 ballet premieres\", \"Balletto\", \"Balletomane\", \"2011 ballet premieres\", \"1940 ballet premieres\", \"Balletomanes\", \"1939 ballet premieres\", \"Ballet characters\", \"Ballet teachers\", \"Ballet dance\", \"Classical Dance\", \"Ballets\", \"Ballet lessons\", \"1915 ballet premieres\", \"1914 ballet premieres\", \"Classical dance\", \"UN/LOCODE:INBLT\", \"1916 ballet premieres\", \"Balet\", \"Ballett\"]", "[\"La Republique francaise\", \"Franciaorsz\\u00e1g\", \"La Republique fran\\u00e7aise\", \"Belle France\", \"FRANCE\", \"Republique fran\\u00e7aise\", \"France\", \"Ranska\", \"Franciaorszag\", \"French Republic\", \"R\\u00e9publique francaise\", \"R\\u00e9publique fran\\u00e7aise\", \"ISO 3166-1:FR\", \"Frankreich\", \"France (country)\", \"Etymology of France\", \"FrancE\", \"La R\\u00e9publique fran\\u00e7aise\", \"People of France\", \"Republic of France\", \"Fracne\", \"Le France\", \"The French Republic\", \"Republique francaise\", \"The Republic of France\", \"La R\\u00e9publique francaise\", \"La France\", \"Rain in France\", \"Republic of france\", \"FRance\", \"Frakkland\", \"Climate of France\", \"Franse\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"The Honourable Stephen Kinnock\", \"Stephen Nathan Kinnock\", \"Stephen Kinnock\", \"STEPHEN KINNOCK\"]", "[\"GIRAFFE\", \"GIRAFFE Radar\"]", "[\"The Magnificant Ambersons\", \"Magnificent Ambersons\", \"The Magnificent Ambersons\"]", "[\"Jaunde Station\", \"Younde\", \"Capital of Cameroon\", \"Yaounde, Cameroon\", \"YAOUNDE\", \"Yound\\u00e9\", \"Jeundo\", \"Yaound\\u00e9, Cameroon\", \"Jaunde\", \"Yaounde\", \"Epsumb\", \"Yaunde Station\", \"Yaund\\u00e9 Station\", \"Yaound\\u00e9\"]", "[\"Lundman v. McKown\", \"Christ, scientist\", \"Scientific Statement of Being\", \"Christian Scientists\", \"Christian scientists\", \"Christian Science Board of Directors\", \"Christian Science Church\", \"Scientist Church of Christ\", \"Church of jesus christ, scientist\", \"The Church of Christ, Scientist\", \"Christian Science healing\", \"Christian scientist\", \"Christian Science\", \"The Christian Science Church\", \"Christian Scientist\", \"Christ Scientist\", \"Christian science\"]", "[\"Joberg\", \"Johannesburg\", \"Johannasberg\", \"Johannesburg, Southafrica\", \"Johannes-burg\", \"Johannesb'g\", \"JOHANNESBURG\", \"Yohannesburg\", \"Johannesburg, South Africa\", \"EGoli\", \"Johannesbourg\", \"Jhb\", \"Johansberg\", \"Johannesburg, Gauteng\", \"Jo'Bourg\", \"Johannesburg Civic Theatre\", \"Jozi\", \"Johannesburg, Transvaal\", \"Johannesgurg\", \"Joburg\", \"Johanessburg\", \"Visitor attractions in Johannesburg\", \"Jo'burg\", \"UN/LOCODE:ZAJNB\", \"Johanesburg\"]", "[\"1\", \"one\", \"One\"]", "[\"PAUL TIBBETS\", \"Paul W. Tibbets Jr\", \"Paul W. Tibbets Jr.\", \"Paul Warfield Tibbets, Jr.\", \"Enola Gay Tibbets\", \"Paul Warfield Tibbets\", \"Paul Tibbets Jr.\", \"Paul W. Tibbets, Jr.\", \"Paul Tibbets\", \"Paul Tibbetts\", \"Paul W. Tibbets\", \"Paul Warfield Tibbets, Jr\"]", "[\"Dartmoor\", \"Dartmoor National Park\", \"Okehayes Nursery\", \"Dartymoor\", \"Dartmoor National park\"]", "[\"Terence Alan Patrick Se\\u00e1n Milligan KBE\", \"Spike Milligan\", \"Terence Alan Patrick Se\\u00e1n Milligan\", \"SPIKE MILLIGAN\", \"Spike milligan\", \"Terence Alan Patrick Se\\u00e1n Milligan, KBE\"]", "[\"Faux\", \"FAUX\"]", "[\"ATC code D08AL30\", \"Ag+\", \"Element 47\", \"Argentical\", \"Silvermounted\", \"Silver mounted\", \"Silvern\", \"Silveriness\", \"Silverily\", \"\\ud83d\\udf1b\", \"Silver ions\", \"Argentate\", \"Native silver\", \"Argentic\", \"Element XLVII\", \"Argentically\", \"Silver processing\", \"Argentous\", \"Silver\", \"Silver compounds\", \"7440-22-4\", \"Silver (element)\", \"ATCvet code QD08AL30\", \"Silver-mounted\", \"E174\", \"Timcanpi\", \"Silverly\", \"Silverness\", \"Argentum\", \"Silver metallurgy\", \"Edible silver\", \"Silver (metal)\"]", "[\"Michael Dobbs (author)\", \"Lord Dobbs\", \"Michael Dobbs (UK author)\", \"Michael Dobbs, Baron Dobbs\", \"Michael Dobbs\", \"House of Cards (novel)\", \"Baron Dobbs\", \"Michael Dobbs (British author)\"]", "[\"Ballet\", \"Ballet competitions\", \"Ballet schools\", \"Balet, India\", \"Balletti\", \"Ballet dancing\", \"1938 ballet premieres\", \"Balletto\", \"Balletomane\", \"2011 ballet premieres\", \"1940 ballet premieres\", \"Balletomanes\", \"1939 ballet premieres\", \"Ballet characters\", \"Ballet teachers\", \"Ballet dance\", \"Classical Dance\", \"Ballets\", \"Ballet lessons\", \"1915 ballet premieres\", \"1914 ballet premieres\", \"Classical dance\", \"UN/LOCODE:INBLT\", \"1916 ballet premieres\", \"Balet\", \"Ballett\"]", "[\"La Republique francaise\", \"Franciaorsz\\u00e1g\", \"La Republique fran\\u00e7aise\", \"Belle France\", \"FRANCE\", \"Republique fran\\u00e7aise\", \"France\", \"Ranska\", \"Franciaorszag\", \"French Republic\", \"R\\u00e9publique francaise\", \"R\\u00e9publique fran\\u00e7aise\", \"ISO 3166-1:FR\", \"Frankreich\", \"France (country)\", \"Etymology of France\", \"FrancE\", \"La R\\u00e9publique fran\\u00e7aise\", \"People of France\", \"Republic of France\", \"Fracne\", \"Le France\", \"The French Republic\", \"Republique francaise\", \"The Republic of France\", \"La R\\u00e9publique francaise\", \"La France\", \"Rain in France\", \"Republic of france\", \"FRance\", \"Frakkland\", \"Climate of France\", \"Franse\"]" ]
[ "His father was an MP. His mother was an MEP. His wife is a Prime Minister. Who was elected MP for Aberavon in the 2015 General Election?", "There is one family of mammals that contains only two species: the Okapi and which other?", "Which 1942 film starring Tim Holt, Joseph Cotton, Ray Collins, Agnes Moorehead, Dolores Costello and Richard Bennett was adapted by Orson Welles from a novel by Booth Tarkington?", "What is the capital of Cameroon?", "Mary Baker Eddy founded which religion?", "O R Tambo airport serves which South African city?", "In a standard game of chess, how many queens does each player start with?", "What was the name of the pilot of Enola Gay, the bomber that dropped the atomic bomb on Hiroshima?", "The novel ‘The Hound of the Baskervilles’, by Arthur Conan Doyle, is set on which English moor?", "Who wrote and starred in the TV series Q7 and Q8?", "What is a French word meaning false or fake?", "Which anniversary is celebrated upon 25 years of marriage?", "Who was the author of 1990 novel 'House of Cards'?", "Battement tendu, Grand écart, Entrechat, Hortensia, and Sissonne are terms in what art form?", "In August 1960 Chad, in Central Africa, became independent from which country?" ]
15
[ 6585, 6586, 6587, 6588, 6589, 6590, 6591, 6592, 6593, 6594, 6595, 6596, 6597, 6598, 6599 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: In the US television show ‘The Sopranos’, what is the name of the nursing home in which Tony Soprano’s mother Livia lived?\nQuestion 2: How is Anne Catherick referred to in the title of a book by Wilkie Collins?\nQuestion 3: How many spikes are on the crown of The Statue of Liberty in New York USA?\nQuestion 4: In which decade did the Gordon Riots take place?\nQuestion 5: \"For what television series was the theme tune \"\"I could be so good for you\"\"?\"\nQuestion 6: By what nickname was the comic book character 'Alf Tupper' known?\nQuestion 7: What controversial politician sought to sell AC Milan in 2015 to finance his quest for rehabiliation and power?\nQuestion 8: \"If someone is eating \"\"longpig\"\" what type of flesh are they eating?\"\nQuestion 9: In the Bible, what is the Decalogue more commonly known as?\nQuestion 10: Which car company was formed in 1908 by the merger of Buick and Oldsmobile?\nQuestion 11: What in Spanish what does the song-title, 'Que Sera, Sera,' mean (loosely, not grammatically correctly)?\nQuestion 12: In Greek mythology Argus Panoptes, guardian of the heifer-nymph Io and son of Arestor, was a primordial giant described as having multiple, often one hundred, what?\nQuestion 13: Which radio station became BBC Radio Four in 1967?\nQuestion 14: Which dynasty has ruled the Netherlands since 1815?\nQuestion 15: In which city is the Amalienborg Palace?", "role": "user" } ]
["[\"Green Grove\"]", "[\"Woman in white\", \"The Woman in White (disambiguation)\", \"The Woman In White\", \"The Woman in White (film)\", \"Woman in White\", \"The Woman in white (disambiguation)\", \"The woman in white\", \"The Woman in White\"]", "[\"Seven\", \"seven\", \"7\"]", "[\"1780-1789\", \"1780s\", \"1780\\u20131789\", \"Seventeen-eighties\"]", "[\"The Minder (film)\", \"The Minder\", \"El Custodio\", \"MINDER\"]", "[\"Alf tupper\", \"'THE TOUGH OF THE TRACK'\", \"The Tough of the Track\", \"Alf Tupper\"]", "[\"Berusconi\", \"Massimo Tartaglia\", \"Noemigate\", \"Noemi Letizia\", \"Il Cavaliere\", \"Papi Silvio\", \"Berlosconi\", \"Massimo tartaglia\", \"2011 resignation of Silvio Berlusconi\", \"Berluscone\", \"Silvio Berlusconi Controversy\", \"Berlusconian\", \"Mr Berlusconi\", \"Barigate\", \"Silvio Berlusconi\", \"Berlusconi\", \"Papigate\"]", "[\"Human species\", \"Humans as primates\", \"Human\", \"Human Being\", \"Man (anthropology and biology)\", \"Human being\", \"Terran (Homo Sapien)\", \"Humans\", \"All Humankind\", \"Human habitat and population\", \"Humano\", \"Human kind\", \"People of this planet\", \"Humankind\", \"Huamn\", \"Human Beings\", \"Human race\", \"Human beings\", \"Human habitat\"]", "[\"Non occides\", \"10 Commandments\", \"Aseret haDibrot\", \"Ten Commandmants\", \"Ten Commandments, The\", \"The Decalogue\", \"The Ten commandments\", \"Exodus 20\", \"Ten Commandments Rulings\", \"10 commandments\", \"Deuteronomy 5\", \"Ten commandments\", \"Decalogo\", \"The 10 Commandments\", \"La Dekologo\", \"The ten commandments\", \"10 comandments\", \"Ten Commandments rulings\", \"The Ten Words\", \"Ethical decalogue\", \"Exodus-20 Decalogue\", \"Deuteronomy 5 Decalogue\", \"Ten Commandments Ruling\", \"Ten Commandments\", \"Revelation at sinai\", \"10 laws of god\", \"Decalogue\", \"Les Dix Commandements\", \"The 10 commandments\", \"Ten comandements\", \"Decalog\", \"Ethical Decalogue\", \"Ten Commandments ruling\", \"Revelation at Sinai\", \"Deuteronomy-5 Decalogue\", \"Sinaitic revelation\", \"The Ten Commandments\", \"Commandments of God (The Ten Commandments)\", \"Sinai Revelation\", \"Exodus 20 Decalogue\"]", "[\"General motors\", \"Detroit GM\", \"Vehicle Acquisition Holdings\", \"New GM\", \"General Motors 50th Anniversary Show\", \"GM Motors\", \"General Motors Corp.\", \"General Motors Company LLC\", \"Micky Bly\", \"Vehicle Acquisition Holdings LLC\", \"GM Powertrain\", \"The GM Company\", \"General Motors Corporation LLC\", \"General Moters\", \"General Motors\", \"General Motors Corporation\", \"General Motors Company\"]", "[\"Whatever Will Be, Will Be\", \"Whatever will be will be\", \"Whatever Will Be, Will Be (movie)\", \"Whatever Will Be Will Be\"]", "[\"Eye (anatomy)\", \"Eye\", \"Eye balls\", \"Schizochroal eye\", \"Ocular globe\", \"Ommateum\", \"Simple eye\", \"Oculars\", \"Animal eyes\", \"Eyes\", \"Compound Eyes\", \"Apposition eye\", \"Robotic eye\", \"Eye ball\", \"Facet eyes\", \"Compound Eye\", \"Conjunctival disorders\", \"Compound eyes\", \"Eyeball\", \"Cyber-eye\", \"Eye (vertebrate)\", \"Eye (invertebrate)\", \"Ommotidium\", \"Fly's eye lens\", \"Peeper (organ)\", \"Camera-type eye\", \"Ocular\", \"Compound eye\", \"Eye membrane\", \"Pinhole eye\"]", "[\"Home Service\", \"Home Service (folk-rock group)\", \"The Home Service\"]", "[\"Huis van Oranje-Nassau\", \"Nassau-Orange\", \"Oranje-Nassau\", \"Prince of Orange-Nassau\", \"Oranje Nassau\", \"Royal House of Netherlands\", \"House of Orange\", \"Orange-Nassau dynasty\", \"House of Oranje-Nassau\", \"House of Orange-Nassau\", \"Royal House of the Netherlands\", \"HOUSE OF ORANGE\", \"The House Of Orange\"]", "[\"K\\u00f8benhavn, Denmark\", \"K-Town, Copenhagen\", \"UN/LOCODE:DKCPH\", \"Copenhagen, Denmark\", \"Koepenhamn\", \"K-Town Hardcore\", \"Capital of Denmark\", \"Ktown Hardcore\", \"Copenhague\", \"Kaupmannah\\u00f6fn\", \"Kaupmannahofn\", \"Kopenhamn\", \"Koebenhavn\", \"K Town Hardcore\", \"K\\u00f6penhamn\", \"Kopenhagen\", \"K\\u00f8benhavn\", \"Hafnia (Latin)\", \"Kj\\u00f8benhavn\", \"K Town punk\", \"Kobenhavn\", \"Copenhagen (Denmark)\", \"K-Town punk\", \"Copenhagen\", \"DKCPH\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Green Grove\"]", "[\"Woman in white\", \"The Woman in White (disambiguation)\", \"The Woman In White\", \"The Woman in White (film)\", \"Woman in White\", \"The Woman in white (disambiguation)\", \"The woman in white\", \"The Woman in White\"]", "[\"Seven\", \"seven\", \"7\"]", "[\"1780-1789\", \"1780s\", \"1780\\u20131789\", \"Seventeen-eighties\"]", "[\"The Minder (film)\", \"The Minder\", \"El Custodio\", \"MINDER\"]", "[\"Alf tupper\", \"'THE TOUGH OF THE TRACK'\", \"The Tough of the Track\", \"Alf Tupper\"]", "[\"Berusconi\", \"Massimo Tartaglia\", \"Noemigate\", \"Noemi Letizia\", \"Il Cavaliere\", \"Papi Silvio\", \"Berlosconi\", \"Massimo tartaglia\", \"2011 resignation of Silvio Berlusconi\", \"Berluscone\", \"Silvio Berlusconi Controversy\", \"Berlusconian\", \"Mr Berlusconi\", \"Barigate\", \"Silvio Berlusconi\", \"Berlusconi\", \"Papigate\"]", "[\"Human species\", \"Humans as primates\", \"Human\", \"Human Being\", \"Man (anthropology and biology)\", \"Human being\", \"Terran (Homo Sapien)\", \"Humans\", \"All Humankind\", \"Human habitat and population\", \"Humano\", \"Human kind\", \"People of this planet\", \"Humankind\", \"Huamn\", \"Human Beings\", \"Human race\", \"Human beings\", \"Human habitat\"]", "[\"Non occides\", \"10 Commandments\", \"Aseret haDibrot\", \"Ten Commandmants\", \"Ten Commandments, The\", \"The Decalogue\", \"The Ten commandments\", \"Exodus 20\", \"Ten Commandments Rulings\", \"10 commandments\", \"Deuteronomy 5\", \"Ten commandments\", \"Decalogo\", \"The 10 Commandments\", \"La Dekologo\", \"The ten commandments\", \"10 comandments\", \"Ten Commandments rulings\", \"The Ten Words\", \"Ethical decalogue\", \"Exodus-20 Decalogue\", \"Deuteronomy 5 Decalogue\", \"Ten Commandments Ruling\", \"Ten Commandments\", \"Revelation at sinai\", \"10 laws of god\", \"Decalogue\", \"Les Dix Commandements\", \"The 10 commandments\", \"Ten comandements\", \"Decalog\", \"Ethical Decalogue\", \"Ten Commandments ruling\", \"Revelation at Sinai\", \"Deuteronomy-5 Decalogue\", \"Sinaitic revelation\", \"The Ten Commandments\", \"Commandments of God (The Ten Commandments)\", \"Sinai Revelation\", \"Exodus 20 Decalogue\"]", "[\"General motors\", \"Detroit GM\", \"Vehicle Acquisition Holdings\", \"New GM\", \"General Motors 50th Anniversary Show\", \"GM Motors\", \"General Motors Corp.\", \"General Motors Company LLC\", \"Micky Bly\", \"Vehicle Acquisition Holdings LLC\", \"GM Powertrain\", \"The GM Company\", \"General Motors Corporation LLC\", \"General Moters\", \"General Motors\", \"General Motors Corporation\", \"General Motors Company\"]", "[\"Whatever Will Be, Will Be\", \"Whatever will be will be\", \"Whatever Will Be, Will Be (movie)\", \"Whatever Will Be Will Be\"]", "[\"Eye (anatomy)\", \"Eye\", \"Eye balls\", \"Schizochroal eye\", \"Ocular globe\", \"Ommateum\", \"Simple eye\", \"Oculars\", \"Animal eyes\", \"Eyes\", \"Compound Eyes\", \"Apposition eye\", \"Robotic eye\", \"Eye ball\", \"Facet eyes\", \"Compound Eye\", \"Conjunctival disorders\", \"Compound eyes\", \"Eyeball\", \"Cyber-eye\", \"Eye (vertebrate)\", \"Eye (invertebrate)\", \"Ommotidium\", \"Fly's eye lens\", \"Peeper (organ)\", \"Camera-type eye\", \"Ocular\", \"Compound eye\", \"Eye membrane\", \"Pinhole eye\"]", "[\"Home Service\", \"Home Service (folk-rock group)\", \"The Home Service\"]", "[\"Huis van Oranje-Nassau\", \"Nassau-Orange\", \"Oranje-Nassau\", \"Prince of Orange-Nassau\", \"Oranje Nassau\", \"Royal House of Netherlands\", \"House of Orange\", \"Orange-Nassau dynasty\", \"House of Oranje-Nassau\", \"House of Orange-Nassau\", \"Royal House of the Netherlands\", \"HOUSE OF ORANGE\", \"The House Of Orange\"]", "[\"K\\u00f8benhavn, Denmark\", \"K-Town, Copenhagen\", \"UN/LOCODE:DKCPH\", \"Copenhagen, Denmark\", \"Koepenhamn\", \"K-Town Hardcore\", \"Capital of Denmark\", \"Ktown Hardcore\", \"Copenhague\", \"Kaupmannah\\u00f6fn\", \"Kaupmannahofn\", \"Kopenhamn\", \"Koebenhavn\", \"K Town Hardcore\", \"K\\u00f6penhamn\", \"Kopenhagen\", \"K\\u00f8benhavn\", \"Hafnia (Latin)\", \"Kj\\u00f8benhavn\", \"K Town punk\", \"Kobenhavn\", \"Copenhagen (Denmark)\", \"K-Town punk\", \"Copenhagen\", \"DKCPH\"]" ]
[ "In the US television show ‘The Sopranos’, what is the name of the nursing home in which Tony Soprano’s mother Livia lived?", "How is Anne Catherick referred to in the title of a book by Wilkie Collins?", "How many spikes are on the crown of The Statue of Liberty in New York USA?", "In which decade did the Gordon Riots take place?", "\"For what television series was the theme tune \"\"I could be so good for you\"\"?\"", "By what nickname was the comic book character 'Alf Tupper' known?", "What controversial politician sought to sell AC Milan in 2015 to finance his quest for rehabiliation and power?", "\"If someone is eating \"\"longpig\"\" what type of flesh are they eating?\"", "In the Bible, what is the Decalogue more commonly known as?", "Which car company was formed in 1908 by the merger of Buick and Oldsmobile?", "What in Spanish what does the song-title, 'Que Sera, Sera,' mean (loosely, not grammatically correctly)?", "In Greek mythology Argus Panoptes, guardian of the heifer-nymph Io and son of Arestor, was a primordial giant described as having multiple, often one hundred, what?", "Which radio station became BBC Radio Four in 1967?", "Which dynasty has ruled the Netherlands since 1815?", "In which city is the Amalienborg Palace?" ]
15
[ 115410, 115411, 115412, 115413, 115414, 115415, 115416, 115417, 115418, 115419, 115420, 115421, 115422, 115423, 115424 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Who is the only US president to have served two non-consecutive terms and is therefore counted as both the 22nd and 24th president?\nQuestion 2: \"Which comedian played the title role in the 1963 film, \"\"The Punch and Judy Man\"\"?\"\nQuestion 3: What is the name of the traditional stiff skirt worn by Greek and Albanian men?\nQuestion 4: Who were Great Uncle Bulgaria, Tobermory, Orinoco, Bungo, Tomsk, Wellington and Madame Cholet?\nQuestion 5: Which king did Henry Bolingbroke depose, and then succeed as Henry IV in 1399?\nQuestion 6: Greetings from Asbury Park, NJ was the 1973 debut album of which artist?\nQuestion 7: Six teenagers are aged 13, 13, 14, 16, 18, and 19. What is the median of their ages?\nQuestion 8: Rita O'Grady is the leading character in which film, made into a musical that opened in London last year starring Gemma Arterton?\nQuestion 9: What was the nickname of the U.S. basketball team at the Barcelona Olympics\nQuestion 10: In the Shakespeare play ‘Macbeth’ who kills Macbeth?\nQuestion 11: \"Whose first book, published in 1920, was \"\"The Mysterious Affair at Styles\"\"?\"\nQuestion 12: How many keys are there on a standard piano keyboard?\nQuestion 13: Castoreum is used as a food additive and in some perfumes. It is obtained from the scent glands of which member of the rodent family?\nQuestion 14: In which series of films would you find a hairless cat called Mr Bigglesworth?\nQuestion 15: N'djamena is the capital of which country?", "role": "user" } ]
["[\"Stephen Cleveland\", \"President Grover Cleveland\", \"Stephen Grover Cleveland\", \"Stephen G. Cleveland\", \"Grover Clevland\", \"22nd President of the United States\", \"President Cleveland\", \"22nd and 24th President of the United States\", \"S. Grover Cleveland\", \"Presidency of Grover Cleveland\", \"24th President of the United States\", \"S. G. Cleveland\", \"Cleveland Administration\", \"Grover Cleveland\", \"Cleveland, Grover\"]", "[\"Tony Hancock\"]", "[\"Fustanella\", \"Foustanella\"]", "[\"Wombles\", \"Wombles of wimbledon\", \"Wimbles\", \"Orinoco (Wombles)\", \"Bulgaria (Wombles)\", \"Great Uncle Bulgaria\", \"Madame Cholet\", \"Womble\", \"Tobermory (Wombles)\", \"The Wombles\"]", "[\"Richard ii\", \"Richard II, King of the English\", \"Richard, Duke of Cornwall\", \"Richard II (England)\", \"Richard II, King of England\", \"Richard II\", \"King Richard II of England\", \"RICHARD II\", \"King Richard II\", \"Richard II of england\", \"Richard II of England\"]", "[\"Bruce Springsteen and The E Street Band\", \"Bruce Springsteen & the E-Street Band\", \"Bruce Springsteen & The E-Street Band\", \"Bruce Frederick Springsteen\", \"Bruce %22The Boss%22 Springsteen\", \"Springstein\", \"Bruce Springsteen & the E Street Band\", \"Bruce Springstein\", \"Bruce Springsteen's awards and honors\", \"Bruce Springsteen\", \"Springsteen\", \"Bruce Springsteen and the E Street Band\", \"Bruce Springstein and The E Street Band\", \"Bruce springsteen\", \"Springsteen, Bruce\", \"Bruce Springstien\", \"Bruce Springsteen and the E-Street Band\", \"Bruce Springsteen & The E Street Band\", \"Bruce Frederick Joseph Springsteen\"]", "[\"15\", \"fifteen\", \"FIFTEEN\"]", "[\"Made in Dagenham\", \"MADE IN DAGENHAM\", \"We Want Sex\"]", "[\"The Dream Team (TDT)\", \"World team\", \"Dream team\", \"Dream Team (pornographic film)\", \"The dream team\", \"Dream Team (disambiguation)\", \"Dream Team\", \"The Dream Team\"]", "[\"Macduff (disambiguation)\", \"MacDuff\", \"Macduff\"]", "[\"Christie Estate\", \"Agatha Christie DBE\", \"Agatha cristie\", \"Agatha Christie's\", \"Dame Agatha Mary Clarissa Christie\", \"Agatha Mary Clarissa\", \"Agatha Mary Clarissa, Lady Mallowan, DBE (nee Miller)\", \"Christie estate\", \"Agatha Christy\", \"Dame Agatha Christie\", \"Christie, Agatha\", \"Mary Westmacott\", \"Agatha Mary Clarissa Christie\", \"Tropes in Agatha Christie's novels\", \"Agatha Mary Clarissa, Lady Mallowan\", \"Christie, Dame Agatha Mary Clarissa\", \"Dame Agatha Mary Clarissa Miller, Lady Mallowan, DBE\", \"Plot devices in Agatha Christie's novels\", \"Lady Mallowan\", \"Agatha Christie Ltd.\", \"Dame Agatha Mary Clarissa, Lady Mallowan, DBE\", \"Agasta Christie\", \"Agatha Clarissa\", \"Agatha Mary Clarissa, Dame Christie\", \"Agatha Christie\", \"Lady Agatha Mallowan\", \"Agathe Christie\", \"Agartha Christie\", \"Agatha Mallowan\", \"Agatha mary\", \"Agathe Christi\", \"Agatha Christie, DBE\", \"Agatha christie\", \"Agatha Mary Clarissa, Lady Mallowan, DBE\", \"Agatha Miller\", \"Agatha Mary Clarissa Miller\"]", "[\"eighty-eight\", \"88\"]", "[\"Beaverdams\", \"Beaver house\", \"Beavers\", \"Beaver pelt\", \"Beever\", \"Salt water beavers\", \"Beaverdam (habitat)\", \"Beaver\", \"Castor (zoology)\", \"Castor (genus)\", \"Beaver lodge\", \"Beaver houses\"]", "[\"Austinpowerism\", \"Sir Austin Danger Powers\", \"Oh behave\", \"Austin powers\", \"Austen Powers\", \"Austin Powers (disambiguation)\", \"Freaky deaky Dutch\", \"Austin Danger Powers\", \"Austin power\", \"Auston Powers\", \"Austin Powers\"]", "[\"\\u062a\\u0634\\u0627\\u062f\", \"Republique du Tchad\", \"T\\u0161\\u0101d\", \"Republic of Chad\", \"R\\u00e9publique du Tchad\", \"Chade\", \"Chad\", \"Tsh\\u0101d\", \"ISO 3166-1:TD\", \"Chad (country)\", \"The Chad\", \"\\u062c\\u0645\\u0647\\u0648\\u0631\\u064a\\u0629 \\u062a\\u0634\\u0627\\u062f\", \"Tsjad\", \"Chadian Republic\", \"Tschad\", \"Gumhuriyyat T\\u0161ad\", \"Culture of Chad\", \"Tchad\", \"\\u01e6umh\\u016briyyat T\\u0161\\u0101d\", \"Jumh\\u016briyyat Tsh\\u0101d\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Stephen Cleveland\", \"President Grover Cleveland\", \"Stephen Grover Cleveland\", \"Stephen G. Cleveland\", \"Grover Clevland\", \"22nd President of the United States\", \"President Cleveland\", \"22nd and 24th President of the United States\", \"S. Grover Cleveland\", \"Presidency of Grover Cleveland\", \"24th President of the United States\", \"S. G. Cleveland\", \"Cleveland Administration\", \"Grover Cleveland\", \"Cleveland, Grover\"]", "[\"Tony Hancock\"]", "[\"Fustanella\", \"Foustanella\"]", "[\"Wombles\", \"Wombles of wimbledon\", \"Wimbles\", \"Orinoco (Wombles)\", \"Bulgaria (Wombles)\", \"Great Uncle Bulgaria\", \"Madame Cholet\", \"Womble\", \"Tobermory (Wombles)\", \"The Wombles\"]", "[\"Richard ii\", \"Richard II, King of the English\", \"Richard, Duke of Cornwall\", \"Richard II (England)\", \"Richard II, King of England\", \"Richard II\", \"King Richard II of England\", \"RICHARD II\", \"King Richard II\", \"Richard II of england\", \"Richard II of England\"]", "[\"Bruce Springsteen and The E Street Band\", \"Bruce Springsteen & the E-Street Band\", \"Bruce Springsteen & The E-Street Band\", \"Bruce Frederick Springsteen\", \"Bruce %22The Boss%22 Springsteen\", \"Springstein\", \"Bruce Springsteen & the E Street Band\", \"Bruce Springstein\", \"Bruce Springsteen's awards and honors\", \"Bruce Springsteen\", \"Springsteen\", \"Bruce Springsteen and the E Street Band\", \"Bruce Springstein and The E Street Band\", \"Bruce springsteen\", \"Springsteen, Bruce\", \"Bruce Springstien\", \"Bruce Springsteen and the E-Street Band\", \"Bruce Springsteen & The E Street Band\", \"Bruce Frederick Joseph Springsteen\"]", "[\"15\", \"fifteen\", \"FIFTEEN\"]", "[\"Made in Dagenham\", \"MADE IN DAGENHAM\", \"We Want Sex\"]", "[\"The Dream Team (TDT)\", \"World team\", \"Dream team\", \"Dream Team (pornographic film)\", \"The dream team\", \"Dream Team (disambiguation)\", \"Dream Team\", \"The Dream Team\"]", "[\"Macduff (disambiguation)\", \"MacDuff\", \"Macduff\"]", "[\"Christie Estate\", \"Agatha Christie DBE\", \"Agatha cristie\", \"Agatha Christie's\", \"Dame Agatha Mary Clarissa Christie\", \"Agatha Mary Clarissa\", \"Agatha Mary Clarissa, Lady Mallowan, DBE (nee Miller)\", \"Christie estate\", \"Agatha Christy\", \"Dame Agatha Christie\", \"Christie, Agatha\", \"Mary Westmacott\", \"Agatha Mary Clarissa Christie\", \"Tropes in Agatha Christie's novels\", \"Agatha Mary Clarissa, Lady Mallowan\", \"Christie, Dame Agatha Mary Clarissa\", \"Dame Agatha Mary Clarissa Miller, Lady Mallowan, DBE\", \"Plot devices in Agatha Christie's novels\", \"Lady Mallowan\", \"Agatha Christie Ltd.\", \"Dame Agatha Mary Clarissa, Lady Mallowan, DBE\", \"Agasta Christie\", \"Agatha Clarissa\", \"Agatha Mary Clarissa, Dame Christie\", \"Agatha Christie\", \"Lady Agatha Mallowan\", \"Agathe Christie\", \"Agartha Christie\", \"Agatha Mallowan\", \"Agatha mary\", \"Agathe Christi\", \"Agatha Christie, DBE\", \"Agatha christie\", \"Agatha Mary Clarissa, Lady Mallowan, DBE\", \"Agatha Miller\", \"Agatha Mary Clarissa Miller\"]", "[\"eighty-eight\", \"88\"]", "[\"Beaverdams\", \"Beaver house\", \"Beavers\", \"Beaver pelt\", \"Beever\", \"Salt water beavers\", \"Beaverdam (habitat)\", \"Beaver\", \"Castor (zoology)\", \"Castor (genus)\", \"Beaver lodge\", \"Beaver houses\"]", "[\"Austinpowerism\", \"Sir Austin Danger Powers\", \"Oh behave\", \"Austin powers\", \"Austen Powers\", \"Austin Powers (disambiguation)\", \"Freaky deaky Dutch\", \"Austin Danger Powers\", \"Austin power\", \"Auston Powers\", \"Austin Powers\"]", "[\"\\u062a\\u0634\\u0627\\u062f\", \"Republique du Tchad\", \"T\\u0161\\u0101d\", \"Republic of Chad\", \"R\\u00e9publique du Tchad\", \"Chade\", \"Chad\", \"Tsh\\u0101d\", \"ISO 3166-1:TD\", \"Chad (country)\", \"The Chad\", \"\\u062c\\u0645\\u0647\\u0648\\u0631\\u064a\\u0629 \\u062a\\u0634\\u0627\\u062f\", \"Tsjad\", \"Chadian Republic\", \"Tschad\", \"Gumhuriyyat T\\u0161ad\", \"Culture of Chad\", \"Tchad\", \"\\u01e6umh\\u016briyyat T\\u0161\\u0101d\", \"Jumh\\u016briyyat Tsh\\u0101d\"]" ]
[ "Who is the only US president to have served two non-consecutive terms and is therefore counted as both the 22nd and 24th president?", "\"Which comedian played the title role in the 1963 film, \"\"The Punch and Judy Man\"\"?\"", "What is the name of the traditional stiff skirt worn by Greek and Albanian men?", "Who were Great Uncle Bulgaria, Tobermory, Orinoco, Bungo, Tomsk, Wellington and Madame Cholet?", "Which king did Henry Bolingbroke depose, and then succeed as Henry IV in 1399?", "Greetings from Asbury Park, NJ was the 1973 debut album of which artist?", "Six teenagers are aged 13, 13, 14, 16, 18, and 19. What is the median of their ages?", "Rita O'Grady is the leading character in which film, made into a musical that opened in London last year starring Gemma Arterton?", "What was the nickname of the U.S. basketball team at the Barcelona Olympics", "In the Shakespeare play ‘Macbeth’ who kills Macbeth?", "\"Whose first book, published in 1920, was \"\"The Mysterious Affair at Styles\"\"?\"", "How many keys are there on a standard piano keyboard?", "Castoreum is used as a food additive and in some perfumes. It is obtained from the scent glands of which member of the rodent family?", "In which series of films would you find a hairless cat called Mr Bigglesworth?", "N'djamena is the capital of which country?" ]
15
[ 76575, 76576, 76577, 76578, 76579, 76580, 76581, 76582, 76583, 76584, 76585, 76586, 76587, 76588, 76589 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: In which county is Eton school\nQuestion 2: Claudia was the first name of the wife of which US President?\nQuestion 3: In kilometres, how long is the coastline of Brazil?\nQuestion 4: In astronomy, what term describes the point in the orbit of a planet or comet at which it is farthest from the Sun?\nQuestion 5: \"Who wrote, the 2011 novel about Sherlock Holmes called, 'The House of Silk\"\"?\"\nQuestion 6: According to the common saying, what is nine-tenths of the law?\nQuestion 7: Which architect worked with Sir Charles Barry on the new Palace of Westminster?\nQuestion 8: According to Zuzu Bailey, what happens every time a bell rings?\nQuestion 9: The Old Testament contains two instances of talking animals, the serpent in the garden is one, name the other?\nQuestion 10: Winston Churchill had a dog - what type?\nQuestion 11: NaCl is the chemical compound of which common substance?\nQuestion 12: What is the meaning of the prefix Kil- or Cill- in Irish place names?\nQuestion 13: The 1792 Battle of Valmy in which a citizen army defeated the Prussian army is significant for saving/preserving what?\nQuestion 14: What type of lens bends parallel rays inwards: convex or concave?\nQuestion 15: \"What was the three word name of the manwith the gong in the \"\"yes or no\"\" interlude in the 1960s game show Take Your Pick?\"", "role": "user" } ]
["[\"Berkshire, England\", \"Highway, Berkshire\", \"Royal Country of Berkshire\", \"Berkshire\", \"Royal Berkshire\", \"County of Berkshire\", \"Royal County of Berkshire\", \"County of Berks\"]", "[\"Rebekah Baines\", \"President Lyndon B Johnson\", \"President Lyndon Baines Johnson\", \"Presidency of Lyndon Baines Johnson\", \"All I have I would have given gladly...\", \"President Lyndon B. Johnson\", \"Lyndon b. johnson\", \"L. Johnson Administration\", \"Johnson, Lyndon Baines\", \"President lbj\", \"Lyndon Johnson Administration\", \"Lindon B. Johnson\", \"L. B. J.\", \"Lyndon b johnson\", \"Lyndon B. Johnson Administration\", \"LBJ\", \"L.B.J.\", \"President LBJ\", \"Lyndon Johnson\", \"36th President of the United States\", \"L B J\", \"Lindon Johnson\", \"Howard University Speech\", \"Lyndon Banes Johnson\", \"Lyndon Baines Johnson Administration\", \"Lyndon B. Johnson\", \"President Lyndon Johnson\", \"Lyndon Baynes Johnson\", \"Lyndon johnson\", \"L. B. Johnson Administration\", \"Lyndon B Johnson\", \"Rebekah Baines Johnson\", \"Lyndon Baines Johnson\", \"Lbj\", \"Presidency of Lyndon B. Johnson\"]", "[\"7491 distance\", \"seven thousand, four hundred and ninety-one distance\", \"7,491 km\"]", "[\"Perihelion and aphelion\", \"Perihelion\", \"Aphelion\", \"APHELION\", \"Aphelion and perihelion\"]", "[\"(Anthony) HOROWITZ\", \"Anthony Horowitz\"]", "[\"Possession\", \"Possession (2012 film)\", \"Possessions\", \"Possession (disambiguation)\", \"Possessor (disambiguation)\", \"Posession\", \"Possess (disambiguation)\", \"Possessor\", \"Possession (film)\", \"Possess\", \"Possesion\", \"Possession (movie)\", \"Possession (album)\", \"Possession (song)\"]", "[\"A.W. Pugin\", \"A W Pugin\", \"A.N. Welby Pugin\", \"Pugin, Augustus Welby Northmore\", \"AW Pugin\", \"Augustus Welby Pugin\", \"August Pugin\", \"A.W.N. Pugin\", \"Augustus Pugin\", \"A. W. Pugin\", \"Augustus PUGIN\", \"AWN Pugin\", \"A W N Pugin\", \"Pugin\", \"Augustus Welby Northmore Pugin\", \"A. W. N. Pugin\"]", "[\"An angel gets his wings\"]", "[\"\\u05d1\\u05b4\\u05bc\\u05dc\\u05b0\\u05e2\\u05b8\\u05dd\", \"Bil'am\", \"Balaam's ass\", \"Islamic view of Balaam\", \"BALAAM'S ASS\", \"Bileam\", \"\\u05d1\\u05dc\\u05e2\\u05dd\", \"Bilam\", \"Balaam\", \"Balaam's donkey\", \"Bilaam\"]", "[\"Corded poodle\", \"Caniche\", \"Poodle (Standard)\", \"Poodle\", \"Poodles\", \"Pomeranian Poodle\", \"Standard Poodle\", \"Canis aquaticus\", \"Teacup Poodle\", \"Poodle dog\", \"\\ud83d\\udc29\", \"Miniature poodle\", \"Poodle (Miniature)\", \"Medium Poodle\", \"Poodle (Toy)\", \"Toy poodle\", \"Poodle wool\", \"Miniature Poodle\", \"Toy Poodles\", \"French Poodle\", \"Tea cup poodle\", \"Poodle-dog\", \"Toy Poodle\", \"Corded Poodle\", \"StandardPoodle\", \"Standard poodle\"]", "[\"ATC code B05CB01\", \"Halite structure\", \"ATCvet code QB05CB01\", \"NaCl\", \"Sodium chloride\", \"Salt (sodium chloride)\", \"Natrium chloride\", \"Natrum Mur.\", \"ATCvet code QA12CA01\", \"Na Cl\", \"ATC code B05XA03\", \"NaCL\", \"Sodium Chloride\", \"Sodium chlorine\", \"NACL\", \"Salt (Sodium Chloride)\", \"Broncho Saline\", \"ATCvet code QB05XA03\", \"Road salt\", \"Nacl\", \"ATC code A12CA01\", \"Muriate of soda\", \"NaCl structure\"]", "[\"Tserkov\", \"Church sign\", \"The Church\", \"Ecclesiastical affair\", \"Ecclesiastical affairs\", \"Church (disambiguation)\", \"Church ward\", \"Church\", \"Churches\", \"Church (ward)\"]", "[\"French Revolution of 1789\", \"French Revolution\", \"French revolutionary\", \"1789 French Revolution\", \"French revolutionary era\", \"French revolution\", \"French Revolutionary\", \"R\\u00e9volution Fran\\u00e7aise\", \"1789 Revolution\", \"French Revolutionary period\", \"R\\u00e9volution\", \"French Revolution up to the storming of the Bastille\", \"French Revolutionaries\", \"Revolution of France\", \"Great Revolution\", \"R\\u00e9volution fran\\u00e7aise\", \"Revolutionary France\", \"French revolutionist\", \"1789 revolution\", \"La Revolution francaise\", \"Great French Revolution\", \"French revolutionaries\", \"French revoultion\", \"Great revolution\", \"Revolution in France\", \"The French Revolution\", \"Roles of women in the french revolution\", \"French Rev\"]", "[\"Convex (disambiguation)\", \"Convexity\", \"Convex\"]", "[\"BOB DANVERS WALKER\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Berkshire, England\", \"Highway, Berkshire\", \"Royal Country of Berkshire\", \"Berkshire\", \"Royal Berkshire\", \"County of Berkshire\", \"Royal County of Berkshire\", \"County of Berks\"]", "[\"Rebekah Baines\", \"President Lyndon B Johnson\", \"President Lyndon Baines Johnson\", \"Presidency of Lyndon Baines Johnson\", \"All I have I would have given gladly...\", \"President Lyndon B. Johnson\", \"Lyndon b. johnson\", \"L. Johnson Administration\", \"Johnson, Lyndon Baines\", \"President lbj\", \"Lyndon Johnson Administration\", \"Lindon B. Johnson\", \"L. B. J.\", \"Lyndon b johnson\", \"Lyndon B. Johnson Administration\", \"LBJ\", \"L.B.J.\", \"President LBJ\", \"Lyndon Johnson\", \"36th President of the United States\", \"L B J\", \"Lindon Johnson\", \"Howard University Speech\", \"Lyndon Banes Johnson\", \"Lyndon Baines Johnson Administration\", \"Lyndon B. Johnson\", \"President Lyndon Johnson\", \"Lyndon Baynes Johnson\", \"Lyndon johnson\", \"L. B. Johnson Administration\", \"Lyndon B Johnson\", \"Rebekah Baines Johnson\", \"Lyndon Baines Johnson\", \"Lbj\", \"Presidency of Lyndon B. Johnson\"]", "[\"7491 distance\", \"seven thousand, four hundred and ninety-one distance\", \"7,491 km\"]", "[\"Perihelion and aphelion\", \"Perihelion\", \"Aphelion\", \"APHELION\", \"Aphelion and perihelion\"]", "[\"(Anthony) HOROWITZ\", \"Anthony Horowitz\"]", "[\"Possession\", \"Possession (2012 film)\", \"Possessions\", \"Possession (disambiguation)\", \"Possessor (disambiguation)\", \"Posession\", \"Possess (disambiguation)\", \"Possessor\", \"Possession (film)\", \"Possess\", \"Possesion\", \"Possession (movie)\", \"Possession (album)\", \"Possession (song)\"]", "[\"A.W. Pugin\", \"A W Pugin\", \"A.N. Welby Pugin\", \"Pugin, Augustus Welby Northmore\", \"AW Pugin\", \"Augustus Welby Pugin\", \"August Pugin\", \"A.W.N. Pugin\", \"Augustus Pugin\", \"A. W. Pugin\", \"Augustus PUGIN\", \"AWN Pugin\", \"A W N Pugin\", \"Pugin\", \"Augustus Welby Northmore Pugin\", \"A. W. N. Pugin\"]", "[\"An angel gets his wings\"]", "[\"\\u05d1\\u05b4\\u05bc\\u05dc\\u05b0\\u05e2\\u05b8\\u05dd\", \"Bil'am\", \"Balaam's ass\", \"Islamic view of Balaam\", \"BALAAM'S ASS\", \"Bileam\", \"\\u05d1\\u05dc\\u05e2\\u05dd\", \"Bilam\", \"Balaam\", \"Balaam's donkey\", \"Bilaam\"]", "[\"Corded poodle\", \"Caniche\", \"Poodle (Standard)\", \"Poodle\", \"Poodles\", \"Pomeranian Poodle\", \"Standard Poodle\", \"Canis aquaticus\", \"Teacup Poodle\", \"Poodle dog\", \"\\ud83d\\udc29\", \"Miniature poodle\", \"Poodle (Miniature)\", \"Medium Poodle\", \"Poodle (Toy)\", \"Toy poodle\", \"Poodle wool\", \"Miniature Poodle\", \"Toy Poodles\", \"French Poodle\", \"Tea cup poodle\", \"Poodle-dog\", \"Toy Poodle\", \"Corded Poodle\", \"StandardPoodle\", \"Standard poodle\"]", "[\"ATC code B05CB01\", \"Halite structure\", \"ATCvet code QB05CB01\", \"NaCl\", \"Sodium chloride\", \"Salt (sodium chloride)\", \"Natrium chloride\", \"Natrum Mur.\", \"ATCvet code QA12CA01\", \"Na Cl\", \"ATC code B05XA03\", \"NaCL\", \"Sodium Chloride\", \"Sodium chlorine\", \"NACL\", \"Salt (Sodium Chloride)\", \"Broncho Saline\", \"ATCvet code QB05XA03\", \"Road salt\", \"Nacl\", \"ATC code A12CA01\", \"Muriate of soda\", \"NaCl structure\"]", "[\"Tserkov\", \"Church sign\", \"The Church\", \"Ecclesiastical affair\", \"Ecclesiastical affairs\", \"Church (disambiguation)\", \"Church ward\", \"Church\", \"Churches\", \"Church (ward)\"]", "[\"French Revolution of 1789\", \"French Revolution\", \"French revolutionary\", \"1789 French Revolution\", \"French revolutionary era\", \"French revolution\", \"French Revolutionary\", \"R\\u00e9volution Fran\\u00e7aise\", \"1789 Revolution\", \"French Revolutionary period\", \"R\\u00e9volution\", \"French Revolution up to the storming of the Bastille\", \"French Revolutionaries\", \"Revolution of France\", \"Great Revolution\", \"R\\u00e9volution fran\\u00e7aise\", \"Revolutionary France\", \"French revolutionist\", \"1789 revolution\", \"La Revolution francaise\", \"Great French Revolution\", \"French revolutionaries\", \"French revoultion\", \"Great revolution\", \"Revolution in France\", \"The French Revolution\", \"Roles of women in the french revolution\", \"French Rev\"]", "[\"Convex (disambiguation)\", \"Convexity\", \"Convex\"]", "[\"BOB DANVERS WALKER\"]" ]
[ "In which county is Eton school", "Claudia was the first name of the wife of which US President?", "In kilometres, how long is the coastline of Brazil?", "In astronomy, what term describes the point in the orbit of a planet or comet at which it is farthest from the Sun?", "\"Who wrote, the 2011 novel about Sherlock Holmes called, 'The House of Silk\"\"?\"", "According to the common saying, what is nine-tenths of the law?", "Which architect worked with Sir Charles Barry on the new Palace of Westminster?", "According to Zuzu Bailey, what happens every time a bell rings?", "The Old Testament contains two instances of talking animals, the serpent in the garden is one, name the other?", "Winston Churchill had a dog - what type?", "NaCl is the chemical compound of which common substance?", "What is the meaning of the prefix Kil- or Cill- in Irish place names?", "The 1792 Battle of Valmy in which a citizen army defeated the Prussian army is significant for saving/preserving what?", "What type of lens bends parallel rays inwards: convex or concave?", "\"What was the three word name of the manwith the gong in the \"\"yes or no\"\" interlude in the 1960s game show Take Your Pick?\"" ]
15
[ 2175, 2176, 2177, 2178, 2179, 2180, 2181, 2182, 2183, 2184, 2185, 2186, 2187, 2188, 2189 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What, resembling a tomato and pepper hybrid, is the edible fruit produced by Diospyros trees, source of ebony wood?\nQuestion 2: In what year was the Battle of Hastings?\nQuestion 3: What does 3G mean in mobile phone advertisements?\nQuestion 4: Who were the first team to field an all foreign starting line up in the English Premiership?\nQuestion 5: On 25 June 1991, Slovenia and Croatia became the first republics to declare independence from which country?\nQuestion 6: His father, a former MEP, founded his own political party and stood as an MP. His mother has a London nightclub named after her. Who is the Conservative MP for Richmond Park, first elected at the 2010 General Election?\nQuestion 7: Dr Seuss (Theodor Seuss Geisel), author of 'The Cat in the Hat' and 'Green Eggs and Ham', is most famous in what literary genre?\nQuestion 8: Who wrote The Pilgrim's Progress?\nQuestion 9: Which US state is known as the Hoosier State?\nQuestion 10: What is the tune hummed by David Brent during his infamous dance routine in the UK tv series ‘The Office’?\nQuestion 11: On which river do Basle, Strasbourg and Cologne stand?\nQuestion 12: On which motorway is Hilton Park services?\nQuestion 13: Which woman ceased to be a senator for the state of New York in 2009?\nQuestion 14: Which structure links the English towns of Barton and Hessle?\nQuestion 15: Lanzarote and Tenerife are part of which group of islands?", "role": "user" } ]
["[\"Chinese fig\", \"Persimmons\", \"Pawdad\", \"Persimon\", \"Persimmon (fruit)\", \"Hoshigaki\", \"Persimmon\", \"Gotgam\"]", "[\"one thousand and sixty-six\", \"1066\"]", "[\"Third generation\", \"Third Generation\", \"3rd generation\", \"The Third Generation\", \"Third generation (disambiguation)\", \"Third-generation\"]", "[\"Chelsy\", \"Chelsey\", \"Chelsi\", \"Chelsea, New York City\", \"Chelsea (disambiguation)\", \"Chelsea (New York)\", \"Chelsea Township (disambiguation)\", \"Chelsea, NY\", \"Chelsie\", \"Chelsea (album)\", \"Chelsea Township\", \"Chelsee\", \"Chelsea, New York\", \"Chelsea\", \"Chelsea (New York City)\", \"Chelsea (Album)\"]", "[\"Yougoslavia\", \"Yugo.\", \"ExYu\", \"Changes in yugoslavian religious demographics\", \"\\u0408\\u0443\\u0433\\u043e\\u0441\\u043b\\u0430\\u0432\\u0438\\u0458\\u0430\", \"Ex-Yugoslav\", \"FYR\", \"North Yugoslavia\", \"Yugosavia\", \"Jugo-Slavia\", \"Northern Yugoslavia\", \"Demographics of the former Yugoslavia\", \"South Slavia\", \"History of Yugoslavia\", \"Jugoslavija\", \"Yugosphere\", \"Jugoslavije\", \"Serboslavia\", \"Yugosalvia\", \"Changes in Yugoslavian Religious Demographics\", \"Jugoslavia\", \"South slavia\", \"Ex-Yu\", \"Yugoslavia\", \"Yugoslavia/History\", \"ISO 3166-1:YU\"]", "[\"Zac Goldsmith\", \"ZAC GOLDSMITH\", \"Frank Zacharias Robin Goldsmith\"]", "[\"Little kids\", \"Bairns\", \"Little kid\", \"Great-children\", \"Childrens\", \"Schoolchildren\", \"Childer\", \"Value of children\", \"Children\", \"Child-centric\", \"Children's\", \"Sproggen\", \"Schoolchild\", \"Child\", \"Human child\", \"Pre-pubescent\", \"Kiddies\"]", "[\"John Bunnion\", \"City of Destruction\", \"Bunyan, John\", \"John Bunyan\", \"Bunyanesque\"]", "[\"Indiana, United States\", \"The Hoosier State\", \"Indiana\", \"Ind.\", \"Hoosier State\", \"Indiania\", \"Education in Indiana\", \"Demographics of Indiana\", \"Indiana, USA\", \"Indana\", \"Indiana (U.S. state)\", \"Indiana (State)\", \"Transportation in Indiana\", \"State of Indiana\", \"Northeastern Indiana\", \"US-IN\", \"Religion in Indiana\", \"Indiana (state)\", \"The Commonwealth of Indiana\", \"Climate of Indiana\", \"19th State\", \"Transport in Indiana\", \"Nineteenth State\", \"INdiana\"]", "[\"Disco Inferno (Cyndi Lauper single)\", \"Disco Inferno (song)\", \"Disco Inferno\", \"Disco Inferno (Cyndi Lauper song)\", \"Disco Inferno (The Trammps song)\", \"Disco inferno\"]", "[\"Rhine\", \"Alpenrhein River\", \"Rhinen\", \"Rhine Estuary\", \"Rhinewater\", \"River Rhein\", \"The Rhine\", \"Upper Rhine River Plains\", \"Rhein River\", \"Rhine river\", \"The River Rhine\", \"Rhine basin\", \"Rhine River\", \"Rhine (river)\", \"Rhein (river)\", \"Rhine mouth\", \"Rijn\", \"River Rhine Pollution: November 1986\", \"Length of the Rhine\", \"Rayn\", \"River Rhine\"]", "[\"M 6\", \"Highway M06\", \"M6 Road\", \"M-6\", \"M.6\", \"M06\", \"M6 (disambiguation)\", \"M6\"]", "[\"Hillary R. Clinton\", \"Hilary Rodham Clinton\", \"Public image of Hillary clinton\", \"Hillary Diane Rodham Clinotn\", \"Secretary Clinton\", \"HilaryRodhamClinton\", \"Hillary Rodham Clinton\", \"Clinton, Hilary Rodham\", \"RodhamClinton\", \"First Lady Clinton\", \"Ms. Clinton\", \"Hillary (politician)\", \"Controversies surrounding Hillary Clinton\", \"Hilary Diane Rodham Clinton\", \"Hillary Rodham\", \"Hillary Klinton\", \"Cultural Matters of Hillary Clinton\", \"Hillery clinton\", \"Rodham Clinton\", \"Senator Clinton\", \"Hillary Clinton\", \"H Clinton\", \"Senator Hillary Rodham Clinton\", \"HillaryRodhamClinton\", \"Clinton, Hillary Rodham\", \"Rodham,Hillary\", \"Hilary D. R. Clinton\", \"Cultural matters related to Hilary Rodham Clinton\", \"Mrs. Bill Clinton\", \"Hilary R. Clinton\", \"New College Compact\", \"Hillary Diane Clinton\", \"Rodham, Hilary\", \"MsRodham\", \"Ms Rodham\", \"Hillary Clinton-Rodham\", \"Clinton, Hillary\", \"Hillary Diane Rodham Clinton\", \"Hillary Diane Rodham\", \"Hillary Cliton\", \"Hillary-Rodham-Clinton\", \"Hillary!\", \"Senator Hilary Clinton\", \"Rodham, Hillary\", \"Hilary clinton\", \"Hilary Diane Rodham\", \"HIllary Rodham Clinton\", \"Hillary D. R. Clinton\", \"Rodham, Hillary Diane\", \"H. Clinton\", \"Mrs. Clinton\", \"Senator Hillary Clinton\", \"H.R. Clinton\", \"Hillary Diane R. Clinton\", \"Hilary Diane R. Clinton\", \"HillaryRodham\", \"Hillary-Rodham\", \"Controversies surrounding Hillary Rodham Clinton\", \"Mrs Clinton\", \"Hillary clinton\", \"Rodham-Clinton\", \"Hilary Rodham Clinton controversies\", \"Ms. Rodham\", \"Hillery Clinton\", \"List of Hillary Rodham Clinton Controversies\", \"HR Clinton\", \"Secretary of State Hillary Clinton\", \"Clinton, Rodham\", \"MissRodham\", \"Rodham, Hilary Diane\", \"Cultural matters related to Hillary Rodham Clinton\", \"Hillary CLINTON\", \"Hillary Rodham Clintion\", \"Mrs Bill Clinton\", \"Hillary Rodham-Clinton\", \"Hilary Rodham-Clinton\", \"Clinton hillary\", \"Miss Rodham\", \"Hillary Diane\", \"Clinton, Hilary\", \"Clinton Rodham\", \"Rodham Hillary\", \"Clinton-Rodham\", \"Hilliary Clinton\", \"Ms.Rodham\", \"Hilary Clinton\", \"Hillary Rodham Clinton controversies\", \"Hillary Rodham Klinton\", \"Hilary Rodham\"]", "[\"The Humber Bridge\", \"Humber bridge\", \"Humber Bridge\"]", "[\"The Canary islands\", \"Canary Isles\", \"Canaria\", \"Canary islands\", \"Science in the Canary Islands\", \"Canary Island\", \"List of islands of the Canary Islands\", \"Rail transport in the Canary Islands\", \"The Canary Islands\", \"History of the Canary Islands\", \"Islas Canarias\", \"Telecommunications in the Canary Islands\", \"Canary island\", \"Name of the Canary Islands\", \"Communications in the Canary Islands\", \"Canarias islands\", \"Foreign relations of the Canary Islands\", \"Canarias Autonomous Community, Spain\", \"Canarian Archipelago\", \"Canary Silands\", \"Canarias Autonomous Community\", \"Climate of the Canary Islands\", \"Canarias, Spain\", \"Canery islands\", \"Economy of the Canary Islands\", \"Canary Islands, Spain\", \"Canary Islands\", \"Geography of the Canary Islands\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Chinese fig\", \"Persimmons\", \"Pawdad\", \"Persimon\", \"Persimmon (fruit)\", \"Hoshigaki\", \"Persimmon\", \"Gotgam\"]", "[\"one thousand and sixty-six\", \"1066\"]", "[\"Third generation\", \"Third Generation\", \"3rd generation\", \"The Third Generation\", \"Third generation (disambiguation)\", \"Third-generation\"]", "[\"Chelsy\", \"Chelsey\", \"Chelsi\", \"Chelsea, New York City\", \"Chelsea (disambiguation)\", \"Chelsea (New York)\", \"Chelsea Township (disambiguation)\", \"Chelsea, NY\", \"Chelsie\", \"Chelsea (album)\", \"Chelsea Township\", \"Chelsee\", \"Chelsea, New York\", \"Chelsea\", \"Chelsea (New York City)\", \"Chelsea (Album)\"]", "[\"Yougoslavia\", \"Yugo.\", \"ExYu\", \"Changes in yugoslavian religious demographics\", \"\\u0408\\u0443\\u0433\\u043e\\u0441\\u043b\\u0430\\u0432\\u0438\\u0458\\u0430\", \"Ex-Yugoslav\", \"FYR\", \"North Yugoslavia\", \"Yugosavia\", \"Jugo-Slavia\", \"Northern Yugoslavia\", \"Demographics of the former Yugoslavia\", \"South Slavia\", \"History of Yugoslavia\", \"Jugoslavija\", \"Yugosphere\", \"Jugoslavije\", \"Serboslavia\", \"Yugosalvia\", \"Changes in Yugoslavian Religious Demographics\", \"Jugoslavia\", \"South slavia\", \"Ex-Yu\", \"Yugoslavia\", \"Yugoslavia/History\", \"ISO 3166-1:YU\"]", "[\"Zac Goldsmith\", \"ZAC GOLDSMITH\", \"Frank Zacharias Robin Goldsmith\"]", "[\"Little kids\", \"Bairns\", \"Little kid\", \"Great-children\", \"Childrens\", \"Schoolchildren\", \"Childer\", \"Value of children\", \"Children\", \"Child-centric\", \"Children's\", \"Sproggen\", \"Schoolchild\", \"Child\", \"Human child\", \"Pre-pubescent\", \"Kiddies\"]", "[\"John Bunnion\", \"City of Destruction\", \"Bunyan, John\", \"John Bunyan\", \"Bunyanesque\"]", "[\"Indiana, United States\", \"The Hoosier State\", \"Indiana\", \"Ind.\", \"Hoosier State\", \"Indiania\", \"Education in Indiana\", \"Demographics of Indiana\", \"Indiana, USA\", \"Indana\", \"Indiana (U.S. state)\", \"Indiana (State)\", \"Transportation in Indiana\", \"State of Indiana\", \"Northeastern Indiana\", \"US-IN\", \"Religion in Indiana\", \"Indiana (state)\", \"The Commonwealth of Indiana\", \"Climate of Indiana\", \"19th State\", \"Transport in Indiana\", \"Nineteenth State\", \"INdiana\"]", "[\"Disco Inferno (Cyndi Lauper single)\", \"Disco Inferno (song)\", \"Disco Inferno\", \"Disco Inferno (Cyndi Lauper song)\", \"Disco Inferno (The Trammps song)\", \"Disco inferno\"]", "[\"Rhine\", \"Alpenrhein River\", \"Rhinen\", \"Rhine Estuary\", \"Rhinewater\", \"River Rhein\", \"The Rhine\", \"Upper Rhine River Plains\", \"Rhein River\", \"Rhine river\", \"The River Rhine\", \"Rhine basin\", \"Rhine River\", \"Rhine (river)\", \"Rhein (river)\", \"Rhine mouth\", \"Rijn\", \"River Rhine Pollution: November 1986\", \"Length of the Rhine\", \"Rayn\", \"River Rhine\"]", "[\"M 6\", \"Highway M06\", \"M6 Road\", \"M-6\", \"M.6\", \"M06\", \"M6 (disambiguation)\", \"M6\"]", "[\"Hillary R. Clinton\", \"Hilary Rodham Clinton\", \"Public image of Hillary clinton\", \"Hillary Diane Rodham Clinotn\", \"Secretary Clinton\", \"HilaryRodhamClinton\", \"Hillary Rodham Clinton\", \"Clinton, Hilary Rodham\", \"RodhamClinton\", \"First Lady Clinton\", \"Ms. Clinton\", \"Hillary (politician)\", \"Controversies surrounding Hillary Clinton\", \"Hilary Diane Rodham Clinton\", \"Hillary Rodham\", \"Hillary Klinton\", \"Cultural Matters of Hillary Clinton\", \"Hillery clinton\", \"Rodham Clinton\", \"Senator Clinton\", \"Hillary Clinton\", \"H Clinton\", \"Senator Hillary Rodham Clinton\", \"HillaryRodhamClinton\", \"Clinton, Hillary Rodham\", \"Rodham,Hillary\", \"Hilary D. R. Clinton\", \"Cultural matters related to Hilary Rodham Clinton\", \"Mrs. Bill Clinton\", \"Hilary R. Clinton\", \"New College Compact\", \"Hillary Diane Clinton\", \"Rodham, Hilary\", \"MsRodham\", \"Ms Rodham\", \"Hillary Clinton-Rodham\", \"Clinton, Hillary\", \"Hillary Diane Rodham Clinton\", \"Hillary Diane Rodham\", \"Hillary Cliton\", \"Hillary-Rodham-Clinton\", \"Hillary!\", \"Senator Hilary Clinton\", \"Rodham, Hillary\", \"Hilary clinton\", \"Hilary Diane Rodham\", \"HIllary Rodham Clinton\", \"Hillary D. R. Clinton\", \"Rodham, Hillary Diane\", \"H. Clinton\", \"Mrs. Clinton\", \"Senator Hillary Clinton\", \"H.R. Clinton\", \"Hillary Diane R. Clinton\", \"Hilary Diane R. Clinton\", \"HillaryRodham\", \"Hillary-Rodham\", \"Controversies surrounding Hillary Rodham Clinton\", \"Mrs Clinton\", \"Hillary clinton\", \"Rodham-Clinton\", \"Hilary Rodham Clinton controversies\", \"Ms. Rodham\", \"Hillery Clinton\", \"List of Hillary Rodham Clinton Controversies\", \"HR Clinton\", \"Secretary of State Hillary Clinton\", \"Clinton, Rodham\", \"MissRodham\", \"Rodham, Hilary Diane\", \"Cultural matters related to Hillary Rodham Clinton\", \"Hillary CLINTON\", \"Hillary Rodham Clintion\", \"Mrs Bill Clinton\", \"Hillary Rodham-Clinton\", \"Hilary Rodham-Clinton\", \"Clinton hillary\", \"Miss Rodham\", \"Hillary Diane\", \"Clinton, Hilary\", \"Clinton Rodham\", \"Rodham Hillary\", \"Clinton-Rodham\", \"Hilliary Clinton\", \"Ms.Rodham\", \"Hilary Clinton\", \"Hillary Rodham Clinton controversies\", \"Hillary Rodham Klinton\", \"Hilary Rodham\"]", "[\"The Humber Bridge\", \"Humber bridge\", \"Humber Bridge\"]", "[\"The Canary islands\", \"Canary Isles\", \"Canaria\", \"Canary islands\", \"Science in the Canary Islands\", \"Canary Island\", \"List of islands of the Canary Islands\", \"Rail transport in the Canary Islands\", \"The Canary Islands\", \"History of the Canary Islands\", \"Islas Canarias\", \"Telecommunications in the Canary Islands\", \"Canary island\", \"Name of the Canary Islands\", \"Communications in the Canary Islands\", \"Canarias islands\", \"Foreign relations of the Canary Islands\", \"Canarias Autonomous Community, Spain\", \"Canarian Archipelago\", \"Canary Silands\", \"Canarias Autonomous Community\", \"Climate of the Canary Islands\", \"Canarias, Spain\", \"Canery islands\", \"Economy of the Canary Islands\", \"Canary Islands, Spain\", \"Canary Islands\", \"Geography of the Canary Islands\"]" ]
[ "What, resembling a tomato and pepper hybrid, is the edible fruit produced by Diospyros trees, source of ebony wood?", "In what year was the Battle of Hastings?", "What does 3G mean in mobile phone advertisements?", "Who were the first team to field an all foreign starting line up in the English Premiership?", "On 25 June 1991, Slovenia and Croatia became the first republics to declare independence from which country?", "His father, a former MEP, founded his own political party and stood as an MP. His mother has a London nightclub named after her. Who is the Conservative MP for Richmond Park, first elected at the 2010 General Election?", "Dr Seuss (Theodor Seuss Geisel), author of 'The Cat in the Hat' and 'Green Eggs and Ham', is most famous in what literary genre?", "Who wrote The Pilgrim's Progress?", "Which US state is known as the Hoosier State?", "What is the tune hummed by David Brent during his infamous dance routine in the UK tv series ‘The Office’?", "On which river do Basle, Strasbourg and Cologne stand?", "On which motorway is Hilton Park services?", "Which woman ceased to be a senator for the state of New York in 2009?", "Which structure links the English towns of Barton and Hessle?", "Lanzarote and Tenerife are part of which group of islands?" ]
15
[ 82020, 82021, 82022, 82023, 82024, 82025, 82026, 82027, 82028, 82029, 82030, 82031, 82032, 82033, 82034 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: An omelette made with smoked haddock invented at the Savoy Hotel was named after which author?\nQuestion 2: In which European country was the Carnation Revolution on April 25th 1974?\nQuestion 3: What kind of creatures are Sam, Merry and Pippin in the Lord of the Rings trilogy?\nQuestion 4: \"What is the \"\"twin city\"\" of Minneapolis?\"\nQuestion 5: Which Swedish prime minister was assassinated in February 1986 in Stockholm?\nQuestion 6: What is the name for a group of lines that is repeated throughout a poem or song?\nQuestion 7: Which sporting event, first held in July 1903, was the idea of Geo Lefevre, a journalist on L'Auto newspaper ?\nQuestion 8: Who is the hero of George Orwell's novel 1984 ?\nQuestion 9: Under what names were Janet and John books sold in the US?\nQuestion 10: Which Disney cartoon character was originally known as Dippy Dawg ?\nQuestion 11: In 1997, who was appointed the first female US Secretary of State?\nQuestion 12: What is the name of the King of Halloween Town who tries to take over Christmas in the Disney movie The Nightmare Before Christmas?\nQuestion 13: What famous billionaire investor lives in Omaha, Nebraska?\nQuestion 14: At the Academy Awards, what was the first British film ever to win the Oscar for Best Film?\nQuestion 15: Where was the venue for the hare-coursing 'Waterloo Cup'?", "role": "user" } ]
["[\"Sampson King\", \"EA Bennett\", \"Buried Alive (novel)\", \"Arnold Bennet\", \"Enoch Arnold Bennett\", \"Arnold Enoch Bennett\", \"Arnold Bennett\", \"ARNOLD BENNETT\"]", "[\"Portoga\\u0142o\", \"Republic of Portugal\", \"PORTUGAL\", \"Portekiz\", \"Portugallu\", \"O Papagaio\", \"ISO 3166-1:PT\", \"Portunga\", \"Phu-to-ga\", \"Potigal\", \"Port\\u00fbnga\", \"Portugul\", \"An Phortaing\\u00e9il\", \"Portug\\u0101le\", \"Portugale\", \"Portingale\", \"Potiti\", \"Portugali\", \"Portugall\", \"Portek\\u00eez\", \"Bo Dao Nha\", \"Portuguese Republic\", \"Portogallo\", \"Portugaul\", \"Portogalo\", \"Portyngal\", \"Yn Phortiugal\", \"Portugalio\", \"Portug\\u00e1l\", \"Portugual\", \"Portuga\", \"Portgual\", \"Portugalsko\", \"Portugaleje\", \"Ph\\u00fb-t\\u00f4-g\\u00e2\", \"Portugalujo\", \"Portugalija\", \"Pertual\", \"P\\u00f2tigal\", \"Portugal\", \"B\\u1ed3 \\u0110\\u00e0o Nha\", \"Portugalska\", \"Rep\\u00fablica Portuguesa\", \"Portiwgal\", \"Portugal\\u0117j\\u0117\", \"Port\\u00fagal\", \"Portegal\", \"An Phortaingeil\", \"Republica Portuguesa\"]", "[\"Hobbits\", \"Periannath\", \"Hobbitish\", \"Fallohides\", \"Pheriannath\", \"Stoor\", \"Holbytla\", \"Kuduk\", \"Holbyta\", \"JRR Tolkien/Hobbits\", \"Hobbit hole\", \"Harfoots\", \"Fallohide\", \"Smial\", \"Harfoot\", \"A hobbit\", \"Hobit\", \"Hobbit (Tolkien)\", \"Hobbit\", \"Hobbit-hole\", \"Stoors\", \"Hobbit holes\", \"Hobbitry\", \"Holbytlan\", \"Hobbitses\"]", "[\"St Paul, the Apostle\", \"Paul of Tarsos\", \"Saul of Tarsus\", \"St Paul the Apostle\", \"Paul of tarsus\", \"Saint Paul the Apostle\", \"Paul the Apostle\", \"Pauloftarsus\", \"Saul/Paul of Tarsus\", \"Saul Of Tarsus\", \"Apostel Paul\", \"The apostle Paul\", \"Apostle Paulus\", \"Paul the apostle\", \"Saint Paul of Tarsus\", \"Paul, Saint\", \"St. Paul the Apostle\", \"Saint Paul\", \"Saint Paul, the Apostle\", \"St. Paul of Tarsus\", \"Alexander the Coppersmith\", \"St Paul\", \"Missionary journeys of Paul\", \"Saul of tarsus\", \"The Apostle Paul\", \"Apostle Paul\", \"St. Paul, the Apostle\", \"Saint Paul (apostle)\", \"St.Pauls\", \"The Apostle, Saint Paul\", \"St. paul\", \"Saint paul\", \"Paul of Tarsus\", \"Alexander the coppersmith\", \"Paul of Tsarsis\", \"Saint Pauls\", \"Saint Paul's\", \"Paul (apostle)\", \"Paul, the Apostle\", \"St. Paul\"]", "[\"Olof Joachim Palme\", \"Sven Olof Joachim Palme\", \"Oluf Palme\", \"Olof Palme\", \"Olaf Palme\"]", "[\"Refrain (song)\", \"Chorus (song)\", \"Refrain\", \"Estribillo\", \"Shout chorus\", \"Arranger's chorus\"]", "[\"La Grande Boucle\", \"Tour de France\", \"Le tour\", \"Tour de france\", \"Tour de France Customs\", \"Tour de France (cycling competition)\", \"TdF\", \"Tour de France cycliste\", \"Tours de France\", \"Le Tour\", \"TOUR DE FRANCE\", \"Tour de Fraud\", \"Tour du France\", \"Souvenir Henri Desgrange\", \"Le tour de france\", \"Tour De France\", \"Le Tour de France\"]", "[\"Winston Smith\", \"WINSTON SMITH\", \"6079\"]", "[\"Alice and Jerry\"]", "[\"Goofy holler\", \"Goofey\", \"Gawrsh!\", \"Goofy Jr.\", \"GOOFY\", \"George Geef\", \"Max Goofy\", \"Goofy yell\", \"Ah-Hyuck\", \"Goofy\", \"Ah-hyuck\", \"A-Hyuck\", \"Goofy Goof\", \"Goofy Sr.\", \"Dippy Dawg\", \"Super Goofy\", \"Super Goof\", \"Goofy filmography\", \"List of Goofy Cartoons\", \"A-hyuck\", \"List of Donald Duck & Goofy Cartoons\"]", "[\"Madelaine Albright\", \"Madeline albright\", \"Marie Korbelova\", \"Madaline albright\", \"Decouple, duplicate, discriminate\", \"Madeleine K. Albright\", \"The non-denial heard 'round the world\", \"Madeleine Allbright\", \"Madeleine Korbel Albright\", \"Marie Korbelov\\u00e1\", \"Marie Jana Korbel\", \"Secretary Albright\", \"Decouple duplicate discriminate\", \"Albright, Madeleine\", \"Madeleine Albright\", \"Madeline Albright\"]", "[\"Jack Skellington\", \"Jack Skeleton\", \"Jack Skelington\", \"Jack skellington\"]", "[\"Oracle of Nebraska\", \"Warren Edward Buffett\", \"Warren buffet\", \"Warren Buffet\", \"Astrid Buffett\", \"Warren Buffett\", \"Sage of Omaha\", \"Astrid Menks Buffett\", \"Sage of Nebraska\", \"The oracle of omaha\", \"Oracle of Omaha\", \"Warren E. Buffett\", \"Oracle of omaha\", \"Warbuf\", \"Omaha's Oracle\", \"WARREN BUFFETT\", \"Astrid Menks\"]", "[\"The Murder of Gonzago\", \"Bernardo (character)\", \"The Tragedy Of Hamlet Prince Of Denmark\", \"Tragical History of Hamlet, Prince of Denmark\", \"The tragical history of Hamlet\", \"Hamletian\", \"William Shakespeare's Hamlet\", \"Hamlet of Denmark\", \"The Tragical History of Hamlet, Prince of Denmark\", \"Tragical History of Hamlet Prince of Denmark\", \"The Revenge of Hamlett, Prince of Denmarke\", \"Marcellus (Hamlet)\", \"The Tragicall Historie of Hamlet, Prince of Denmarke\", \"Hamlet (Shakespeare)\", \"The Tragedy of Hamlet Prince of Denmark\", \"Hamlet (play)\", \"The Tragicall Historie of Hamlet, Prince of Denmarke.\", \"The Tragical History Of Hamlet Prince of Denmark\", \"Goodnight sweet prince\", \"The Murder Of Gonzago\", \"Hamlet, Prince of Denmark\", \"Man delights not me\", \"Hamlet\", \"Bernardo (Hamlet)\", \"The Tragedy of Hamlet\", \"The Tragedy of Hamlet, Prince of Denmark\"]", "[\"Petro-free\", \"Alternative fuel sources for motorcars\", \"Alternative fuel vehicle\", \"Alternative fuel cars\", \"Alternative energy vehicle\", \"Alternative propulsion\", \"Alternative motor vehicle\", \"ALTCAR\", \"Ecological propulsion\", \"Alternative powered car\", \"Petroleum-free\", \"Alternative fuel car\", \"Alternative Energy Vehicle\", \"Automobile propulsion technologies\", \"Alternative fuel vehicles\", \"Alternative-fuel vehicle\", \"AltCar\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Sampson King\", \"EA Bennett\", \"Buried Alive (novel)\", \"Arnold Bennet\", \"Enoch Arnold Bennett\", \"Arnold Enoch Bennett\", \"Arnold Bennett\", \"ARNOLD BENNETT\"]", "[\"Portoga\\u0142o\", \"Republic of Portugal\", \"PORTUGAL\", \"Portekiz\", \"Portugallu\", \"O Papagaio\", \"ISO 3166-1:PT\", \"Portunga\", \"Phu-to-ga\", \"Potigal\", \"Port\\u00fbnga\", \"Portugul\", \"An Phortaing\\u00e9il\", \"Portug\\u0101le\", \"Portugale\", \"Portingale\", \"Potiti\", \"Portugali\", \"Portugall\", \"Portek\\u00eez\", \"Bo Dao Nha\", \"Portuguese Republic\", \"Portogallo\", \"Portugaul\", \"Portogalo\", \"Portyngal\", \"Yn Phortiugal\", \"Portugalio\", \"Portug\\u00e1l\", \"Portugual\", \"Portuga\", \"Portgual\", \"Portugalsko\", \"Portugaleje\", \"Ph\\u00fb-t\\u00f4-g\\u00e2\", \"Portugalujo\", \"Portugalija\", \"Pertual\", \"P\\u00f2tigal\", \"Portugal\", \"B\\u1ed3 \\u0110\\u00e0o Nha\", \"Portugalska\", \"Rep\\u00fablica Portuguesa\", \"Portiwgal\", \"Portugal\\u0117j\\u0117\", \"Port\\u00fagal\", \"Portegal\", \"An Phortaingeil\", \"Republica Portuguesa\"]", "[\"Hobbits\", \"Periannath\", \"Hobbitish\", \"Fallohides\", \"Pheriannath\", \"Stoor\", \"Holbytla\", \"Kuduk\", \"Holbyta\", \"JRR Tolkien/Hobbits\", \"Hobbit hole\", \"Harfoots\", \"Fallohide\", \"Smial\", \"Harfoot\", \"A hobbit\", \"Hobit\", \"Hobbit (Tolkien)\", \"Hobbit\", \"Hobbit-hole\", \"Stoors\", \"Hobbit holes\", \"Hobbitry\", \"Holbytlan\", \"Hobbitses\"]", "[\"St Paul, the Apostle\", \"Paul of Tarsos\", \"Saul of Tarsus\", \"St Paul the Apostle\", \"Paul of tarsus\", \"Saint Paul the Apostle\", \"Paul the Apostle\", \"Pauloftarsus\", \"Saul/Paul of Tarsus\", \"Saul Of Tarsus\", \"Apostel Paul\", \"The apostle Paul\", \"Apostle Paulus\", \"Paul the apostle\", \"Saint Paul of Tarsus\", \"Paul, Saint\", \"St. Paul the Apostle\", \"Saint Paul\", \"Saint Paul, the Apostle\", \"St. Paul of Tarsus\", \"Alexander the Coppersmith\", \"St Paul\", \"Missionary journeys of Paul\", \"Saul of tarsus\", \"The Apostle Paul\", \"Apostle Paul\", \"St. Paul, the Apostle\", \"Saint Paul (apostle)\", \"St.Pauls\", \"The Apostle, Saint Paul\", \"St. paul\", \"Saint paul\", \"Paul of Tarsus\", \"Alexander the coppersmith\", \"Paul of Tsarsis\", \"Saint Pauls\", \"Saint Paul's\", \"Paul (apostle)\", \"Paul, the Apostle\", \"St. Paul\"]", "[\"Olof Joachim Palme\", \"Sven Olof Joachim Palme\", \"Oluf Palme\", \"Olof Palme\", \"Olaf Palme\"]", "[\"Refrain (song)\", \"Chorus (song)\", \"Refrain\", \"Estribillo\", \"Shout chorus\", \"Arranger's chorus\"]", "[\"La Grande Boucle\", \"Tour de France\", \"Le tour\", \"Tour de france\", \"Tour de France Customs\", \"Tour de France (cycling competition)\", \"TdF\", \"Tour de France cycliste\", \"Tours de France\", \"Le Tour\", \"TOUR DE FRANCE\", \"Tour de Fraud\", \"Tour du France\", \"Souvenir Henri Desgrange\", \"Le tour de france\", \"Tour De France\", \"Le Tour de France\"]", "[\"Winston Smith\", \"WINSTON SMITH\", \"6079\"]", "[\"Alice and Jerry\"]", "[\"Goofy holler\", \"Goofey\", \"Gawrsh!\", \"Goofy Jr.\", \"GOOFY\", \"George Geef\", \"Max Goofy\", \"Goofy yell\", \"Ah-Hyuck\", \"Goofy\", \"Ah-hyuck\", \"A-Hyuck\", \"Goofy Goof\", \"Goofy Sr.\", \"Dippy Dawg\", \"Super Goofy\", \"Super Goof\", \"Goofy filmography\", \"List of Goofy Cartoons\", \"A-hyuck\", \"List of Donald Duck & Goofy Cartoons\"]", "[\"Madelaine Albright\", \"Madeline albright\", \"Marie Korbelova\", \"Madaline albright\", \"Decouple, duplicate, discriminate\", \"Madeleine K. Albright\", \"The non-denial heard 'round the world\", \"Madeleine Allbright\", \"Madeleine Korbel Albright\", \"Marie Korbelov\\u00e1\", \"Marie Jana Korbel\", \"Secretary Albright\", \"Decouple duplicate discriminate\", \"Albright, Madeleine\", \"Madeleine Albright\", \"Madeline Albright\"]", "[\"Jack Skellington\", \"Jack Skeleton\", \"Jack Skelington\", \"Jack skellington\"]", "[\"Oracle of Nebraska\", \"Warren Edward Buffett\", \"Warren buffet\", \"Warren Buffet\", \"Astrid Buffett\", \"Warren Buffett\", \"Sage of Omaha\", \"Astrid Menks Buffett\", \"Sage of Nebraska\", \"The oracle of omaha\", \"Oracle of Omaha\", \"Warren E. Buffett\", \"Oracle of omaha\", \"Warbuf\", \"Omaha's Oracle\", \"WARREN BUFFETT\", \"Astrid Menks\"]", "[\"The Murder of Gonzago\", \"Bernardo (character)\", \"The Tragedy Of Hamlet Prince Of Denmark\", \"Tragical History of Hamlet, Prince of Denmark\", \"The tragical history of Hamlet\", \"Hamletian\", \"William Shakespeare's Hamlet\", \"Hamlet of Denmark\", \"The Tragical History of Hamlet, Prince of Denmark\", \"Tragical History of Hamlet Prince of Denmark\", \"The Revenge of Hamlett, Prince of Denmarke\", \"Marcellus (Hamlet)\", \"The Tragicall Historie of Hamlet, Prince of Denmarke\", \"Hamlet (Shakespeare)\", \"The Tragedy of Hamlet Prince of Denmark\", \"Hamlet (play)\", \"The Tragicall Historie of Hamlet, Prince of Denmarke.\", \"The Tragical History Of Hamlet Prince of Denmark\", \"Goodnight sweet prince\", \"The Murder Of Gonzago\", \"Hamlet, Prince of Denmark\", \"Man delights not me\", \"Hamlet\", \"Bernardo (Hamlet)\", \"The Tragedy of Hamlet\", \"The Tragedy of Hamlet, Prince of Denmark\"]", "[\"Petro-free\", \"Alternative fuel sources for motorcars\", \"Alternative fuel vehicle\", \"Alternative fuel cars\", \"Alternative energy vehicle\", \"Alternative propulsion\", \"Alternative motor vehicle\", \"ALTCAR\", \"Ecological propulsion\", \"Alternative powered car\", \"Petroleum-free\", \"Alternative fuel car\", \"Alternative Energy Vehicle\", \"Automobile propulsion technologies\", \"Alternative fuel vehicles\", \"Alternative-fuel vehicle\", \"AltCar\"]" ]
[ "An omelette made with smoked haddock invented at the Savoy Hotel was named after which author?", "In which European country was the Carnation Revolution on April 25th 1974?", "What kind of creatures are Sam, Merry and Pippin in the Lord of the Rings trilogy?", "\"What is the \"\"twin city\"\" of Minneapolis?\"", "Which Swedish prime minister was assassinated in February 1986 in Stockholm?", "What is the name for a group of lines that is repeated throughout a poem or song?", "Which sporting event, first held in July 1903, was the idea of Geo Lefevre, a journalist on L'Auto newspaper ?", "Who is the hero of George Orwell's novel 1984 ?", "Under what names were Janet and John books sold in the US?", "Which Disney cartoon character was originally known as Dippy Dawg ?", "In 1997, who was appointed the first female US Secretary of State?", "What is the name of the King of Halloween Town who tries to take over Christmas in the Disney movie The Nightmare Before Christmas?", "What famous billionaire investor lives in Omaha, Nebraska?", "At the Academy Awards, what was the first British film ever to win the Oscar for Best Film?", "Where was the venue for the hare-coursing 'Waterloo Cup'?" ]
15
[ 65100, 65101, 65102, 65103, 65104, 65105, 65106, 65107, 65108, 65109, 65110, 65111, 65112, 65113, 65114 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which disease used to be called infantile paralysis?\nQuestion 2: Which family ruled Russia from 1613 until the 1917 revolution?\nQuestion 3: The Sunda Trench is the deepest part of which ocean?\nQuestion 4: What volcano exploded in 1883 with the force of 200 megatons of TNT?\nQuestion 5: The first what in the UK took place on the night of Nov. 19th, 1994?\nQuestion 6: Who was the last Tudor monarch of England?\nQuestion 7: Which cartoon show was turned into a film called Bigger, Longer and Uncut in 1999\nQuestion 8: In response to the crappy reputation High Fructose Corn Syrup has these days, the Corn Refiners Association has applied for permission to rename it to what?\nQuestion 9: Which of Henry VIII’s wives had twice been widowed when they married?\nQuestion 10: The 'Dames Pipi' are traditional Parisien?\nQuestion 11: What colour is the sky on the Moon?\nQuestion 12: Name the Greek goddess of peace.\nQuestion 13: At which castle did Edward II meet his gruesome death in 1327?\nQuestion 14: The American War of Independence began as a war between the Kingdom of Great Britain and how many British colonies in North America?\nQuestion 15: Which artist painted the 'Man in a Red Turban'?", "role": "user" } ]
["[\"Acute poliomyelitis\", \"Abortive poliomyelitis\", \"Polio\", \"Heine-Medin's disease\", \"Poliomyelitis, bulbar\", \"Debility of the lower extremities\", \"Poliomyletis\", \"Acute anterior poliomyelitis\", \"POLIOMYELITIS\", \"Heine-Medin disease\", \"Bulbar poliomyelitis\", \"Infantile Paralysis\", \"Paralytic polio\", \"Poliomyelitiss\", \"Paralytic poliomyelitis\", \"Poliomyelitis\", \"Poliomyelitis, paralytic\", \"Bulbar polio\", \"Poliomylitis\", \"Infantile paralysis\"]", "[\"House of romanov\", \"Romanovs\", \"Holstein-Gottorp-Romanov\", \"Russian Royal Family\", \"Romanoff\", \"House of Romanovs\", \"Russian Imperial Family\", \"Zakharyin-Yuriev\", \"House of Romanov\", \"Romanov Dynasty\", \"ROMANOV\", \"Romanova\", \"Romanov\", \"Romanov-Holstein-Gottorp\", \"Romanov family\", \"Russian imperial family\", \"Romanov dynasty\", \"House of Holstein-Gottorp-Romanov\", \"Russian Imperial family\", \"Imperial House of Russia\"]", "[\"India Ocean\", \"Indian Sea\", \"Southern Indian Ocean\", \"North Indian Ocean\", \"Indian ocean\", \"Asian Ocean\", \"The Indian Ocean\", \"Indian Ocean\"]", "[\"Anak Krakatau\", \"Krakitoa\", \"Cracatau\", \"Krakatoa\", \"Krakatowa\", \"Crokatoa\", \"Anak Krakatoa\", \"Krakatua eruption 1883\", \"Krakatao\", \"Telok Batong\", \"Krackatoa\", \"Mount Anak Krakatau\", \"KRAKATOA\", \"Krakatoan eruption\", \"Krakatua\", \"Krakatoan Eruption\", \"Mt krakatoa\", \"Krakatau\"]", "[\"NATIONAL LOTTERY DRAW\"]", "[\"The Gloriana\", \"Queen Elisabeth of england\", \"Elizabeth the First\", \"Queene Elisabeth of England\", \"Bess of England\", \"Elizabeth I of Ireland\", \"Queen Elizabeth 1\", \"Queen Elisabeth I\", \"Elizabeth I (England)\", \"Elizabeth I of Great Britain\", \"Queen of England Elizabeth\", \"Queen Elizabeth the first\", \"Queen Elizabeth I of England\", \"Elizabeth the first\", \"Elizabeth I of the United Kingdom\", \"Queen of England Elizabeth I\", \"QEI\", \"Elizabeth I\", \"Queen Elizabeth of England\", \"Elisabeth 1st\", \"La Vita della Regina Elizabetta\", \"Elisabeth I of England\", \"Elisabeth of England\", \"Queen Elizabeth the First\", \"Elizabeth I of England\", \"Good Queen Bess\", \"Liz 1\", \"Virgin Queen\", \"Elizabeth 1\", \"Queen Elizabeth l\", \"Elizabeth of England\", \"Elizabeth I Tudor\", \"Elizabeth Tudor\", \"Elizabeth I, Queen of England\", \"Elizabeth the 1st\", \"Queen Elizabeth I\", \"Elizabeth i of england\", \"Elisabeth I\"]", "[\"South Park Studios\", \"Cheesy Poofs\", \"I'm not just sure, I'm HIV positive\", \"Little Danny Pocket\", \"South Park Opening Credits\", \"Sout Park\", \"South Park Studios.com\", \"Commentary minis\", \"Southparkstudios.com\", \"South Park (cartoon)\", \"Tardicaca shark\", \"South Park, Colorado\", \"South Park title sequence\", \"Soutpark\", \"South Park Digital Studios\", \"South Park\", \"Hell's Pass\", \"Year of the fan\", \"Huntin' and Killin'\", \"YOTF\", \"South Park opening credits\", \"South park\", \"South pakr\", \"SouthParkStudios.com\", \"South Park opening sequence\", \"Tynacorp\", \"South Park theme tune\", \"Lord of the underworld\", \"Hell's Pass Hospital\", \"Authorita\", \"South Park Opening\", \"South Park (TV series)\", \"South Park theme\"]", "[\"Corn sugar (disambiguation)\", \"Corn Sugar\", \"Corn sugar\"]", "[\"Katheryn Parre\", \"Queen Katherine Parr\", \"Kateryn Parre\", \"Katherine Parr\", \"Katharine Parr\", \"Catherine Parr\", \"Catherine Parre\", \"Lady Latimer\", \"Catherine Borough\", \"Katherine Borough\", \"Katheryn Parr\", \"Kateryn Parr\", \"Anthony Martienssen\", \"Katharine Parre\", \"Katherine Parre\", \"KATHARINE PARR\", \"Queen Catherine Parr\", \"Lady Lattimer\"]", "[\"Public toilet attendants\"]", "[\"Blackishly\", \"Color/black\", \"Blackly\", \"Black (color)\", \"Rgb(0, 0, 0)\", \"000000\", \"Blackeness\", \"Blackishness\", \"Black (colour)\", \"Color/Black\", \"Blackest\", \"(0, 0, 0)\", \"Ultimately dark\", \"Black is not a Color\", \"Black\", \"Black (Colour)\", \"BLACK\"]", "[\"Eirene\", \"Irini\", \"Ir\\u00e8ne\", \"Irene (film)\", \"Irene (disambiguation)\", \"Eirini\", \"Irene (ship)\", \"Irene\"]", "[\"Berkely\", \"Berkeley\", \"Berkeley (disambiguation)\"]", "[\"13\", \"thirteen\"]", "[\"J. Van Eyck\", \"Worship of the Lamb\", \"Jan van Eyck\", \"Van Eyk\", \"Jan van Ike\", \"John Van Eych\", \"Jan Van Eyck\", \"Johannes de Eyck\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Acute poliomyelitis\", \"Abortive poliomyelitis\", \"Polio\", \"Heine-Medin's disease\", \"Poliomyelitis, bulbar\", \"Debility of the lower extremities\", \"Poliomyletis\", \"Acute anterior poliomyelitis\", \"POLIOMYELITIS\", \"Heine-Medin disease\", \"Bulbar poliomyelitis\", \"Infantile Paralysis\", \"Paralytic polio\", \"Poliomyelitiss\", \"Paralytic poliomyelitis\", \"Poliomyelitis\", \"Poliomyelitis, paralytic\", \"Bulbar polio\", \"Poliomylitis\", \"Infantile paralysis\"]", "[\"House of romanov\", \"Romanovs\", \"Holstein-Gottorp-Romanov\", \"Russian Royal Family\", \"Romanoff\", \"House of Romanovs\", \"Russian Imperial Family\", \"Zakharyin-Yuriev\", \"House of Romanov\", \"Romanov Dynasty\", \"ROMANOV\", \"Romanova\", \"Romanov\", \"Romanov-Holstein-Gottorp\", \"Romanov family\", \"Russian imperial family\", \"Romanov dynasty\", \"House of Holstein-Gottorp-Romanov\", \"Russian Imperial family\", \"Imperial House of Russia\"]", "[\"India Ocean\", \"Indian Sea\", \"Southern Indian Ocean\", \"North Indian Ocean\", \"Indian ocean\", \"Asian Ocean\", \"The Indian Ocean\", \"Indian Ocean\"]", "[\"Anak Krakatau\", \"Krakitoa\", \"Cracatau\", \"Krakatoa\", \"Krakatowa\", \"Crokatoa\", \"Anak Krakatoa\", \"Krakatua eruption 1883\", \"Krakatao\", \"Telok Batong\", \"Krackatoa\", \"Mount Anak Krakatau\", \"KRAKATOA\", \"Krakatoan eruption\", \"Krakatua\", \"Krakatoan Eruption\", \"Mt krakatoa\", \"Krakatau\"]", "[\"NATIONAL LOTTERY DRAW\"]", "[\"The Gloriana\", \"Queen Elisabeth of england\", \"Elizabeth the First\", \"Queene Elisabeth of England\", \"Bess of England\", \"Elizabeth I of Ireland\", \"Queen Elizabeth 1\", \"Queen Elisabeth I\", \"Elizabeth I (England)\", \"Elizabeth I of Great Britain\", \"Queen of England Elizabeth\", \"Queen Elizabeth the first\", \"Queen Elizabeth I of England\", \"Elizabeth the first\", \"Elizabeth I of the United Kingdom\", \"Queen of England Elizabeth I\", \"QEI\", \"Elizabeth I\", \"Queen Elizabeth of England\", \"Elisabeth 1st\", \"La Vita della Regina Elizabetta\", \"Elisabeth I of England\", \"Elisabeth of England\", \"Queen Elizabeth the First\", \"Elizabeth I of England\", \"Good Queen Bess\", \"Liz 1\", \"Virgin Queen\", \"Elizabeth 1\", \"Queen Elizabeth l\", \"Elizabeth of England\", \"Elizabeth I Tudor\", \"Elizabeth Tudor\", \"Elizabeth I, Queen of England\", \"Elizabeth the 1st\", \"Queen Elizabeth I\", \"Elizabeth i of england\", \"Elisabeth I\"]", "[\"South Park Studios\", \"Cheesy Poofs\", \"I'm not just sure, I'm HIV positive\", \"Little Danny Pocket\", \"South Park Opening Credits\", \"Sout Park\", \"South Park Studios.com\", \"Commentary minis\", \"Southparkstudios.com\", \"South Park (cartoon)\", \"Tardicaca shark\", \"South Park, Colorado\", \"South Park title sequence\", \"Soutpark\", \"South Park Digital Studios\", \"South Park\", \"Hell's Pass\", \"Year of the fan\", \"Huntin' and Killin'\", \"YOTF\", \"South Park opening credits\", \"South park\", \"South pakr\", \"SouthParkStudios.com\", \"South Park opening sequence\", \"Tynacorp\", \"South Park theme tune\", \"Lord of the underworld\", \"Hell's Pass Hospital\", \"Authorita\", \"South Park Opening\", \"South Park (TV series)\", \"South Park theme\"]", "[\"Corn sugar (disambiguation)\", \"Corn Sugar\", \"Corn sugar\"]", "[\"Katheryn Parre\", \"Queen Katherine Parr\", \"Kateryn Parre\", \"Katherine Parr\", \"Katharine Parr\", \"Catherine Parr\", \"Catherine Parre\", \"Lady Latimer\", \"Catherine Borough\", \"Katherine Borough\", \"Katheryn Parr\", \"Kateryn Parr\", \"Anthony Martienssen\", \"Katharine Parre\", \"Katherine Parre\", \"KATHARINE PARR\", \"Queen Catherine Parr\", \"Lady Lattimer\"]", "[\"Public toilet attendants\"]", "[\"Blackishly\", \"Color/black\", \"Blackly\", \"Black (color)\", \"Rgb(0, 0, 0)\", \"000000\", \"Blackeness\", \"Blackishness\", \"Black (colour)\", \"Color/Black\", \"Blackest\", \"(0, 0, 0)\", \"Ultimately dark\", \"Black is not a Color\", \"Black\", \"Black (Colour)\", \"BLACK\"]", "[\"Eirene\", \"Irini\", \"Ir\\u00e8ne\", \"Irene (film)\", \"Irene (disambiguation)\", \"Eirini\", \"Irene (ship)\", \"Irene\"]", "[\"Berkely\", \"Berkeley\", \"Berkeley (disambiguation)\"]", "[\"13\", \"thirteen\"]", "[\"J. Van Eyck\", \"Worship of the Lamb\", \"Jan van Eyck\", \"Van Eyk\", \"Jan van Ike\", \"John Van Eych\", \"Jan Van Eyck\", \"Johannes de Eyck\"]" ]
[ "Which disease used to be called infantile paralysis?", "Which family ruled Russia from 1613 until the 1917 revolution?", "The Sunda Trench is the deepest part of which ocean?", "What volcano exploded in 1883 with the force of 200 megatons of TNT?", "The first what in the UK took place on the night of Nov. 19th, 1994?", "Who was the last Tudor monarch of England?", "Which cartoon show was turned into a film called Bigger, Longer and Uncut in 1999", "In response to the crappy reputation High Fructose Corn Syrup has these days, the Corn Refiners Association has applied for permission to rename it to what?", "Which of Henry VIII’s wives had twice been widowed when they married?", "The 'Dames Pipi' are traditional Parisien?", "What colour is the sky on the Moon?", "Name the Greek goddess of peace.", "At which castle did Edward II meet his gruesome death in 1327?", "The American War of Independence began as a war between the Kingdom of Great Britain and how many British colonies in North America?", "Which artist painted the 'Man in a Red Turban'?" ]
15
[ 13605, 13606, 13607, 13608, 13609, 13610, 13611, 13612, 13613, 13614, 13615, 13616, 13617, 13618, 13619 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: ‘Ruby Rose’ is Cockney rhyming slang for which part of the body?\nQuestion 2: Which stretch of water separates the Orkneys from Scotland\nQuestion 3: Middelburg is the capital of which province in the South West of The Netherlands?\nQuestion 4: What is the currency of Algeria?\nQuestion 5: Former Dutch Guiana is now known by what name?\nQuestion 6: What is the Russian rocket launch and development site in the Astrakhan Oblast, between Volgograd and Astrakhan, established in 1946?\nQuestion 7: Name the detective in'The Mousetrap'?\nQuestion 8: Who wrote the book The Woman in White?\nQuestion 9: Give a year in the life of composer, conductor and pianist Carl Maria von Weber.\nQuestion 10: What pub chain was founded by Tim Martin in 1975?\nQuestion 11: The European city of Rome lies on which river?\nQuestion 12: \"According to Kenneth Graham (in Wind in the Willows) there is \"\"nothing - absolutely nothing half so much worth doing as ...\"\" what?\"\nQuestion 13: Who was lost in France in 1976?\nQuestion 14: Which football league club plays its home games at the Weston Homes Community Stadium?\nQuestion 15: Who was elected President of the Palestinian National Authority in January 2005?", "role": "user" } ]
["[\"Noses\", \"Schnoz\", \"Nose\", \"Schnozzle\", \"Schnozz\", \"Smeller\"]", "[\"An Caol Arcach\", \"Pentland Firth\"]", "[\"Zeeland\", \"Old Zealand\", \"Zeeuwsvlaanderen\", \"Zealand (The Netherlands)\", \"Zeeland (province)\", \"Ze\\u00ealand\"]", "[\"Dinar\", \"\\u062f\\u064a\\u0646\\u0627\\u0631\", \"Dinars\"]", "[\"Republic of Suriname\", \"Subdivisions of Suriname\", \"Administrative divisions of Suriname\", \"Sport in Suriname\", \"ISO 3166-1:SR\", \"Surinam\", \"Sranang\", \"Surinamese\", \"Health in Suriname\", \"Suriname\", \"Languages of Suriname\", \"Public holidays in Suriname\", \"Republiek Suriname\", \"NGY\", \"Etymology of Suriname\"]", "[\"Russian Roswell\", \"Kapustin Yar\", \"Kapustin-Yar\", \"Zhitkur\", \"Russia's Roswell\"]", "[\"'SERGEANT TROTTER'\"]", "[\"Collins, Wilkie\", \"WW Collins\", \"Collinsian\", \"William Wilkie Collins\", \"Wilkie Collins\", \"William %22Wilkie%22 Collins\"]", "[\"1786-1826\"]", "[\"Wetherspoon's\", \"J.D. Wetherspoons\", \"J D Wetherspoon\", \"J.D. Weatherspoons\", \"Wetherspoon\", \"Tim Martin (Wetherspoons)\", \"Weatherspoons\", \"Wetherspoons (pub chain)\", \"JD Wetherspoon\", \"Spoon's\", \"Lloyds No. 1\", \"Wetherspoon\\u2019s\", \"Witherspoon's\", \"Wetherspoon(J D) plc\", \"Wetherspoon (J D) plc\", \"JD Weatherspoon\", \"Wetherspoons\"]", "[\"Tiber\", \"River Tiber\", \"Tevere\", \"The Tiber\", \"Tiber river\", \"Tiber River\", \"Tiberis\"]", "[\"(simply) messing about in boats\"]", "[\"Gaynor Hopkins\", \"Bonnie Tyler\", \"Bonnie Tylor\", \"Bonnie tyler awards\", \"List of Bonnie Tyler awards\"]", "[\"Colchester United F.C.\", \"Colchester United Football Club\", \"Colchester United\", \"Colchester United F. C.\", \"Colchester United FC\", \"Col U\", \"Colchester United F C\"]", "[\"Mahmoud Abbas\", \"Abu Mazen\", \"MAHMOUD ABBAS\", \"\\u00c5b\\u00fa M\\u00e1z\\u0269n\", \"Mahmood Abbas\", \"Mahmoud 'Abbas\", \"Abbas, Mahmoud\", \"Mahmud 'Abbas\", \"Mahmud Abbas\", \"Ma\\u1e25m\\u016bd \\u02bfAbb\\u0101s\", \"Mahmood Abass\", \"\\u0645\\u062d\\u0645\\u0648\\u062f \\u0639\\u0628\\u0627\\u0633\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Noses\", \"Schnoz\", \"Nose\", \"Schnozzle\", \"Schnozz\", \"Smeller\"]", "[\"An Caol Arcach\", \"Pentland Firth\"]", "[\"Zeeland\", \"Old Zealand\", \"Zeeuwsvlaanderen\", \"Zealand (The Netherlands)\", \"Zeeland (province)\", \"Ze\\u00ealand\"]", "[\"Dinar\", \"\\u062f\\u064a\\u0646\\u0627\\u0631\", \"Dinars\"]", "[\"Republic of Suriname\", \"Subdivisions of Suriname\", \"Administrative divisions of Suriname\", \"Sport in Suriname\", \"ISO 3166-1:SR\", \"Surinam\", \"Sranang\", \"Surinamese\", \"Health in Suriname\", \"Suriname\", \"Languages of Suriname\", \"Public holidays in Suriname\", \"Republiek Suriname\", \"NGY\", \"Etymology of Suriname\"]", "[\"Russian Roswell\", \"Kapustin Yar\", \"Kapustin-Yar\", \"Zhitkur\", \"Russia's Roswell\"]", "[\"'SERGEANT TROTTER'\"]", "[\"Collins, Wilkie\", \"WW Collins\", \"Collinsian\", \"William Wilkie Collins\", \"Wilkie Collins\", \"William %22Wilkie%22 Collins\"]", "[\"1786-1826\"]", "[\"Wetherspoon's\", \"J.D. Wetherspoons\", \"J D Wetherspoon\", \"J.D. Weatherspoons\", \"Wetherspoon\", \"Tim Martin (Wetherspoons)\", \"Weatherspoons\", \"Wetherspoons (pub chain)\", \"JD Wetherspoon\", \"Spoon's\", \"Lloyds No. 1\", \"Wetherspoon\\u2019s\", \"Witherspoon's\", \"Wetherspoon(J D) plc\", \"Wetherspoon (J D) plc\", \"JD Weatherspoon\", \"Wetherspoons\"]", "[\"Tiber\", \"River Tiber\", \"Tevere\", \"The Tiber\", \"Tiber river\", \"Tiber River\", \"Tiberis\"]", "[\"(simply) messing about in boats\"]", "[\"Gaynor Hopkins\", \"Bonnie Tyler\", \"Bonnie Tylor\", \"Bonnie tyler awards\", \"List of Bonnie Tyler awards\"]", "[\"Colchester United F.C.\", \"Colchester United Football Club\", \"Colchester United\", \"Colchester United F. C.\", \"Colchester United FC\", \"Col U\", \"Colchester United F C\"]", "[\"Mahmoud Abbas\", \"Abu Mazen\", \"MAHMOUD ABBAS\", \"\\u00c5b\\u00fa M\\u00e1z\\u0269n\", \"Mahmood Abbas\", \"Mahmoud 'Abbas\", \"Abbas, Mahmoud\", \"Mahmud 'Abbas\", \"Mahmud Abbas\", \"Ma\\u1e25m\\u016bd \\u02bfAbb\\u0101s\", \"Mahmood Abass\", \"\\u0645\\u062d\\u0645\\u0648\\u062f \\u0639\\u0628\\u0627\\u0633\"]" ]
[ "‘Ruby Rose’ is Cockney rhyming slang for which part of the body?", "Which stretch of water separates the Orkneys from Scotland", "Middelburg is the capital of which province in the South West of The Netherlands?", "What is the currency of Algeria?", "Former Dutch Guiana is now known by what name?", "What is the Russian rocket launch and development site in the Astrakhan Oblast, between Volgograd and Astrakhan, established in 1946?", "Name the detective in'The Mousetrap'?", "Who wrote the book The Woman in White?", "Give a year in the life of composer, conductor and pianist Carl Maria von Weber.", "What pub chain was founded by Tim Martin in 1975?", "The European city of Rome lies on which river?", "\"According to Kenneth Graham (in Wind in the Willows) there is \"\"nothing - absolutely nothing half so much worth doing as ...\"\" what?\"", "Who was lost in France in 1976?", "Which football league club plays its home games at the Weston Homes Community Stadium?", "Who was elected President of the Palestinian National Authority in January 2005?" ]
15
[ 130620, 130621, 130622, 130623, 130624, 130625, 130626, 130627, 130628, 130629, 130630, 130631, 130632, 130633, 130634 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which classical composter wrote 'The Snow Maiden' and 'The Golden Cockerel'?\nQuestion 2: Who plays Stephen in the 2012 film ‘Django Unchained’?\nQuestion 3: What American DJ was nicknamed Moondog?\nQuestion 4: In 1953 Ethel and Julius Rosenberg were executed in the USA for spying for which country?\nQuestion 5: Who composed 'The Sorcerer's Apprentice'?\nQuestion 6: What was the name of the ground-breaking 'thought experiment' proposed by an Austrian Scientist in 1935?\nQuestion 7: The Basques are native people of France and which other neighbouring country?\nQuestion 8: \"Name the year - An earthquake in Haiti kills over 300,000 people, A P McCoy wins the Grand National on \"\"Don't push it\"\" and Deepwater Horizon rig explodes in the Gulf of Mexico?\"\nQuestion 9: What was the former name of Surinam?\nQuestion 10: In mythology, who is the Roman god of fire?\nQuestion 11: On which programme is the presenter followed around by a dog called Nigel?\nQuestion 12: \"Which English composer, whose work was influenced by folk song and the music of the 16th century, wrote \"\"London Symphony\"\", \"\"Pilgrim's Progress\"\" and \"\"Sinfonia Antarctica\"\"?\"\nQuestion 13: The Nordic countries (Denmark, Sweden, Norway notably) tend to celebrate Christmas chiefly on which date?\nQuestion 14: Who hosts TV's Water Colour Challenge\nQuestion 15: Who was Hitler's Prime Minister in Prussia?", "role": "user" } ]
["[\"Nikolai Rimsky Korsakov\", \"Rimsky Korsakoff\", \"Nikolay Rimsky-Korsakov\", \"Rimsky-Korsakov, Nikolay Andreyevich\", \"Nikolai Andreyevich Rimski-Korsakov\", \"Rimsky-korsakov\", \"Rimskij-Korsakov\", \"Nikolay Andreyevich Rimsky-Korsakoff\", \"Rimsky-Korsakof\", \"Nikolay Rimsky-Korsakoff\", \"Nikolai Andreyevich Rimsky-Korsakoff\", \"Nikolai Andrejewitsch Rimsky-Korsakow\", \"Nikolaj Andreevi\\u010d Rimskij-Korsakov\", \"Rimsky korsakov\", \"Rimsy-korsakov\", \"Nikolaj Rimskij-Korsakov\", \"Rimsky-Korsakov\", \"Nikolai Rimsky-Korsakoff\", \"Nicolas Andreievich Rimsky-Korsakov\", \"Nicolai Andreyevich Rimsky-Korsakov\", \"Nikolaj Rimsky-Korsakov\", \"RIMSKY KORSAKOV\", \"Nikolaj Andreevic Rimskij-Korsakov\", \"Nikolay Andreyevich Rimsky-Korsakov\", \"\\u041d\\u0438\\u043a\\u043e\\u043b\\u0430\\u0439 \\u0420\\u0438\\u043c\\u0441\\u043a\\u0438\\u0439-\\u041a\\u043e\\u0440\\u0441\\u0430\\u043a\\u043e\\u0432\", \"Nikolai Rimsky-Korsakov\", \"Nikolai Andreievich Rimsky-Korsakov\", \"Nikolai Andreyevich Rimsky-Korsakov\", \"Nicolas Rimsky-Korsakov\", \"Nicolai Rimsky-Korsakov\", \"Rimsky-Korsakoff\", \"Rimsky-Korsakov, Nicolai Andreyevich\", \"Nikolai Andreevich Rimski-Korsakov\", \"Nikolai Rimski-Korsakov\", \"Nikolay Rimsky Korsakov\", \"Nikolai Rimsky Korsakoff\"]", "[\"SL Jackson\", \"S. L. Jackson\", \"Samuel Leroy Jackson\", \"Sam L\", \"S.L. Jackson\", \"Jackson, Samuel\", \"Samuel L. Jackson\", \"Samuel Jackson\", \"Samuel L Jackson\", \"Samuel L\"]", "[\"Alan Freed and payola\", \"Allan freed\", \"Alan Freed and the Payola Scandal\", \"Alan Freed\", \"Freed, Alan\"]", "[\"The U.\\u2013S.\\u2013S.\\u2013R.\", \"\\u0421\\u043e\\u0432\\u0435\\u0442\\u0441\\u043a\\u043e\\u0439 \\u0421\\u043e\\u0446\\u0438\\u0430\\u043b\\u0438\\u0441\\u0442\\u0438\\u0447\\u0435\\u0441\\u043a\\u043e\\u0439 \\u0420\\u0435\\u0441\\u043f\\u0443\\u0431\\u043b\\u0438\\u043a\\u0430\\u043e\\u0441\\u043b\\u044d\\u043d \\u0421\\u043e\\u044e\\u0437\\u0437\\u044b\", \"\\u0421\\u043e\\u0432\\u0435\\u0442 \\u0423\\u0448\\u0435\\u043c\", \"The Soviet\\u2013Union\", \"The Soviet-Union\", \"U.\\u2013S.\\u2013S.\\u2013R.\", \"SRSR\", \"C.C.C.P.\", \"SU (country)\", \"U\\u2013S\\u2013S\\u2013R\", \"Soviet\\u2013Union\", \"The U\\u2013S\\u2013S\\u2013R\", \"The U.S.S.R.\", \"The Union of Socialist Soviet Republics\", \"U S S R\", \"U. S. S. R.\", \"The C.C.C.P.\", \"CPCP\", \"SSSR\", \"The U S S R\", \"Soviet\", \"The Soviets\", \"CCCP%5C\", \"C\\u2013C\\u2013C\\u2013P\", \"The USSR\", \"C C C P\", \"The C. C. C. P.\", \"The C\\u2013C\\u2013C\\u2013P\", \"U.-S.-S.-R.\", \"\\u0421\\u0421\\u0421\\u0420\", \"United Soviet Socialist Republics\", \"C.\\u2013C.\\u2013C.\\u2013P.\", \"\\u0421\\u043e\\u0432\\u0435\\u0442\\u0441\\u043a\\u0430\\u0439 \\u0421\\u043e\\u0446\\u0438\\u0430\\u043b\\u0438\\u0441\\u0442\\u0438\\u0447\\u0435\\u0441\\u043a\\u0430\\u0439 \\u0420\\u0435\\u0441\\u043f\\u0443\\u0431\\u043b\\u0438\\u043a\\u0430\\u043b\\u0430\\u0440 \\u0421\\u043e\\u044e\\u0437\\u0442\\u0430\\u0440\\u0430\", \"Sowjetunion\", \"The Union of Soviet Socialist Republics\", \"Sovyet Union\", \"USSR\", \"SovietUnion\", \"\\u0421\\u043e\\u0432\\u0435\\u0442 \\u0421\\u043e\\u0446\\u0438\\u0430\\u043b\\u0438\\u0441\\u0442\\u0438\\u043a \\u0420\\u0435\\u0441\\u043f\\u0443\\u0431\\u043b\\u0438\\u043a\\u0430\\u043b\\u0430\\u0440 \\u0421\\u043e\\u044e\\u0437\\u044b\", \"Neuvostoliitto\", \"UdSSR\", \"\\u10e1\\u10e1\\u10e0\\u10d9\", \"USSr\", \"The CCCP\", \"Soviet union\", \"Sovietic Union\", \"The union of Soviet Socialist Rebublics\", \"Soyuz Sovietskikh Sotsialisticheskikh Respublik\", \"The U-S-S-R\", \"S.U. (country)\", \"\\u0421\\u043e\\u044e\\u0437 \\u0421\\u043e\\u0432\\u0435\\u0442\\u0441\\u043a\\u0438\\u0445 \\u0421\\u043e\\u0446\\u0438\\u0430\\u043b\\u0438\\u0441\\u0442\\u0438\\u0447\\u0435\\u0441\\u043a\\u0438\\u0445 \\u0420\\u0435\\u0441\\u043f\\u0443\\u0431\\u043b\\u0438\\u043a\", \"United soviet socialist republic\", \"C-C-C-P\", \"U-S-S-R\", \"Union of Soviet Socialist Republic\", \"United Soviets Socialist Rebublic\", \"Union of Soviet Socialist Republics (USSR)\", \"The Soviet\", \"Sovetskij Soyuz\", \"Soveit Union\", \"Sovietsky Soyuz\", \"Union of soviet socialist republics\", \"The C.\\u2013C.\\u2013C.\\u2013P.\", \"The Soviet Union\", \"U.S.S.R\", \"Sovyet-Union\", \"The U.-S.-S.-R.\", \"Sovetskiy Soyuz\", \"Sovjet\", \"United soviets socialist republic\", \"U.S.S.R.\", \"Ussr\", \"\\u0421\\u043e\\u0432\\u0435\\u0442\\u0441\\u043a\\u0438\\u0439 \\u0421\\u043e\\u044e\\u0437\", \"\\u0421\\u043e\\u044e\\u0437 \\u0421\\u043e\\u0432\\u0435\\u0442\\u0441\\u043a\\u0438\\u0445 \\u0421\\u043e\\u0446\\u0438\\u0430\\u043b\\u0438\\u0441\\u0442\\u0438\\u0447\\u0435\\u0441\\u043a\\u0430\\u044f \\u0420\\u0435\\u0441\\u043f\\u0443\\u0431\\u043b\\u0438\\u043a\\u0430\", \"The C C C P\", \"\\u0421\\u043e\\u0432\\u0435\\u0442 \\u0421\\u043e\\u0446\\u0438\\u0430\\u043b\\u0438\\u0441\\u0442\\u0438\\u0433 \\u0420\\u0435\\u0441\\u043f\\u0443\\u0431\\u043b\\u0438\\u043a\\u0430\\u043b\\u0430\\u0440\\u043d\\u044b\\u04a3 \\u042d\\u0432\\u0438\\u043b\\u0435\\u043b\\u0438\", \"All-union\", \"Cccp\", \"Union of Soviet Socialist Republics\", \"European USSR\", \"All-Union\", \"The U. S. S. R.\", \"CCCP\", \"\\u0421\\u043e\\u044e\\u0301\\u0437 \\u0421\\u043e\\u0432\\u0435\\u0301\\u0442\\u0441\\u043a\\u0438\\u0445 \\u0421\\u043e\\u0446\\u0438\\u0430\\u043b\\u0438\\u0441\\u0442\\u0438\\u0301\\u0447\\u0435\\u0441\\u043a\\u0438\\u0445 \\u0420\\u0435\\u0441\\u043f\\u0443\\u0301\\u0431\\u043b\\u0438\\u043a\", \"TSRS\", \"Soyuz Sovetskikh Sotsialisticheskikh Respublik\", \"\\u0421\\u043e\\u0432\\u0435\\u0442\\u043b\\u0430\\u0440 \\u0421\\u043e\\u044e\\u0437\\u044b\", \"The C-C-C-P\", \"Soviet Union\", \"C. C. C. P.\", \"Union of Socialist Soviet Republics\", \"PSRS\", \"United Soviet Socialist Rebublic\", \"Sovietunion\", \"Soviet-Union\", \"C.-C.-C.-P.\", \"The C.-C.-C.-P.\", \"Soviets\", \"The Union of Soviet Socialist Republics (U.S.S.R)\", \"\\u0421\\u043e\\u0432\\u0435\\u0442\\u0441\\u043a\\u0430\\u0439 \\u0421\\u043e\\u044e\\u0437\"]", "[\"Paul dukas\", \"Paul Dukas\", \"Paul Abraham Dukas\", \"Paul A. Dukas\", \"PAUL DUKAS\", \"Ballets by Paul Dukas\"]", "[\"Schroedinger's Cat\", \"Schrodinger cat\", \"Shrodinger cat paradox\", \"Schrodingers cat\", \"Schr\\u00f6dinger's cat experiment\", \"Schroedinger\\u2019s Cat\", \"Schrodinger's Cat\", \"Shrodinger's cat\", \"Schr\\u00f6dinger Cat\", \"Schr\\u00f6dinger's Cat\", \"Schrodinger Cat\", \"Schroedinger cat\", \"Schrodingers Cat\", \"Schr\\u00f6dinger\\u2019s cat\", \"Cat experiment\", \"SCHRODINGER'S CAT\", \"Schrodinger's cat paradox\", \"Schr\\u00f6dingers Cat\", \"Schr\\u00f6dinger's cat\", \"Schrodeger's cat\", \"Schroedinger Cat\", \"Schr\\u00f6dinger's Paradox\", \"Shroedinger cat paradox\", \"Quote Schrodinger cat\", \"Quote Schr\\u00f6dinger cat\", \"Schroedinger's cat paradox\", \"Shrodenger's cat\", \"Schroedingers cat\", \"Schrodinger\\u2019s Cat\", \"Schroedinger's cat\", \"Shr\\u00f6dinger cat paradox\", \"Schr\\u00f6dingers katt\", \"Shroedinger's Cat\", \"Schredinger's Cat\", \"Schrocat\", \"Schr\\u00f6dinger cat\", \"Quote Schroedinger cat\", \"Schrodinger's cat\", \"Schrodenger's cat\", \"Schr\\u00f6dinger's cat paradox\", \"Schroedingers Cat\", \"Shrodingers cat\"]", "[\"Islands of Spain\", \"Espa\\u00f1a\", \"Reino de Espa\\u00f1a\", \"Name of Spain\", \"Espagna\", \"Espa\\u0144a\", \"Reino de Espana\", \"Espana\", \"Kingdom of the Spains\", \"The Spanish Society\", \"Espainia\", \"Mountains of Spain\", \"Regne d'Espanya\", \"The kingdom of Spain\", \"SPAIN\", \"Regne d'Espanha\", \"Espanya\", \"Espainiako Erresuma\", \"Etymology of Spain\", \"Spane\", \"ISO 3166-1:ES\", \"Spain\", \"Spanish Kingdom\", \"Kingdom of Spain\", \"El Reino de Espa\\u00f1a\", \"El Reino de Espana\"]", "[\"two thousand and ten\", \"2010\"]", "[\"DUTCH GUIANA\", \"Netherlands Guiana\", \"Dutch Guiana\", \"Dutch Guiana (disambiguation)\", \"Dutch Guyana\"]", "[\"The Vulcan\", \"Vulcan (disambiguation)\", \"Vulcan\"]", "[\"Gardeners' World\", \"Gardener's World\", \"Gardeners World\", \"Gardener\\u2019s World\"]", "[\"Ralph Vaughan Williams\", \"Ballets by Ralph Vaughan Williams\", \"Ralph Vaughan-Williams\", \"Ralph Von Willams\", \"Vaughn Williams\", \"Vaughan Williams OM\", \"Vaughn williams\", \"Vaughan-Williams\", \"Vaughan Williams\", \"Ralph van williams\", \"Vaughn-Williams\", \"%22Ralph Vaughn-Williams%22\", \"Ralph Vaughn Williams\", \"Ralph Vaughan Williams OM\", \"Ralph Vaughan WIlliams\", \"Ralph Vaughn-Williams\", \"Vaughan williams\"]", "[\"24 December\", \"December 24th\", \"24th December\", \"Dec 24\", \"December 24\"]", "[\"Hannah Gordon\"]", "[\"Hermann William Goering\", \"Forschungstelle\", \"Goering, Hermann\", \"Herman Wilhelm Goring\", \"Goring, Herman\", \"Hermann Goring\", \"Hermann Goering\", \"G\\u00f6ring, Hermann\", \"G\\u00f6ring, Herman\", \"Goring, Hermann\", \"Herman Goring\", \"Herman Wilhelm Goering\", \"Herman Wilhelm G\\u00f6ring\", \"Hermann G\\u00f6ering\", \"Herman Goerring\", \"Herman William Goering\", \"Hermann William Goring\", \"Meier's trumpets\", \"Hermann Goeering\", \"Reichsmarschall Goering\", \"Hermann G\\u00f6ring\", \"Hermann William G\\u00f6ring\", \"Goering, Herman\", \"Hermann Gring\", \"Herman William G\\u00f6ring\", \"Hermann Wilhelm Goring\", \"Herman G\\u00f6ring\", \"Hermann Wilhelm G\\u00f6ring\", \"G\\u00f6ring\", \"Herman Goering\", \"Hermann Wilhelm Goering\", \"Goering\", \"Hermann Goerring\", \"Herman William Goring\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Nikolai Rimsky Korsakov\", \"Rimsky Korsakoff\", \"Nikolay Rimsky-Korsakov\", \"Rimsky-Korsakov, Nikolay Andreyevich\", \"Nikolai Andreyevich Rimski-Korsakov\", \"Rimsky-korsakov\", \"Rimskij-Korsakov\", \"Nikolay Andreyevich Rimsky-Korsakoff\", \"Rimsky-Korsakof\", \"Nikolay Rimsky-Korsakoff\", \"Nikolai Andreyevich Rimsky-Korsakoff\", \"Nikolai Andrejewitsch Rimsky-Korsakow\", \"Nikolaj Andreevi\\u010d Rimskij-Korsakov\", \"Rimsky korsakov\", \"Rimsy-korsakov\", \"Nikolaj Rimskij-Korsakov\", \"Rimsky-Korsakov\", \"Nikolai Rimsky-Korsakoff\", \"Nicolas Andreievich Rimsky-Korsakov\", \"Nicolai Andreyevich Rimsky-Korsakov\", \"Nikolaj Rimsky-Korsakov\", \"RIMSKY KORSAKOV\", \"Nikolaj Andreevic Rimskij-Korsakov\", \"Nikolay Andreyevich Rimsky-Korsakov\", \"\\u041d\\u0438\\u043a\\u043e\\u043b\\u0430\\u0439 \\u0420\\u0438\\u043c\\u0441\\u043a\\u0438\\u0439-\\u041a\\u043e\\u0440\\u0441\\u0430\\u043a\\u043e\\u0432\", \"Nikolai Rimsky-Korsakov\", \"Nikolai Andreievich Rimsky-Korsakov\", \"Nikolai Andreyevich Rimsky-Korsakov\", \"Nicolas Rimsky-Korsakov\", \"Nicolai Rimsky-Korsakov\", \"Rimsky-Korsakoff\", \"Rimsky-Korsakov, Nicolai Andreyevich\", \"Nikolai Andreevich Rimski-Korsakov\", \"Nikolai Rimski-Korsakov\", \"Nikolay Rimsky Korsakov\", \"Nikolai Rimsky Korsakoff\"]", "[\"SL Jackson\", \"S. L. Jackson\", \"Samuel Leroy Jackson\", \"Sam L\", \"S.L. Jackson\", \"Jackson, Samuel\", \"Samuel L. Jackson\", \"Samuel Jackson\", \"Samuel L Jackson\", \"Samuel L\"]", "[\"Alan Freed and payola\", \"Allan freed\", \"Alan Freed and the Payola Scandal\", \"Alan Freed\", \"Freed, Alan\"]", "[\"The U.\\u2013S.\\u2013S.\\u2013R.\", \"\\u0421\\u043e\\u0432\\u0435\\u0442\\u0441\\u043a\\u043e\\u0439 \\u0421\\u043e\\u0446\\u0438\\u0430\\u043b\\u0438\\u0441\\u0442\\u0438\\u0447\\u0435\\u0441\\u043a\\u043e\\u0439 \\u0420\\u0435\\u0441\\u043f\\u0443\\u0431\\u043b\\u0438\\u043a\\u0430\\u043e\\u0441\\u043b\\u044d\\u043d \\u0421\\u043e\\u044e\\u0437\\u0437\\u044b\", \"\\u0421\\u043e\\u0432\\u0435\\u0442 \\u0423\\u0448\\u0435\\u043c\", \"The Soviet\\u2013Union\", \"The Soviet-Union\", \"U.\\u2013S.\\u2013S.\\u2013R.\", \"SRSR\", \"C.C.C.P.\", \"SU (country)\", \"U\\u2013S\\u2013S\\u2013R\", \"Soviet\\u2013Union\", \"The U\\u2013S\\u2013S\\u2013R\", \"The U.S.S.R.\", \"The Union of Socialist Soviet Republics\", \"U S S R\", \"U. S. S. R.\", \"The C.C.C.P.\", \"CPCP\", \"SSSR\", \"The U S S R\", \"Soviet\", \"The Soviets\", \"CCCP%5C\", \"C\\u2013C\\u2013C\\u2013P\", \"The USSR\", \"C C C P\", \"The C. C. C. P.\", \"The C\\u2013C\\u2013C\\u2013P\", \"U.-S.-S.-R.\", \"\\u0421\\u0421\\u0421\\u0420\", \"United Soviet Socialist Republics\", \"C.\\u2013C.\\u2013C.\\u2013P.\", \"\\u0421\\u043e\\u0432\\u0435\\u0442\\u0441\\u043a\\u0430\\u0439 \\u0421\\u043e\\u0446\\u0438\\u0430\\u043b\\u0438\\u0441\\u0442\\u0438\\u0447\\u0435\\u0441\\u043a\\u0430\\u0439 \\u0420\\u0435\\u0441\\u043f\\u0443\\u0431\\u043b\\u0438\\u043a\\u0430\\u043b\\u0430\\u0440 \\u0421\\u043e\\u044e\\u0437\\u0442\\u0430\\u0440\\u0430\", \"Sowjetunion\", \"The Union of Soviet Socialist Republics\", \"Sovyet Union\", \"USSR\", \"SovietUnion\", \"\\u0421\\u043e\\u0432\\u0435\\u0442 \\u0421\\u043e\\u0446\\u0438\\u0430\\u043b\\u0438\\u0441\\u0442\\u0438\\u043a \\u0420\\u0435\\u0441\\u043f\\u0443\\u0431\\u043b\\u0438\\u043a\\u0430\\u043b\\u0430\\u0440 \\u0421\\u043e\\u044e\\u0437\\u044b\", \"Neuvostoliitto\", \"UdSSR\", \"\\u10e1\\u10e1\\u10e0\\u10d9\", \"USSr\", \"The CCCP\", \"Soviet union\", \"Sovietic Union\", \"The union of Soviet Socialist Rebublics\", \"Soyuz Sovietskikh Sotsialisticheskikh Respublik\", \"The U-S-S-R\", \"S.U. (country)\", \"\\u0421\\u043e\\u044e\\u0437 \\u0421\\u043e\\u0432\\u0435\\u0442\\u0441\\u043a\\u0438\\u0445 \\u0421\\u043e\\u0446\\u0438\\u0430\\u043b\\u0438\\u0441\\u0442\\u0438\\u0447\\u0435\\u0441\\u043a\\u0438\\u0445 \\u0420\\u0435\\u0441\\u043f\\u0443\\u0431\\u043b\\u0438\\u043a\", \"United soviet socialist republic\", \"C-C-C-P\", \"U-S-S-R\", \"Union of Soviet Socialist Republic\", \"United Soviets Socialist Rebublic\", \"Union of Soviet Socialist Republics (USSR)\", \"The Soviet\", \"Sovetskij Soyuz\", \"Soveit Union\", \"Sovietsky Soyuz\", \"Union of soviet socialist republics\", \"The C.\\u2013C.\\u2013C.\\u2013P.\", \"The Soviet Union\", \"U.S.S.R\", \"Sovyet-Union\", \"The U.-S.-S.-R.\", \"Sovetskiy Soyuz\", \"Sovjet\", \"United soviets socialist republic\", \"U.S.S.R.\", \"Ussr\", \"\\u0421\\u043e\\u0432\\u0435\\u0442\\u0441\\u043a\\u0438\\u0439 \\u0421\\u043e\\u044e\\u0437\", \"\\u0421\\u043e\\u044e\\u0437 \\u0421\\u043e\\u0432\\u0435\\u0442\\u0441\\u043a\\u0438\\u0445 \\u0421\\u043e\\u0446\\u0438\\u0430\\u043b\\u0438\\u0441\\u0442\\u0438\\u0447\\u0435\\u0441\\u043a\\u0430\\u044f \\u0420\\u0435\\u0441\\u043f\\u0443\\u0431\\u043b\\u0438\\u043a\\u0430\", \"The C C C P\", \"\\u0421\\u043e\\u0432\\u0435\\u0442 \\u0421\\u043e\\u0446\\u0438\\u0430\\u043b\\u0438\\u0441\\u0442\\u0438\\u0433 \\u0420\\u0435\\u0441\\u043f\\u0443\\u0431\\u043b\\u0438\\u043a\\u0430\\u043b\\u0430\\u0440\\u043d\\u044b\\u04a3 \\u042d\\u0432\\u0438\\u043b\\u0435\\u043b\\u0438\", \"All-union\", \"Cccp\", \"Union of Soviet Socialist Republics\", \"European USSR\", \"All-Union\", \"The U. S. S. R.\", \"CCCP\", \"\\u0421\\u043e\\u044e\\u0301\\u0437 \\u0421\\u043e\\u0432\\u0435\\u0301\\u0442\\u0441\\u043a\\u0438\\u0445 \\u0421\\u043e\\u0446\\u0438\\u0430\\u043b\\u0438\\u0441\\u0442\\u0438\\u0301\\u0447\\u0435\\u0441\\u043a\\u0438\\u0445 \\u0420\\u0435\\u0441\\u043f\\u0443\\u0301\\u0431\\u043b\\u0438\\u043a\", \"TSRS\", \"Soyuz Sovetskikh Sotsialisticheskikh Respublik\", \"\\u0421\\u043e\\u0432\\u0435\\u0442\\u043b\\u0430\\u0440 \\u0421\\u043e\\u044e\\u0437\\u044b\", \"The C-C-C-P\", \"Soviet Union\", \"C. C. C. P.\", \"Union of Socialist Soviet Republics\", \"PSRS\", \"United Soviet Socialist Rebublic\", \"Sovietunion\", \"Soviet-Union\", \"C.-C.-C.-P.\", \"The C.-C.-C.-P.\", \"Soviets\", \"The Union of Soviet Socialist Republics (U.S.S.R)\", \"\\u0421\\u043e\\u0432\\u0435\\u0442\\u0441\\u043a\\u0430\\u0439 \\u0421\\u043e\\u044e\\u0437\"]", "[\"Paul dukas\", \"Paul Dukas\", \"Paul Abraham Dukas\", \"Paul A. Dukas\", \"PAUL DUKAS\", \"Ballets by Paul Dukas\"]", "[\"Schroedinger's Cat\", \"Schrodinger cat\", \"Shrodinger cat paradox\", \"Schrodingers cat\", \"Schr\\u00f6dinger's cat experiment\", \"Schroedinger\\u2019s Cat\", \"Schrodinger's Cat\", \"Shrodinger's cat\", \"Schr\\u00f6dinger Cat\", \"Schr\\u00f6dinger's Cat\", \"Schrodinger Cat\", \"Schroedinger cat\", \"Schrodingers Cat\", \"Schr\\u00f6dinger\\u2019s cat\", \"Cat experiment\", \"SCHRODINGER'S CAT\", \"Schrodinger's cat paradox\", \"Schr\\u00f6dingers Cat\", \"Schr\\u00f6dinger's cat\", \"Schrodeger's cat\", \"Schroedinger Cat\", \"Schr\\u00f6dinger's Paradox\", \"Shroedinger cat paradox\", \"Quote Schrodinger cat\", \"Quote Schr\\u00f6dinger cat\", \"Schroedinger's cat paradox\", \"Shrodenger's cat\", \"Schroedingers cat\", \"Schrodinger\\u2019s Cat\", \"Schroedinger's cat\", \"Shr\\u00f6dinger cat paradox\", \"Schr\\u00f6dingers katt\", \"Shroedinger's Cat\", \"Schredinger's Cat\", \"Schrocat\", \"Schr\\u00f6dinger cat\", \"Quote Schroedinger cat\", \"Schrodinger's cat\", \"Schrodenger's cat\", \"Schr\\u00f6dinger's cat paradox\", \"Schroedingers Cat\", \"Shrodingers cat\"]", "[\"Islands of Spain\", \"Espa\\u00f1a\", \"Reino de Espa\\u00f1a\", \"Name of Spain\", \"Espagna\", \"Espa\\u0144a\", \"Reino de Espana\", \"Espana\", \"Kingdom of the Spains\", \"The Spanish Society\", \"Espainia\", \"Mountains of Spain\", \"Regne d'Espanya\", \"The kingdom of Spain\", \"SPAIN\", \"Regne d'Espanha\", \"Espanya\", \"Espainiako Erresuma\", \"Etymology of Spain\", \"Spane\", \"ISO 3166-1:ES\", \"Spain\", \"Spanish Kingdom\", \"Kingdom of Spain\", \"El Reino de Espa\\u00f1a\", \"El Reino de Espana\"]", "[\"two thousand and ten\", \"2010\"]", "[\"DUTCH GUIANA\", \"Netherlands Guiana\", \"Dutch Guiana\", \"Dutch Guiana (disambiguation)\", \"Dutch Guyana\"]", "[\"The Vulcan\", \"Vulcan (disambiguation)\", \"Vulcan\"]", "[\"Gardeners' World\", \"Gardener's World\", \"Gardeners World\", \"Gardener\\u2019s World\"]", "[\"Ralph Vaughan Williams\", \"Ballets by Ralph Vaughan Williams\", \"Ralph Vaughan-Williams\", \"Ralph Von Willams\", \"Vaughn Williams\", \"Vaughan Williams OM\", \"Vaughn williams\", \"Vaughan-Williams\", \"Vaughan Williams\", \"Ralph van williams\", \"Vaughn-Williams\", \"%22Ralph Vaughn-Williams%22\", \"Ralph Vaughn Williams\", \"Ralph Vaughan Williams OM\", \"Ralph Vaughan WIlliams\", \"Ralph Vaughn-Williams\", \"Vaughan williams\"]", "[\"24 December\", \"December 24th\", \"24th December\", \"Dec 24\", \"December 24\"]", "[\"Hannah Gordon\"]", "[\"Hermann William Goering\", \"Forschungstelle\", \"Goering, Hermann\", \"Herman Wilhelm Goring\", \"Goring, Herman\", \"Hermann Goring\", \"Hermann Goering\", \"G\\u00f6ring, Hermann\", \"G\\u00f6ring, Herman\", \"Goring, Hermann\", \"Herman Goring\", \"Herman Wilhelm Goering\", \"Herman Wilhelm G\\u00f6ring\", \"Hermann G\\u00f6ering\", \"Herman Goerring\", \"Herman William Goering\", \"Hermann William Goring\", \"Meier's trumpets\", \"Hermann Goeering\", \"Reichsmarschall Goering\", \"Hermann G\\u00f6ring\", \"Hermann William G\\u00f6ring\", \"Goering, Herman\", \"Hermann Gring\", \"Herman William G\\u00f6ring\", \"Hermann Wilhelm Goring\", \"Herman G\\u00f6ring\", \"Hermann Wilhelm G\\u00f6ring\", \"G\\u00f6ring\", \"Herman Goering\", \"Hermann Wilhelm Goering\", \"Goering\", \"Hermann Goerring\", \"Herman William Goring\"]" ]
[ "Which classical composter wrote 'The Snow Maiden' and 'The Golden Cockerel'?", "Who plays Stephen in the 2012 film ‘Django Unchained’?", "What American DJ was nicknamed Moondog?", "In 1953 Ethel and Julius Rosenberg were executed in the USA for spying for which country?", "Who composed 'The Sorcerer's Apprentice'?", "What was the name of the ground-breaking 'thought experiment' proposed by an Austrian Scientist in 1935?", "The Basques are native people of France and which other neighbouring country?", "\"Name the year - An earthquake in Haiti kills over 300,000 people, A P McCoy wins the Grand National on \"\"Don't push it\"\" and Deepwater Horizon rig explodes in the Gulf of Mexico?\"", "What was the former name of Surinam?", "In mythology, who is the Roman god of fire?", "On which programme is the presenter followed around by a dog called Nigel?", "\"Which English composer, whose work was influenced by folk song and the music of the 16th century, wrote \"\"London Symphony\"\", \"\"Pilgrim's Progress\"\" and \"\"Sinfonia Antarctica\"\"?\"", "The Nordic countries (Denmark, Sweden, Norway notably) tend to celebrate Christmas chiefly on which date?", "Who hosts TV's Water Colour Challenge", "Who was Hitler's Prime Minister in Prussia?" ]
15
[ 39735, 39736, 39737, 39738, 39739, 39740, 39741, 39742, 39743, 39744, 39745, 39746, 39747, 39748, 39749 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: The 2010 Winter Olympic skiing and sliding events took place in what town, approximately 75 miles north of Vancouver?\nQuestion 2: Which English football club is nicknamed ‘The Tykes’?\nQuestion 3: What most nearly describes the position of the human spine in relation to the heart?\nQuestion 4: Who replaced Dr. John Reid as Secretary of State for Scotland?\nQuestion 5: Who was the highest ranking Nazi officer to be tried at the Nuremburg Trials?\nQuestion 6: In which European city are the headquarters of the European Central Bank?\nQuestion 7: Now a brand of General motors what is oldest active American car make?\nQuestion 8: In 1978, Italian Prime Minister Aldo Moro was found dead where?\nQuestion 9: Which eastern capital is served by Queen Alia airport\nQuestion 10: Which Englishman was the very first footballer to score a goal for Liverpool in a European Cup Final, the year in question being 1977 ?\nQuestion 11: According to legend, what was the name of Lady Godiva's horse?\nQuestion 12: What is the name of the helicopter used to transport the President of the USA?\nQuestion 13: Which Hull group had a Top Five single in 1986 with 'Happy Hour’?\nQuestion 14: If the race goes to plan, how many obstacles do the runners in the Grand National have to jump ?\nQuestion 15: Who is considered to be the first Roman emperor?", "role": "user" } ]
["[\"Whistler\", \"Whistler (surname)\", \"Whistler (disambiguation)\"]", "[\"Barnsley St Peter's\", \"Barnsley FC\", \"Barnsley F.C.\", \"The Tykes\", \"Barnsley F C\", \"Barnsley F. C.\", \"Barnsley Football Club\", \"Barnsley St. Peter's\", \"Barnsley fc\"]", "[\"Dorsal (disambiguation)\", \"Dorsal\"]", "[\"Baroness Liddell of Coatdyke\", \"Helen Lawrie Liddell\", \"Helen Liddle\", \"Helen Liddell, Baroness Liddell of Coatdyke\", \"Helen Lawrie Reilly\", \"HELEN LIDDELL\", \"Helen Liddell\"]", "[\"Hermann William Goering\", \"Forschungstelle\", \"Goering, Hermann\", \"Herman Wilhelm Goring\", \"Goring, Herman\", \"Hermann Goring\", \"Hermann Goering\", \"G\\u00f6ring, Hermann\", \"G\\u00f6ring, Herman\", \"Goring, Hermann\", \"Herman Goring\", \"Herman Wilhelm Goering\", \"Herman Wilhelm G\\u00f6ring\", \"Hermann G\\u00f6ering\", \"Herman Goerring\", \"Herman William Goering\", \"Hermann William Goring\", \"Meier's trumpets\", \"Hermann Goeering\", \"Reichsmarschall Goering\", \"Hermann G\\u00f6ring\", \"Hermann William G\\u00f6ring\", \"Goering, Herman\", \"Hermann Gring\", \"Herman William G\\u00f6ring\", \"Hermann Wilhelm Goring\", \"HERMANN GORING\", \"Herman G\\u00f6ring\", \"Hermann Wilhelm G\\u00f6ring\", \"G\\u00f6ring\", \"Herman Goering\", \"Hermann Wilhelm Goering\", \"Goering\", \"Hermann Goerring\", \"Herman William Goring\"]", "[\"Frankfort-on-the-Main\", \"Frankfurt am Main, Germany\", \"UN/LOCODE:DEFRA\", \"Frankfort-on-the-Maine\", \"Frankfort on Main\", \"Frankfurt-on-the-Main\", \"Frankfort/Main\", \"Franckford\", \"Frankfurt am Main (Germany)\", \"Frankfurt-Am-Main, Germany\", \"Frankfort On Main\", \"Frankfurt a.M.\", \"Frankfurt (Main)\", \"Franfurt\", \"Frankfurt, Main\", \"Frankfurt am Main, Hesse\", \"Frankfurt-Am-Main\", \"Frankfurt-on-Main\", \"Frankfurt (state)\", \"Frankfort-am-Main\", \"Frankfurt, Hesse\", \"Frankfurt am Main\", \"Frankfurt\\u2013am-Main\", \"Frankfort-on-Main\", \"Mainhattan\", \"Frankfurt, Germany\", \"Frankfurt-am-Main\", \"Frankfurt\", \"Frankfurt/Main\", \"Frankfurt on Main\", \"Frankfurt am main\", \"Frankfurt on the Main\", \"Frankfort on the Main\"]", "[\"Buicks\", \"Buick Engine\", \"Ventiport\", \"BUICK\", \"Buick Motor Company\", \"Four-holer\", \"Four holer\", \"Buick Motor Division\", \"Buick\", \"Buik\"]", "[\"In the boot of a car\"]", "[\"Rabbah\", \"\\u0670\\u0100mm\\u0101n\", \"Amman, JO\", \"Amman (Jordan)\", \"Rabbath Ammon\", \"Capital of Jordan\", \"\\u02bfAmm\\u0101n\", \"Amman, Hashemite Kingdom of Jordan\", \"Aman capital\", \"7th Circle, Amman\", \"Aman, JO\", \"Amman\", \"'Amman\", \"'Ammon\", \"Amman, Jordan\", \"Rabbath-Ammon\", \"\\u0639\\u0645\\u0627\\u0646\"]", "[\"Terry McDermott\", \"TERRY McDERMOTT\"]", "[\"Godgyfu\", \"Godgifu of Mercia\", \"Lady Godiva\", \"Peeping Tom of Coventry\", \"Peeping Tom\", \"Aethenoth\", \"Pru Porretta\", \"Godiva\"]", "[\"Marine Two\", \"Marine Corps One\", \"Marine One\", \"Marine I\", \"Marine one\", \"Marine 1\", \"Marine Corps 1\", \"Marine-One\"]", "[\"Housemartins\", \"The House Martins\", \"The Housemartins\", \"The house martins\", \"The housemartins\"]", "[\"30\", \"thirty\", \"THIRTY\"]", "[\"GAIVS\\u2022IVLIVS\\u2022CAESAR\\u2022OCTAVIANVS\", \"Julius Caesar Octavianus\", \"Gaius Julius Caesar Octavianus\", \"GAIVS*IVLIVS*CAESAR*OCTAVIANVS\", \"Ceasar Augustus\", \"Gaius Octavius Thurinus\", \"Augustus Octavian Caesar\", \"Octavious\", \"Agustus\", \"Augustus\", \"Octavian Caesar\", \"Caesar Octavian\", \"IMPERATOR\\u2022CAESAR\\u2022DIVI\\u2022FILIVS\\u2022AVGVSTVS\", \"Avgvstvs\", \"Octavianus\", \"Octavian Augustus\", \"Augustus Ceasar\", \"Augusts Caesar\", \"Coinage reform of Augustus\", \"Augustus Caesar\", \"Emperor Augustus\", \"Emperor Augustus of Rome\", \"Gaius Julius Caesar Augustus\", \"IMPERATOR*CAESAR*DIVI*FILIVS*AVGVSTVS\", \"Octavius Caesar\", \"Roman Emperor Augustus\", \"Augustus, Emperor of Rome\", \"Octavius\", \"Octavian\", \"Gaius Julius Caesar Octavanius Augustus\", \"Augustan reform\", \"Caesar Octavianus\", \"Gaius Octavius Augustus\", \"Octavianus Augustus\", \"C\\u00e6sar Augustus\", \"Octavian Augustus Caesar\", \"Caesar Augustus\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Whistler\", \"Whistler (surname)\", \"Whistler (disambiguation)\"]", "[\"Barnsley St Peter's\", \"Barnsley FC\", \"Barnsley F.C.\", \"The Tykes\", \"Barnsley F C\", \"Barnsley F. C.\", \"Barnsley Football Club\", \"Barnsley St. Peter's\", \"Barnsley fc\"]", "[\"Dorsal (disambiguation)\", \"Dorsal\"]", "[\"Baroness Liddell of Coatdyke\", \"Helen Lawrie Liddell\", \"Helen Liddle\", \"Helen Liddell, Baroness Liddell of Coatdyke\", \"Helen Lawrie Reilly\", \"HELEN LIDDELL\", \"Helen Liddell\"]", "[\"Hermann William Goering\", \"Forschungstelle\", \"Goering, Hermann\", \"Herman Wilhelm Goring\", \"Goring, Herman\", \"Hermann Goring\", \"Hermann Goering\", \"G\\u00f6ring, Hermann\", \"G\\u00f6ring, Herman\", \"Goring, Hermann\", \"Herman Goring\", \"Herman Wilhelm Goering\", \"Herman Wilhelm G\\u00f6ring\", \"Hermann G\\u00f6ering\", \"Herman Goerring\", \"Herman William Goering\", \"Hermann William Goring\", \"Meier's trumpets\", \"Hermann Goeering\", \"Reichsmarschall Goering\", \"Hermann G\\u00f6ring\", \"Hermann William G\\u00f6ring\", \"Goering, Herman\", \"Hermann Gring\", \"Herman William G\\u00f6ring\", \"Hermann Wilhelm Goring\", \"HERMANN GORING\", \"Herman G\\u00f6ring\", \"Hermann Wilhelm G\\u00f6ring\", \"G\\u00f6ring\", \"Herman Goering\", \"Hermann Wilhelm Goering\", \"Goering\", \"Hermann Goerring\", \"Herman William Goring\"]", "[\"Frankfort-on-the-Main\", \"Frankfurt am Main, Germany\", \"UN/LOCODE:DEFRA\", \"Frankfort-on-the-Maine\", \"Frankfort on Main\", \"Frankfurt-on-the-Main\", \"Frankfort/Main\", \"Franckford\", \"Frankfurt am Main (Germany)\", \"Frankfurt-Am-Main, Germany\", \"Frankfort On Main\", \"Frankfurt a.M.\", \"Frankfurt (Main)\", \"Franfurt\", \"Frankfurt, Main\", \"Frankfurt am Main, Hesse\", \"Frankfurt-Am-Main\", \"Frankfurt-on-Main\", \"Frankfurt (state)\", \"Frankfort-am-Main\", \"Frankfurt, Hesse\", \"Frankfurt am Main\", \"Frankfurt\\u2013am-Main\", \"Frankfort-on-Main\", \"Mainhattan\", \"Frankfurt, Germany\", \"Frankfurt-am-Main\", \"Frankfurt\", \"Frankfurt/Main\", \"Frankfurt on Main\", \"Frankfurt am main\", \"Frankfurt on the Main\", \"Frankfort on the Main\"]", "[\"Buicks\", \"Buick Engine\", \"Ventiport\", \"BUICK\", \"Buick Motor Company\", \"Four-holer\", \"Four holer\", \"Buick Motor Division\", \"Buick\", \"Buik\"]", "[\"In the boot of a car\"]", "[\"Rabbah\", \"\\u0670\\u0100mm\\u0101n\", \"Amman, JO\", \"Amman (Jordan)\", \"Rabbath Ammon\", \"Capital of Jordan\", \"\\u02bfAmm\\u0101n\", \"Amman, Hashemite Kingdom of Jordan\", \"Aman capital\", \"7th Circle, Amman\", \"Aman, JO\", \"Amman\", \"'Amman\", \"'Ammon\", \"Amman, Jordan\", \"Rabbath-Ammon\", \"\\u0639\\u0645\\u0627\\u0646\"]", "[\"Terry McDermott\", \"TERRY McDERMOTT\"]", "[\"Godgyfu\", \"Godgifu of Mercia\", \"Lady Godiva\", \"Peeping Tom of Coventry\", \"Peeping Tom\", \"Aethenoth\", \"Pru Porretta\", \"Godiva\"]", "[\"Marine Two\", \"Marine Corps One\", \"Marine One\", \"Marine I\", \"Marine one\", \"Marine 1\", \"Marine Corps 1\", \"Marine-One\"]", "[\"Housemartins\", \"The House Martins\", \"The Housemartins\", \"The house martins\", \"The housemartins\"]", "[\"30\", \"thirty\", \"THIRTY\"]", "[\"GAIVS\\u2022IVLIVS\\u2022CAESAR\\u2022OCTAVIANVS\", \"Julius Caesar Octavianus\", \"Gaius Julius Caesar Octavianus\", \"GAIVS*IVLIVS*CAESAR*OCTAVIANVS\", \"Ceasar Augustus\", \"Gaius Octavius Thurinus\", \"Augustus Octavian Caesar\", \"Octavious\", \"Agustus\", \"Augustus\", \"Octavian Caesar\", \"Caesar Octavian\", \"IMPERATOR\\u2022CAESAR\\u2022DIVI\\u2022FILIVS\\u2022AVGVSTVS\", \"Avgvstvs\", \"Octavianus\", \"Octavian Augustus\", \"Augustus Ceasar\", \"Augusts Caesar\", \"Coinage reform of Augustus\", \"Augustus Caesar\", \"Emperor Augustus\", \"Emperor Augustus of Rome\", \"Gaius Julius Caesar Augustus\", \"IMPERATOR*CAESAR*DIVI*FILIVS*AVGVSTVS\", \"Octavius Caesar\", \"Roman Emperor Augustus\", \"Augustus, Emperor of Rome\", \"Octavius\", \"Octavian\", \"Gaius Julius Caesar Octavanius Augustus\", \"Augustan reform\", \"Caesar Octavianus\", \"Gaius Octavius Augustus\", \"Octavianus Augustus\", \"C\\u00e6sar Augustus\", \"Octavian Augustus Caesar\", \"Caesar Augustus\"]" ]
[ "The 2010 Winter Olympic skiing and sliding events took place in what town, approximately 75 miles north of Vancouver?", "Which English football club is nicknamed ‘The Tykes’?", "What most nearly describes the position of the human spine in relation to the heart?", "Who replaced Dr. John Reid as Secretary of State for Scotland?", "Who was the highest ranking Nazi officer to be tried at the Nuremburg Trials?", "In which European city are the headquarters of the European Central Bank?", "Now a brand of General motors what is oldest active American car make?", "In 1978, Italian Prime Minister Aldo Moro was found dead where?", "Which eastern capital is served by Queen Alia airport", "Which Englishman was the very first footballer to score a goal for Liverpool in a European Cup Final, the year in question being 1977 ?", "According to legend, what was the name of Lady Godiva's horse?", "What is the name of the helicopter used to transport the President of the USA?", "Which Hull group had a Top Five single in 1986 with 'Happy Hour’?", "If the race goes to plan, how many obstacles do the runners in the Grand National have to jump ?", "Who is considered to be the first Roman emperor?" ]
15
[ 53535, 53536, 53537, 53538, 53539, 53540, 53541, 53542, 53543, 53544, 53545, 53546, 53547, 53548, 53549 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Who wrote the 1948 play 'The Browning Version'?\nQuestion 2: Near which Lincolnshire village did the apple fall on Newton?s head?\nQuestion 3: What exam must be passed to practice law in the U.S.?\nQuestion 4: What famous saying, representing a deranged and directionless group of people, has been interpreted in creative works by Hieronymus Bosch, Katherine Anne Porter, Erasure, The Grateful Dead, and Bob Seger, among others?\nQuestion 5: \"Who emerged as the top Chinese Communist leader during the \"\"Long March\"\" in 1934?\"\nQuestion 6: \"Which Cunard Line ship first came to the aid of \"\"RMS Titanic\"\"?\"\nQuestion 7: In Greek mythology, who were Clotho, Atropos and Lachesis?\nQuestion 8: Which fictional RAF Station gave its name to a post war radio comedy starring Richard Murdoch and Kenneth Horne?\nQuestion 9: What was Girls Aloud's 2002 UK Christmas number one single?\nQuestion 10: Who said ‘a single death is a tragedy, a million deaths is a statistic’?\nQuestion 11: In 2015, who replaced Dara Ó Briain as the presenter of The Apprentice: You’re Fired?\nQuestion 12: What is the official language of Nigeria?\nQuestion 13: Closing Time was a sequel to which famous novel of 1961?\nQuestion 14: Which famous American jazz singer was born Eleanora Fagan in Baltimore in 1915?\nQuestion 15: Which group had a 1967 hit with 'Night of Fear'?", "role": "user" } ]
["[\"Terence Ratigan\", \"Rattigan\", \"Terrence Rattigan\", \"Sir Terence Rattigan\", \"Sir Terence Mervyn Rattigan\", \"Terence Rattigan\", \"Terence Mervyn Rattigan\"]", "[\"Woolsthorpe, Lincolnshire\", \"Woolsthorpe (disambiguation)\", \"WOOLSTHORPE\", \"Woolsthorpe\"]", "[\"Multistate Essay Exam\", \"Multistate Bar Exam\", \"Multi state bar exam\", \"Bar test\", \"Bar Exam\", \"NCBE\", \"Bar Examination\", \"Bar exam\", \"National conference of bar examiners\", \"Multistate Performance Test\", \"Multistate Essay Examination\", \"Bar exams\", \"Bar examination\", \"National Conference of Bar Examiners\", \"Multistate Bar Examination\"]", "[\"The Ship of Fools\", \"The Ship Of Fools\", \"Ship of Fools\", \"Narrenschijf\", \"Ship of fools\"]", "[\"Mao Ze-dong\", \"Maozedong\", \"Mao Tse-Tung\", \"Genealogy of Mao Zedong\", \"Mao Tse'tung\", \"Mao Tse Tong\", \"Mao Zedang\", \"\\u6bdb\\u6fa4\\u6771\", \"\\u6bdb\\u4e3b\\u5e2d\", \"Chairman Mao Zedong\", \"Mao Tse-Dong\", \"More Ze-dong\", \"Mao tse Tung\", \"Mao Tsedung\", \"\\u6bdb\\u6cfd\\u4e1c\", \"Mao zedung\", \"Mao Yongzhi\", \"Mao Tsedong\", \"Mao Runzhi\", \"Mao Tse Toung\", \"Mao Ze Dong\", \"Mao Zedong (Mao Tse-tung)\", \"Mao Tsetung\", \"Zedong\", \"M\\u00e1o Z\\u00e9d\\u014dng\", \"Mall Zedong\", \"Zedong Mao\", \"\\u6f64\\u829d\", \"Mao Tse-dong\", \"Jun-Chih\", \"Mao Tse-toung\", \"Mao Dsu Tung\", \"Mao Zadong\", \"Mao Se Tung\", \"R\\u00f9nzhi\", \"Mao Tse-tung\", \"Zdong\", \"Mao Zedong\", \"Mao zedong\", \"Junchih\", \"Mao-Tse-tung\", \"Jun-chih\", \"Chairman Mao Tse-tung\", \"Mao-Tse Tung\", \"Mao Tse Tung\", \"Mao Tse-Dung\", \"Mao Tsetong\", \"Poems by Mao Zedong\", \"Mousie Dung\", \"Mau: tsu.tUNG\", \"Mall Ze-dong\", \"Early life of Mao\", \"Mao Ze-Dung\", \"Mao Zhedong\", \"M\\u00e1o Z\\u00e9dong\", \"Mao Tse-Tounge\", \"Mao tse-tung\", \"Mao Tze-Tung\", \"Mao ZeDong\", \"Mao Ts\\u00e9-toung\", \"Political ideas of Mao Zedong\", \"Mao Tse-tong\", \"Runzhi\", \"Chairman Mao\", \"\\u6f64\\u829d\\u00b9\", \"\\u6da6\\u829d\", \"Mao Tse-dung\", \"Mao tsetong\", \"Tse Tung Mao\", \"First Red Emperor\", \"Tse-tung Mao\", \"Mao\", \"Mao Tze Tung\", \"Poetry by Mao Zedong\", \"Chairman of the Politburo and Secretariat\", \"Mao Tze-tung\", \"R\\u00f9nzh\\u012b\", \"More Zedong\"]", "[\"RMS Carpathia\", \"SS Carpathia\", \"Rms carpathia\"]", "[\"Fates (disambiguation)\", \"Three fates\", \"Three-fates\", \"The Fates (disambiguation)\", \"The fates\", \"The Fates\", \"Fates\", \"Three Fates\", \"The Three Fates\"]", "[\"MUCH BINDING IN THE MARSH\", \"Much-Binding-in-the-Marsh\", \"Much Binding in the Marsh\"]", "[\"Sound of the Underground (disambiguation)\", \"Sound Of The Underground\", \"Sound of the Underground\"]", "[\"Josif Djugashvili\", \"Joseph Stalin's death conspiracy Theories\", \"StalinJosef\", \"Joseph Dzhugashvili\", \"\\u0418\\u043e\\u0441\\u0438\\u0444 \\u0421\\u0442\\u0430\\u043b\\u0438\\u043d\", \"Josef Dzugashvili\", \"Staline\", \"Stalin Joseph\", \"\\u65af\\u5927\\u6797\", \"Joseph, Man of Steel\", \"Josef Vissarionovich Djugashvili\", \"Joseph V Stalin\", \"Iosif Vissarionovic Stalin\", \"Stalin, Josef\", \"Josef stalin\", \"Jossif Vissarionovich Dhzugazvili\", \"Joseph Djugashvili\", \"Yosef Stalin\", \"Jose Stalin\", \"Iosif Vissarionovi\\u010d Stalin\", \"Joseph Vissarionovich Stalin\", \"Yosif Stalin\", \"Uncle Joe Stalin\", \"Ioseb Vissarionovich Jugashvili\", \"Ioseb Besarionis dze Jugashvili\", \"J. Dzhugashvili\", \"Ioseb Dzhugashvili\", \"Joseph Staline\", \"Josif Vissarionovich Dzhugashvili\", \"I\\u00f3sif Dzhugashv\\u00edli\", \"Jozef Stalin\", \"E\\u00f2saph Stalin\", \"Josef Jughashvili\", \"Vissarionovich Stalin\", \"\\u0421\\u0442\\u0430\\u0301\\u043b\\u0438\\u043d\", \"Stalin,Josef\", \"Iosif Jugashvili\", \"Iosif Vissarionovic Dzugasvili\", \"Joseph Vissarionovich Dzhugashvili\", \"Joseph Vissarionovich Djugashvili\", \"Iosif Vissarionovich Stalin\", \"Stalin\", \"Iosef Dzhugashvili\", \"Josif Dzhugashvili\", \"STALIN\", \"Joseph Stalin and religion\", \"Death of Stalin\", \"Chijikov\", \"Stallin\", \"Joseph V. Stalin\", \"\\u0418\\u043e\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0414\\u0436\\u0443\\u0433\\u0430\\u0448\\u0432\\u0438\\u043b\\u0438\", \"Ioseb Jugashvili\", \"S\\u012b D\\u00e0l\\u00edn\", \"J V Stalin\", \"Joseph stalin\", \"Vissarionovich Dzhugashvili\", \"\\u0421\\u0442\\u0430\\u043b\\u0438\\u043d\", \"Joseph Jughashvili\", \"Ioseb Jughashvili\", \"\\u0418\\u043e\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0421\\u0442\\u0430\\u043b\\u0438\\u043d\", \"Dze Jugashvili\", \"J.V. Stalin\", \"Iosif Vissarionovich Djugashvili\", \"Soso Stalin\", \"Iosef Jugashvili\", \"Josef Dzhugashvili\", \"Death of Joseph Stalin\", \"Comrade Stalin\", \"Stalin's\", \"\\u10d8\\u10dd\\u10e1\\u10d4\\u10d1 \\u10d1\\u10d4\\u10e1\\u10d0\\u10e0\\u10d8\\u10dd\\u10dc\\u10d8\\u10e1 \\u10eb\\u10d4 \\u10ef\\u10e3\\u10e6\\u10d0\\u10e8\\u10d5\\u10d8\\u10da\\u10d8\", \"Stalin, Joseph\", \"Josip Stalin\", \"\\u0418\\u043e\\u0301\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u0301\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0414\\u0436\\u0443\\u0433\\u0430\\u0448\\u0432\\u0438\\u043b\", \"\\u10d8\\u10dd\\u10e1\\u10d4\\u10d1 \\u10ef\\u10e3\\u10e6\\u10d0\\u10e8\\u10d5\\u10d8\\u10da\\u10d8\", \"Ivan Stalin\", \"Joseph Stalin\", \"\\u10d8\\u10dd\\u10e1\\u10d4\\u10d1 \\u10e1\\u10e2\\u10d0\\u10da\\u10d8\\u10dc\\u10d8\", \"Iosif Djugashvili\", \"Yosif Vissarionovich Dzhugashvili\", \"Joe Stalin\", \"Josif Stalin\", \"Ioseb Besarionis Dze Jughashvili\", \"I.V. Stalin\", \"Josef Vissarionovich Dzhugashvili\", \"Joseph Stalin's death conspiracy\", \"Joseph Stalins's religious views\", \"Iosif Vissarionovich Dzhugashvili\", \"Critique of Stalin\", \"Iosif Vissarionovi\\u010d D\\u017euga\\u0161vili\", \"\\u0418\\u043e\\u0301\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u0301\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0421\\u0442\\u0430\\u0301\\u043b\\u0438\\u043d\", \"\\u053b\\u0578\\u057d\\u056b\\u0586 \\u054d\\u057f\\u0561\\u056c\\u056b\\u0576\", \"Djugashvili\", \"Iosif Stalin\", \"Josef Stalin\", \"Eosaph Stalin\", \"Nijeradze\", \"StalinJoseph\", \"Iosif Dzhugashvili\", \"Dzjugasjvili\", \"Joey Stalin\", \"Iosef Stalin\", \"Stalin Josef\", \"J. V. Stalin\", \"Marshal Stalin\", \"Stalin,Joseph\", \"JV Stalin\", \"Iosef Dzugashvili\"]", "[\"Dee, Jack\", \"Jack Dee's Sunday Service\", \"Jack Dee's Saturday Night\", \"James Andrew Innes %22Jack%22 Dee\", \"Jack Dee\", \"James Andrew Innes Dee\"]", "[\"Egnlish\", \"Englilsh\", \"English (disambiguation)\", \"Englissh\", \"ENGLISH\", \"Englis\", \"Enlish\", \"English\", \"Inglisj\", \"Engish\"]", "[\"Catch-22 (novel)\", \"Catch Twenty Two\", \"Catch-18\", \"Catch-22\", \"Catch XXII\", \"Catch 22 (novel)\", \"A. Fortiori\", \"Catch22\", \"Catch\\u201122\", \"Catch 22\"]", "[\"Billie halliday\", \"Billie Holiday\", \"Billy Holiday\", \"Lady Day (singer)\", \"Eleanora Fagan\", \"Frank DeViese\", \"Billy Holliday\", \"BILLIE HOLIDAY\", \"Billie Holliday\", \"Billy holliday\", \"Eleanora Fagan Gough\", \"Holiday, Billie\"]", "[\"M.o.v.e.\", \"THE MOVE\", \"M.o.v.e\", \"Operation Overload 7 (album)\", \"M.O.V.E.\", \"Move (Japanese band)\", \"M.O.V.E\", \"M.o.v.e (Japanese band)\", \"Move (J-Pop)\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Terence Ratigan\", \"Rattigan\", \"Terrence Rattigan\", \"Sir Terence Rattigan\", \"Sir Terence Mervyn Rattigan\", \"Terence Rattigan\", \"Terence Mervyn Rattigan\"]", "[\"Woolsthorpe, Lincolnshire\", \"Woolsthorpe (disambiguation)\", \"WOOLSTHORPE\", \"Woolsthorpe\"]", "[\"Multistate Essay Exam\", \"Multistate Bar Exam\", \"Multi state bar exam\", \"Bar test\", \"Bar Exam\", \"NCBE\", \"Bar Examination\", \"Bar exam\", \"National conference of bar examiners\", \"Multistate Performance Test\", \"Multistate Essay Examination\", \"Bar exams\", \"Bar examination\", \"National Conference of Bar Examiners\", \"Multistate Bar Examination\"]", "[\"The Ship of Fools\", \"The Ship Of Fools\", \"Ship of Fools\", \"Narrenschijf\", \"Ship of fools\"]", "[\"Mao Ze-dong\", \"Maozedong\", \"Mao Tse-Tung\", \"Genealogy of Mao Zedong\", \"Mao Tse'tung\", \"Mao Tse Tong\", \"Mao Zedang\", \"\\u6bdb\\u6fa4\\u6771\", \"\\u6bdb\\u4e3b\\u5e2d\", \"Chairman Mao Zedong\", \"Mao Tse-Dong\", \"More Ze-dong\", \"Mao tse Tung\", \"Mao Tsedung\", \"\\u6bdb\\u6cfd\\u4e1c\", \"Mao zedung\", \"Mao Yongzhi\", \"Mao Tsedong\", \"Mao Runzhi\", \"Mao Tse Toung\", \"Mao Ze Dong\", \"Mao Zedong (Mao Tse-tung)\", \"Mao Tsetung\", \"Zedong\", \"M\\u00e1o Z\\u00e9d\\u014dng\", \"Mall Zedong\", \"Zedong Mao\", \"\\u6f64\\u829d\", \"Mao Tse-dong\", \"Jun-Chih\", \"Mao Tse-toung\", \"Mao Dsu Tung\", \"Mao Zadong\", \"Mao Se Tung\", \"R\\u00f9nzhi\", \"Mao Tse-tung\", \"Zdong\", \"Mao Zedong\", \"Mao zedong\", \"Junchih\", \"Mao-Tse-tung\", \"Jun-chih\", \"Chairman Mao Tse-tung\", \"Mao-Tse Tung\", \"Mao Tse Tung\", \"Mao Tse-Dung\", \"Mao Tsetong\", \"Poems by Mao Zedong\", \"Mousie Dung\", \"Mau: tsu.tUNG\", \"Mall Ze-dong\", \"Early life of Mao\", \"Mao Ze-Dung\", \"Mao Zhedong\", \"M\\u00e1o Z\\u00e9dong\", \"Mao Tse-Tounge\", \"Mao tse-tung\", \"Mao Tze-Tung\", \"Mao ZeDong\", \"Mao Ts\\u00e9-toung\", \"Political ideas of Mao Zedong\", \"Mao Tse-tong\", \"Runzhi\", \"Chairman Mao\", \"\\u6f64\\u829d\\u00b9\", \"\\u6da6\\u829d\", \"Mao Tse-dung\", \"Mao tsetong\", \"Tse Tung Mao\", \"First Red Emperor\", \"Tse-tung Mao\", \"Mao\", \"Mao Tze Tung\", \"Poetry by Mao Zedong\", \"Chairman of the Politburo and Secretariat\", \"Mao Tze-tung\", \"R\\u00f9nzh\\u012b\", \"More Zedong\"]", "[\"RMS Carpathia\", \"SS Carpathia\", \"Rms carpathia\"]", "[\"Fates (disambiguation)\", \"Three fates\", \"Three-fates\", \"The Fates (disambiguation)\", \"The fates\", \"The Fates\", \"Fates\", \"Three Fates\", \"The Three Fates\"]", "[\"MUCH BINDING IN THE MARSH\", \"Much-Binding-in-the-Marsh\", \"Much Binding in the Marsh\"]", "[\"Sound of the Underground (disambiguation)\", \"Sound Of The Underground\", \"Sound of the Underground\"]", "[\"Josif Djugashvili\", \"Joseph Stalin's death conspiracy Theories\", \"StalinJosef\", \"Joseph Dzhugashvili\", \"\\u0418\\u043e\\u0441\\u0438\\u0444 \\u0421\\u0442\\u0430\\u043b\\u0438\\u043d\", \"Josef Dzugashvili\", \"Staline\", \"Stalin Joseph\", \"\\u65af\\u5927\\u6797\", \"Joseph, Man of Steel\", \"Josef Vissarionovich Djugashvili\", \"Joseph V Stalin\", \"Iosif Vissarionovic Stalin\", \"Stalin, Josef\", \"Josef stalin\", \"Jossif Vissarionovich Dhzugazvili\", \"Joseph Djugashvili\", \"Yosef Stalin\", \"Jose Stalin\", \"Iosif Vissarionovi\\u010d Stalin\", \"Joseph Vissarionovich Stalin\", \"Yosif Stalin\", \"Uncle Joe Stalin\", \"Ioseb Vissarionovich Jugashvili\", \"Ioseb Besarionis dze Jugashvili\", \"J. Dzhugashvili\", \"Ioseb Dzhugashvili\", \"Joseph Staline\", \"Josif Vissarionovich Dzhugashvili\", \"I\\u00f3sif Dzhugashv\\u00edli\", \"Jozef Stalin\", \"E\\u00f2saph Stalin\", \"Josef Jughashvili\", \"Vissarionovich Stalin\", \"\\u0421\\u0442\\u0430\\u0301\\u043b\\u0438\\u043d\", \"Stalin,Josef\", \"Iosif Jugashvili\", \"Iosif Vissarionovic Dzugasvili\", \"Joseph Vissarionovich Dzhugashvili\", \"Joseph Vissarionovich Djugashvili\", \"Iosif Vissarionovich Stalin\", \"Stalin\", \"Iosef Dzhugashvili\", \"Josif Dzhugashvili\", \"STALIN\", \"Joseph Stalin and religion\", \"Death of Stalin\", \"Chijikov\", \"Stallin\", \"Joseph V. Stalin\", \"\\u0418\\u043e\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0414\\u0436\\u0443\\u0433\\u0430\\u0448\\u0432\\u0438\\u043b\\u0438\", \"Ioseb Jugashvili\", \"S\\u012b D\\u00e0l\\u00edn\", \"J V Stalin\", \"Joseph stalin\", \"Vissarionovich Dzhugashvili\", \"\\u0421\\u0442\\u0430\\u043b\\u0438\\u043d\", \"Joseph Jughashvili\", \"Ioseb Jughashvili\", \"\\u0418\\u043e\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0421\\u0442\\u0430\\u043b\\u0438\\u043d\", \"Dze Jugashvili\", \"J.V. Stalin\", \"Iosif Vissarionovich Djugashvili\", \"Soso Stalin\", \"Iosef Jugashvili\", \"Josef Dzhugashvili\", \"Death of Joseph Stalin\", \"Comrade Stalin\", \"Stalin's\", \"\\u10d8\\u10dd\\u10e1\\u10d4\\u10d1 \\u10d1\\u10d4\\u10e1\\u10d0\\u10e0\\u10d8\\u10dd\\u10dc\\u10d8\\u10e1 \\u10eb\\u10d4 \\u10ef\\u10e3\\u10e6\\u10d0\\u10e8\\u10d5\\u10d8\\u10da\\u10d8\", \"Stalin, Joseph\", \"Josip Stalin\", \"\\u0418\\u043e\\u0301\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u0301\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0414\\u0436\\u0443\\u0433\\u0430\\u0448\\u0432\\u0438\\u043b\", \"\\u10d8\\u10dd\\u10e1\\u10d4\\u10d1 \\u10ef\\u10e3\\u10e6\\u10d0\\u10e8\\u10d5\\u10d8\\u10da\\u10d8\", \"Ivan Stalin\", \"Joseph Stalin\", \"\\u10d8\\u10dd\\u10e1\\u10d4\\u10d1 \\u10e1\\u10e2\\u10d0\\u10da\\u10d8\\u10dc\\u10d8\", \"Iosif Djugashvili\", \"Yosif Vissarionovich Dzhugashvili\", \"Joe Stalin\", \"Josif Stalin\", \"Ioseb Besarionis Dze Jughashvili\", \"I.V. Stalin\", \"Josef Vissarionovich Dzhugashvili\", \"Joseph Stalin's death conspiracy\", \"Joseph Stalins's religious views\", \"Iosif Vissarionovich Dzhugashvili\", \"Critique of Stalin\", \"Iosif Vissarionovi\\u010d D\\u017euga\\u0161vili\", \"\\u0418\\u043e\\u0301\\u0441\\u0438\\u0444 \\u0412\\u0438\\u0441\\u0441\\u0430\\u0440\\u0438\\u043e\\u0301\\u043d\\u043e\\u0432\\u0438\\u0447 \\u0421\\u0442\\u0430\\u0301\\u043b\\u0438\\u043d\", \"\\u053b\\u0578\\u057d\\u056b\\u0586 \\u054d\\u057f\\u0561\\u056c\\u056b\\u0576\", \"Djugashvili\", \"Iosif Stalin\", \"Josef Stalin\", \"Eosaph Stalin\", \"Nijeradze\", \"StalinJoseph\", \"Iosif Dzhugashvili\", \"Dzjugasjvili\", \"Joey Stalin\", \"Iosef Stalin\", \"Stalin Josef\", \"J. V. Stalin\", \"Marshal Stalin\", \"Stalin,Joseph\", \"JV Stalin\", \"Iosef Dzugashvili\"]", "[\"Dee, Jack\", \"Jack Dee's Sunday Service\", \"Jack Dee's Saturday Night\", \"James Andrew Innes %22Jack%22 Dee\", \"Jack Dee\", \"James Andrew Innes Dee\"]", "[\"Egnlish\", \"Englilsh\", \"English (disambiguation)\", \"Englissh\", \"ENGLISH\", \"Englis\", \"Enlish\", \"English\", \"Inglisj\", \"Engish\"]", "[\"Catch-22 (novel)\", \"Catch Twenty Two\", \"Catch-18\", \"Catch-22\", \"Catch XXII\", \"Catch 22 (novel)\", \"A. Fortiori\", \"Catch22\", \"Catch\\u201122\", \"Catch 22\"]", "[\"Billie halliday\", \"Billie Holiday\", \"Billy Holiday\", \"Lady Day (singer)\", \"Eleanora Fagan\", \"Frank DeViese\", \"Billy Holliday\", \"BILLIE HOLIDAY\", \"Billie Holliday\", \"Billy holliday\", \"Eleanora Fagan Gough\", \"Holiday, Billie\"]", "[\"M.o.v.e.\", \"THE MOVE\", \"M.o.v.e\", \"Operation Overload 7 (album)\", \"M.O.V.E.\", \"Move (Japanese band)\", \"M.O.V.E\", \"M.o.v.e (Japanese band)\", \"Move (J-Pop)\"]" ]
[ "Who wrote the 1948 play 'The Browning Version'?", "Near which Lincolnshire village did the apple fall on Newton?s head?", "What exam must be passed to practice law in the U.S.?", "What famous saying, representing a deranged and directionless group of people, has been interpreted in creative works by Hieronymus Bosch, Katherine Anne Porter, Erasure, The Grateful Dead, and Bob Seger, among others?", "\"Who emerged as the top Chinese Communist leader during the \"\"Long March\"\" in 1934?\"", "\"Which Cunard Line ship first came to the aid of \"\"RMS Titanic\"\"?\"", "In Greek mythology, who were Clotho, Atropos and Lachesis?", "Which fictional RAF Station gave its name to a post war radio comedy starring Richard Murdoch and Kenneth Horne?", "What was Girls Aloud's 2002 UK Christmas number one single?", "Who said ‘a single death is a tragedy, a million deaths is a statistic’?", "In 2015, who replaced Dara Ó Briain as the presenter of The Apprentice: You’re Fired?", "What is the official language of Nigeria?", "Closing Time was a sequel to which famous novel of 1961?", "Which famous American jazz singer was born Eleanora Fagan in Baltimore in 1915?", "Which group had a 1967 hit with 'Night of Fear'?" ]
15
[ 63975, 63976, 63977, 63978, 63979, 63980, 63981, 63982, 63983, 63984, 63985, 63986, 63987, 63988, 63989 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: \"The statue called \"\"Manneken Pis\"\", of a small boy relieving himself, is in which city?\"\nQuestion 2: Which pope was elected in 1414, ending the situation where there were multiple Popes?\nQuestion 3: \"Which cartoonist, famous for his work for the British newspaper the \"\"Daily Express\"\", used a cartoon family (including Grandma, the enigmatic matriarch, and Chalkie, the tyrannical school teacher), to comment on current affairs?\"\nQuestion 4: What is a Jewish place of worship called?\nQuestion 5: In which country was the 2010 golf Ryder Cup competition held?\nQuestion 6: \"\"\"Well Price, so Genoa and Lucca are now just familyestates of the Bonapartes\"\", is the first line of which novel?\"\nQuestion 7: Madeline Bray married which eponymous character in a Charles Dickens novel?\nQuestion 8: Which actress played Agatha Christie's Miss Marple in five films?\nQuestion 9: Which British Prime Minister was born on December 29th 1809 and is the only British Prime Minister to be born in Liverpool?\nQuestion 10: Who got the vote in Britain in 1829?\nQuestion 11: What cartoon characters are described as being three apples high?\nQuestion 12: In George Orwell's 'Animal Farm', what is the name of the loyal but dim-witted cart-horse who carries out many of the orders handed down by 'Napoleon'?\nQuestion 13: Treskilling Yellow from Sweden, Bull's Eye from Brazil, Inverted Jenny from the United States, Basel Dove from Switzerland and Benjamin Franklin Z Grill from the United States are some of the famous specimens of what?\nQuestion 14: In which year was the University of Alaska Anchorage founded?\nQuestion 15: What invention of the Greenland Inuit is also derogatory slang for an outdoor hobbyist who observes or collects things?", "role": "user" } ]
["[\"Bruselas\", \"Brussels-Capital region\", \"BEBRU\", \"Brussels-capital region\", \"Brusells\", \"R\\u00e9gion de bruxelles-capital\", \"Bruxelle\", \"Bruessel\", \"Region bruxelles-capitale\", \"Region Br\\u00fcssel-Hauptstadt\", \"Br\\u00fcssel\", \"Brusselse region\", \"Brussels Hoofdstedelijk Gewest\", \"Brusels\", \"Brussels-capital Region\", \"Brussels-Capital Region\", \"Brussels-Capital\", \"R\\u00e9gion de Bruxelles-Capitale\", \"Brussels, BE\", \"Region de Bruxelles-Capitale\", \"R\\u00e9gion de bruxelles-capitale\", \"Region Brussel-Hauptstadt\", \"Region de Bruxelles Capitale\", \"Region de bruxelles-capital\", \"Brussels Capital-Region\", \"R\\u00e9gion bruxelles-capitale\", \"Brussels Capital Region\", \"Region Bruessel-Hauptstadt\", \"Brussles\", \"Brussel\", \"Brussels\", \"Brussels capital region\", \"Bruxless\", \"Brusselian\", \"Bruessels\", \"Br\\u00fcssels\", \"UN/LOCODE:BEBRU\", \"Brussels Region\", \"Bruxelles\", \"R\\u00e9gion de Bruxelles Capitale\", \"Region de bruxelles-capitale\", \"Brussels, Belgium\", \"Brussells\"]", "[\"Oddo Colonna\", \"Martin V\", \"206th pope\", \"Oddone Colonna\", \"Martin V.\", \"Pope Martin V\", \"Otto di Colonna\", \"Pope martin V\"]", "[\"Giles\", \"Giles (disambiguation)\"]", "[\"Synagogue\", \"Jewish Synagogue\", \"Havuroth\", \"Bet kenesset\", \"Conservative temple\", \"Jewish Community\", \"Beit ha'knesset\", \"Beit Tefillah\", \"Bet ha-Keneset\", \"Reform temple\", \"Beth kneset\", \"Beth kenesset\", \"Beit kneset\", \"Synogogue\", \"Synagog\", \"Shul\", \"Bet keneset\", \"Bet kneset\", \"\\ud83d\\udd4d\", \"Beit keneset\", \"Beit kennesset\", \"Bet knesset\", \"Beit kenneset\", \"Bet kennesset\", \"Beit kenesset\", \"Beit Knesset\", \"Beth kennesset\", \"Bet ha-tefillah\", \"Jewish synagogue\", \"Beth knesset\", \"Beth keneset\", \"Synagogues\", \"Bet ha'keneset\", \"Synagogue worship\", \"Shuls\", \"Temple (modern Judaism)\", \"Beth kenneset\", \"Synagogal\", \"Bet kenneset\", \"Synagoge\", \"Bet ha-knesset\"]", "[\"Welsh nation\", \"Climate of Wales\", \"Autonomous Province of Wales\", \"Cymru / wales\", \"Cyrmu\", \"Wales\", \"WALES\", \"Rain in Wales\", \"Welsh Nation\", \"Welsh Peninsula\", \"Wales, UK\", \"Etymology of Wales\", \"Cymru\", \"Wales, United Kingdom\", \"Pays de Galles\", \"Communications in Wales\", \"The Principality of Wales\", \"West of the Rhymney\", \"Wales, U.K.\", \"Cymru am byth\", \"Gymru\", \"Cymru / Wales\", \"Welsh mountains\", \"CYMRU\"]", "[\"War+Peace\", \"War and peace\", \"Maria Bolkonskaya\", \"'WAR AND PEACE'\", \"Marya Bolkosky\", \"Voyn\\u00e1 i mir\", \"War and Peace\", \"Andrey Bolkonsky\", \"War & Peace\", \"War 'n' Peace\", \"Petya Ilyitch Rostov\", \"Maria Bolkonsky\", \"War 'n Peace\", \"Pierre Besouchoff\", \"War n' Peace\", \"Count Nikolay Rostov\", \"Voina i Mir\", \"\\u0412\\u043e\\u0439\\u043d\\u0430 \\u0438 \\u043c\\u0438\\u0440\", \"Princess Marya\", \"War n Peace\", \"Sonya Rostov\", \"Voyna i mir\", \"War And Peace\", \"War and Peace (novel)\", \"War and Society\", \"Guerre et Paix\", \"War + Peace\"]", "[\"Nicholas Nickelby\", \"The Life and Adventures of Nicholas Nickleby\", \"Nicholas Nickleby\", \"Mr. Wackford Squeers\", \"Wackford Squeers\", \"Dotheboys Hall\", \"Nicholas Nickleby (protagonist)\", \"Do-the-Boys'-Hall\", \"Squeer\"]", "[\"Dame Margaret Rutherford\", \"Rutherford, Dame Margaret\", \"Margaret Rutherford\", \"MARGARET RUTHERFORD\"]", "[\"Mr. Gresham\", \"William Gladstone\", \"Sir William Ewart Gladstone\", \"W.E. Gladstone\", \"William Ewart Gladstone\", \"Gladstonian\", \"W E Gladstone\", \"William E Gladstone\", \"William Ewert Gladstone\", \"William GLADSTONE\", \"William E. Gladstone\", \"W. E. Gladstone\", \"WE Gladstone\", \"Ewart Gladstone\"]", "[\"Catholic Communion\", \"Popish Church\", \"RomanCatholic\", \"Roman Catholic church\", \"RomanCatholicChurch\", \"Roman catholic\", \"Catholic teachings\", \"Roman Catholic Christian\", \"Catholicism.\", \"Christian - Catholic\", \"Kanisa\", \"Roman Catholicism\", \"Roman Catholic Communion\", \"Romish Church\", \"Iglesia Catolica Apostolica Romana\", \"Communion with Rome\", \"Roman Catholic\", \"Catholic Faith\", \"Catholic Christians\", \"Catholic church\", \"Catholic Church, Roman\", \"Catholic (church)\", \"Roman catholicism\", \"Unam, sanctam, catholicam et apostolicam ecclesiam\", \"Katolikismo\", \"Roman Catholic Church\", \"Catholics in Communion with Rome\", \"Holy Mother Church\", \"Roman Catholics\", \"The Roman Catholic Church\", \"Catholic Church\", \"Roman-catholic\", \"The Catholic Church\", \"Roman Communion\", \"The Worldwide Roman Catholic Church\", \"Holy Roman Catholic\", \"Catholic Christian\", \"CatholicChurch\", \"Roman catholic church\", \"Holy Roman Catholic Church\", \"Roman CatholicChurch\", \"RomanCatholic Church\", \"Christifideles\", \"Catholicism (Roman)\", \"Roman Catholics Church\", \"Roman-Catholic\", \"Roman Catholic communion\", \"Roman-Catholic Church\"]", "[\"Le Pays maudit\", \"Swoof\", \"De Smurfen\", \"Schtroumpfs\", \"The Smurfs\", \"Smurf communism\", \"A smurf\", \"Les Schtroumpfs\", \"Smurfs\", \"Smurfy\", \"The smurfs\", \"Smurf Communism\", \"Schtroumpf\", \"Smurves\", \"A Smurf\", \"Smurfberry\", \"Smurf (nickname)\", \"Smurf\", \"The Smurfs and communism\", \"Smurf language\", \"The Smurf\", \"Smurfen\", \"The Smurfs (game)\"]", "[\"German Boxer\", \"'BOXER'\", \"Deutscher Boxer\", \"Boxer.\", \"Boxer (breed)\", \"Boxer dogs\", \"White Boxer\", \"Boxer Dogs\", \"Boxer dog\", \"Boxer (dog)\", \"Boxer (Dog)\"]", "[\"Adhesive postage stamp\", \"Postage stamps\", \"Post stamp\", \"Postage stamp\", \"Postage Stamp\", \"Stamp (postage)\", \"Postal stamp\", \"Postage stamp/how dispensed\"]", "[\"1954\", \"one thousand, nine hundred and fifty-four\"]", "[\"Snorkel Parka\", \"Fishtail parka\", \"Anoraks\", \"Arctic jacket\", \"N3b\", \"Snorkel Jacket\", \"Anorak\", \"Snorkel parka\", \"Anorack\", \"Parka\", \"Parka (coat)\", \"Parkas\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Bruselas\", \"Brussels-Capital region\", \"BEBRU\", \"Brussels-capital region\", \"Brusells\", \"R\\u00e9gion de bruxelles-capital\", \"Bruxelle\", \"Bruessel\", \"Region bruxelles-capitale\", \"Region Br\\u00fcssel-Hauptstadt\", \"Br\\u00fcssel\", \"Brusselse region\", \"Brussels Hoofdstedelijk Gewest\", \"Brusels\", \"Brussels-capital Region\", \"Brussels-Capital Region\", \"Brussels-Capital\", \"R\\u00e9gion de Bruxelles-Capitale\", \"Brussels, BE\", \"Region de Bruxelles-Capitale\", \"R\\u00e9gion de bruxelles-capitale\", \"Region Brussel-Hauptstadt\", \"Region de Bruxelles Capitale\", \"Region de bruxelles-capital\", \"Brussels Capital-Region\", \"R\\u00e9gion bruxelles-capitale\", \"Brussels Capital Region\", \"Region Bruessel-Hauptstadt\", \"Brussles\", \"Brussel\", \"Brussels\", \"Brussels capital region\", \"Bruxless\", \"Brusselian\", \"Bruessels\", \"Br\\u00fcssels\", \"UN/LOCODE:BEBRU\", \"Brussels Region\", \"Bruxelles\", \"R\\u00e9gion de Bruxelles Capitale\", \"Region de bruxelles-capitale\", \"Brussels, Belgium\", \"Brussells\"]", "[\"Oddo Colonna\", \"Martin V\", \"206th pope\", \"Oddone Colonna\", \"Martin V.\", \"Pope Martin V\", \"Otto di Colonna\", \"Pope martin V\"]", "[\"Giles\", \"Giles (disambiguation)\"]", "[\"Synagogue\", \"Jewish Synagogue\", \"Havuroth\", \"Bet kenesset\", \"Conservative temple\", \"Jewish Community\", \"Beit ha'knesset\", \"Beit Tefillah\", \"Bet ha-Keneset\", \"Reform temple\", \"Beth kneset\", \"Beth kenesset\", \"Beit kneset\", \"Synogogue\", \"Synagog\", \"Shul\", \"Bet keneset\", \"Bet kneset\", \"\\ud83d\\udd4d\", \"Beit keneset\", \"Beit kennesset\", \"Bet knesset\", \"Beit kenneset\", \"Bet kennesset\", \"Beit kenesset\", \"Beit Knesset\", \"Beth kennesset\", \"Bet ha-tefillah\", \"Jewish synagogue\", \"Beth knesset\", \"Beth keneset\", \"Synagogues\", \"Bet ha'keneset\", \"Synagogue worship\", \"Shuls\", \"Temple (modern Judaism)\", \"Beth kenneset\", \"Synagogal\", \"Bet kenneset\", \"Synagoge\", \"Bet ha-knesset\"]", "[\"Welsh nation\", \"Climate of Wales\", \"Autonomous Province of Wales\", \"Cymru / wales\", \"Cyrmu\", \"Wales\", \"WALES\", \"Rain in Wales\", \"Welsh Nation\", \"Welsh Peninsula\", \"Wales, UK\", \"Etymology of Wales\", \"Cymru\", \"Wales, United Kingdom\", \"Pays de Galles\", \"Communications in Wales\", \"The Principality of Wales\", \"West of the Rhymney\", \"Wales, U.K.\", \"Cymru am byth\", \"Gymru\", \"Cymru / Wales\", \"Welsh mountains\", \"CYMRU\"]", "[\"War+Peace\", \"War and peace\", \"Maria Bolkonskaya\", \"'WAR AND PEACE'\", \"Marya Bolkosky\", \"Voyn\\u00e1 i mir\", \"War and Peace\", \"Andrey Bolkonsky\", \"War & Peace\", \"War 'n' Peace\", \"Petya Ilyitch Rostov\", \"Maria Bolkonsky\", \"War 'n Peace\", \"Pierre Besouchoff\", \"War n' Peace\", \"Count Nikolay Rostov\", \"Voina i Mir\", \"\\u0412\\u043e\\u0439\\u043d\\u0430 \\u0438 \\u043c\\u0438\\u0440\", \"Princess Marya\", \"War n Peace\", \"Sonya Rostov\", \"Voyna i mir\", \"War And Peace\", \"War and Peace (novel)\", \"War and Society\", \"Guerre et Paix\", \"War + Peace\"]", "[\"Nicholas Nickelby\", \"The Life and Adventures of Nicholas Nickleby\", \"Nicholas Nickleby\", \"Mr. Wackford Squeers\", \"Wackford Squeers\", \"Dotheboys Hall\", \"Nicholas Nickleby (protagonist)\", \"Do-the-Boys'-Hall\", \"Squeer\"]", "[\"Dame Margaret Rutherford\", \"Rutherford, Dame Margaret\", \"Margaret Rutherford\", \"MARGARET RUTHERFORD\"]", "[\"Mr. Gresham\", \"William Gladstone\", \"Sir William Ewart Gladstone\", \"W.E. Gladstone\", \"William Ewart Gladstone\", \"Gladstonian\", \"W E Gladstone\", \"William E Gladstone\", \"William Ewert Gladstone\", \"William GLADSTONE\", \"William E. Gladstone\", \"W. E. Gladstone\", \"WE Gladstone\", \"Ewart Gladstone\"]", "[\"Catholic Communion\", \"Popish Church\", \"RomanCatholic\", \"Roman Catholic church\", \"RomanCatholicChurch\", \"Roman catholic\", \"Catholic teachings\", \"Roman Catholic Christian\", \"Catholicism.\", \"Christian - Catholic\", \"Kanisa\", \"Roman Catholicism\", \"Roman Catholic Communion\", \"Romish Church\", \"Iglesia Catolica Apostolica Romana\", \"Communion with Rome\", \"Roman Catholic\", \"Catholic Faith\", \"Catholic Christians\", \"Catholic church\", \"Catholic Church, Roman\", \"Catholic (church)\", \"Roman catholicism\", \"Unam, sanctam, catholicam et apostolicam ecclesiam\", \"Katolikismo\", \"Roman Catholic Church\", \"Catholics in Communion with Rome\", \"Holy Mother Church\", \"Roman Catholics\", \"The Roman Catholic Church\", \"Catholic Church\", \"Roman-catholic\", \"The Catholic Church\", \"Roman Communion\", \"The Worldwide Roman Catholic Church\", \"Holy Roman Catholic\", \"Catholic Christian\", \"CatholicChurch\", \"Roman catholic church\", \"Holy Roman Catholic Church\", \"Roman CatholicChurch\", \"RomanCatholic Church\", \"Christifideles\", \"Catholicism (Roman)\", \"Roman Catholics Church\", \"Roman-Catholic\", \"Roman Catholic communion\", \"Roman-Catholic Church\"]", "[\"Le Pays maudit\", \"Swoof\", \"De Smurfen\", \"Schtroumpfs\", \"The Smurfs\", \"Smurf communism\", \"A smurf\", \"Les Schtroumpfs\", \"Smurfs\", \"Smurfy\", \"The smurfs\", \"Smurf Communism\", \"Schtroumpf\", \"Smurves\", \"A Smurf\", \"Smurfberry\", \"Smurf (nickname)\", \"Smurf\", \"The Smurfs and communism\", \"Smurf language\", \"The Smurf\", \"Smurfen\", \"The Smurfs (game)\"]", "[\"German Boxer\", \"'BOXER'\", \"Deutscher Boxer\", \"Boxer.\", \"Boxer (breed)\", \"Boxer dogs\", \"White Boxer\", \"Boxer Dogs\", \"Boxer dog\", \"Boxer (dog)\", \"Boxer (Dog)\"]", "[\"Adhesive postage stamp\", \"Postage stamps\", \"Post stamp\", \"Postage stamp\", \"Postage Stamp\", \"Stamp (postage)\", \"Postal stamp\", \"Postage stamp/how dispensed\"]", "[\"1954\", \"one thousand, nine hundred and fifty-four\"]", "[\"Snorkel Parka\", \"Fishtail parka\", \"Anoraks\", \"Arctic jacket\", \"N3b\", \"Snorkel Jacket\", \"Anorak\", \"Snorkel parka\", \"Anorack\", \"Parka\", \"Parka (coat)\", \"Parkas\"]" ]
[ "\"The statue called \"\"Manneken Pis\"\", of a small boy relieving himself, is in which city?\"", "Which pope was elected in 1414, ending the situation where there were multiple Popes?", "\"Which cartoonist, famous for his work for the British newspaper the \"\"Daily Express\"\", used a cartoon family (including Grandma, the enigmatic matriarch, and Chalkie, the tyrannical school teacher), to comment on current affairs?\"", "What is a Jewish place of worship called?", "In which country was the 2010 golf Ryder Cup competition held?", "\"\"\"Well Price, so Genoa and Lucca are now just familyestates of the Bonapartes\"\", is the first line of which novel?\"", "Madeline Bray married which eponymous character in a Charles Dickens novel?", "Which actress played Agatha Christie's Miss Marple in five films?", "Which British Prime Minister was born on December 29th 1809 and is the only British Prime Minister to be born in Liverpool?", "Who got the vote in Britain in 1829?", "What cartoon characters are described as being three apples high?", "In George Orwell's 'Animal Farm', what is the name of the loyal but dim-witted cart-horse who carries out many of the orders handed down by 'Napoleon'?", "Treskilling Yellow from Sweden, Bull's Eye from Brazil, Inverted Jenny from the United States, Basel Dove from Switzerland and Benjamin Franklin Z Grill from the United States are some of the famous specimens of what?", "In which year was the University of Alaska Anchorage founded?", "What invention of the Greenland Inuit is also derogatory slang for an outdoor hobbyist who observes or collects things?" ]
15
[ 134565, 134566, 134567, 134568, 134569, 134570, 134571, 134572, 134573, 134574, 134575, 134576, 134577, 134578, 134579 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: 'Russell Hybrids' are a type of which common garden flower?\nQuestion 2: In what wrestling move does the wrestler grabs his opponent, turn him upside-down, and drop into a sitting or kneeling position, driving the opponent head-first into the mat?\nQuestion 3: In which English county is the source of the River Trent ?\nQuestion 4: For which cricket county does former England test batsman Mark Ramprakash play?\nQuestion 5: What word is used for the divination of dreams?\nQuestion 6: What international news TV network is based in Doha, Qatar?\nQuestion 7: Which food company, still in existence today, was founded in 1902 in a disused malthouse in Burton-on-Trent?\nQuestion 8: In December, which former Italian colony declared independence in Africa?\nQuestion 9: Which of the Spanish ‘Costas’ has a name meaning ‘gold coast’?\nQuestion 10: In South Korea a chaebol is a significant family-owned/operated?\nQuestion 11: Saddam Hussein was born in which town?\nQuestion 12: Provenance, originally relating to an artwork, now extending widely to other created or collectible works, refers specifically to?\nQuestion 13: The Crucible, a 1953 play by Arthur Miller, was set in what city?\nQuestion 14: After whom is the international airport at Genoa named?\nQuestion 15: Which country first tried unsuccessfully to build the Panama Canal?", "role": "user" } ]
["[\"Lupinus hybrids\", \"Lupinus\", \"Lupin\", \"Altramuz\", \"Wild lupine\", \"LUPINS\", \"Lupins\"]", "[\"Air hammer (pile driver)\", \"Pile driver\", \"Pile drive\", \"Pile driving\", \"Pile Driver\"]", "[\"Staffordshire, England\", \"Staffs\", \"Staffordshire\", \"County of Stafford\", \"STAFFORDSHIRE\"]", "[\"Surrey\", \"Su\\u00f0rigean\", \"Godley (Hundred)\", \"County of Surrey\", \"Surrey, England\", \"History of Surrey\", \"Kingdom of Surrey\", \"Services for Young People in Surrey County Council\", \"History of surrey\", \"Surrey (England)\", \"St Nicolas C of E Infant School\"]", "[\"Oniromancy\", \"Finding Meaning in Dreams\", \"Oneiromancy\", \"Analysing their dreams\", \"Neiromancy\", \"Onieromancy\"]", "[\"AI Jazeera\", \"Aljazeerah\", \"Aljazeera TV\", \"Al Jazeera Arabic\", \"Al Jazeera TV\", \"Aljazirah\", \"Al-Jazirah\", \"AlJazeera\", \"Aljazira\", \"Aljazeera.net\", \"Al Jazeera Network\", \"Al Jazeera\", \"Al-jazeera\", \"Al-Jazeerah\", \"Al Jazeera Presenters\", \"Al Jazeera Television\", \"Al Jazeerah\", \"Al Jazeera (Arabic)\", \"Al Jazera\", \"Al-Jazeera\", \"Al Dschasira\", \"\\u0627\\u0644\\u062c\\u0632\\u064a\\u0631\\u0629\", \"AL Jazirah TV\", \"Al jazeera\", \"Aljazera\", \"Aljazeera Television\", \"Al Jazeera News\", \"Al-jezeera\", \"Aljazeera\", \"Al Jazeera footage\", \"Al Jezeera\", \"Al Jazeera's\"]", "[\"Marmageddon\", \"Marmite reaction\", \"Marmite\", \"Our Mate\", \"Marmite effect\", \"Where to buy marmite\", \"Ma'amite\"]", "[\"Free Democratic Libya\", \"LIBYA\", \"Islamic Republic of Libya\", \"Libya (National Transitional Council)\", \"Republic of Libya\", \"Libya\", \"State of Libya\", \"Libyan Republic (2011)\", \"Libyan Republic\", \"\\u2d4d\\u2d49\\u2d31\\u2d62\\u2d30\", \"\\u0644\\u064a\\u0628\\u064a\\u0627\", \"Libiyah\", \"LBY\", \"Etymology of Libya\", \"Al-Jamahiriya al-%60Arabiyah al-Libiyah ash-Sha%60biyah al-Ishtirakiyah al-Uzma\", \"Largest cities in Libya\", \"L\\u012bbiy\\u0101\", \"Lybya\", \"Free Libya\", \"Libiya\", \"ISO 3166-1:LY\"]", "[\"Costa Daurada\", \"Costa Dorada\"]", "[\"Corporate entities\", \"Corporation\", \"Corplate\", \"Company law history\", \"History of corporations\", \"Close corporation\", \"Incorporated businesses\", \"Corporate agenda\", \"Mutual Benefit Corporation\", \"Corporate enterprise\", \"Corp.\", \"Incorporated business\", \"Corperation\", \"Shareholder owned\", \"Corporate entity\", \"History of company law\", \"Company history\", \"History of companies\", \"Corporate\", \"Coporation\", \"Corporate enterprises\", \"History of corporate law\", \"Mutual benefit corporation\", \"Corporations\", \"Coportate\"]", "[\"Tikrit, Iraq\", \"Takrit\", \"Tikrit Palace\", \"\\u062a\\u0643\\u0631\\u064a\\u062a\", \"Tikreet\", \"Tekrit\", \"Tikr\\u012bt\", \"The Birthday Palace\", \"Birthday Palace\", \"Tikrit\", \"Tagrit\"]", "[\"Historical change\", \"Histrory\", \"History - BA\", \"Stage (period)\", \"Hi\\u017ftory\", \"Historical sciences\", \"Hist.\", \"Military history (descriptive)\", \"History (etymology)\", \"Historically\", \"Histroy\", \"Historic\", \"Historical events\", \"HISTORY\", \"HiStory\", \"Historical science\", \"Etymology of %22history%22\", \"General history\", \"Bibliography of history\", \"Hisotry\", \"Historical\", \"History\", \"Hisory\", \"Non-historical\", \"Histoire\", \"Historical narrative\", \"History books\", \"Historical Sciences\", \"Traditional History\", \"HisTory\"]", "[\"Salem\", \"Salem (band)\", \"Salem (disambiguation)\"]", "[\"Christoffa Corombo\", \"Christopher columbus\", \"Col\\u00f3n, Crist\\u00f3bal-- Explorer\", \"Crostoforo Colombo\", \"Chistopher Colombus\", \"Christopher Colombus\", \"Cristoforo Colubmo\", \"Christophorus Columbus\", \"Columbus Quincentennial\", \"Crist\\u00f3bal Col\\u00f3n\", \"Columbus's\", \"Christoper Columbus\", \"Crist\\u00f3v\\u00e3o Colombo\", \"Christovao Columbo\", \"Cristoforo Colombo\", \"Cristopher Colombus\", \"Christopher columb\", \"Christopher colub\", \"Christopher Columbus 1st Voyage\", \"Colon, Cristobal-- Explorer\", \"Perceptions of Columbus\", \"Cristobol Colon\", \"Topher columbus\", \"Cristovao Colombo\", \"Christofo Columbo\", \"Christopher Columbus\", \"Christopher coloumbus\", \"Christobal Colon\", \"Admiral of the Ocean Sea\", \"Cristopher Columbus\", \"Cristoforo Columbo\"]", "[\"La Republique francaise\", \"Franciaorsz\\u00e1g\", \"La Republique fran\\u00e7aise\", \"Belle France\", \"FRANCE\", \"Republique fran\\u00e7aise\", \"France\", \"Ranska\", \"Franciaorszag\", \"French Republic\", \"R\\u00e9publique francaise\", \"R\\u00e9publique fran\\u00e7aise\", \"ISO 3166-1:FR\", \"Frankreich\", \"France (country)\", \"Etymology of France\", \"FrancE\", \"La R\\u00e9publique fran\\u00e7aise\", \"People of France\", \"Republic of France\", \"Fracne\", \"Le France\", \"The French Republic\", \"Republique francaise\", \"The Republic of France\", \"La R\\u00e9publique francaise\", \"La France\", \"Rain in France\", \"Republic of france\", \"FRance\", \"Frakkland\", \"Climate of France\", \"Franse\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Lupinus hybrids\", \"Lupinus\", \"Lupin\", \"Altramuz\", \"Wild lupine\", \"LUPINS\", \"Lupins\"]", "[\"Air hammer (pile driver)\", \"Pile driver\", \"Pile drive\", \"Pile driving\", \"Pile Driver\"]", "[\"Staffordshire, England\", \"Staffs\", \"Staffordshire\", \"County of Stafford\", \"STAFFORDSHIRE\"]", "[\"Surrey\", \"Su\\u00f0rigean\", \"Godley (Hundred)\", \"County of Surrey\", \"Surrey, England\", \"History of Surrey\", \"Kingdom of Surrey\", \"Services for Young People in Surrey County Council\", \"History of surrey\", \"Surrey (England)\", \"St Nicolas C of E Infant School\"]", "[\"Oniromancy\", \"Finding Meaning in Dreams\", \"Oneiromancy\", \"Analysing their dreams\", \"Neiromancy\", \"Onieromancy\"]", "[\"AI Jazeera\", \"Aljazeerah\", \"Aljazeera TV\", \"Al Jazeera Arabic\", \"Al Jazeera TV\", \"Aljazirah\", \"Al-Jazirah\", \"AlJazeera\", \"Aljazira\", \"Aljazeera.net\", \"Al Jazeera Network\", \"Al Jazeera\", \"Al-jazeera\", \"Al-Jazeerah\", \"Al Jazeera Presenters\", \"Al Jazeera Television\", \"Al Jazeerah\", \"Al Jazeera (Arabic)\", \"Al Jazera\", \"Al-Jazeera\", \"Al Dschasira\", \"\\u0627\\u0644\\u062c\\u0632\\u064a\\u0631\\u0629\", \"AL Jazirah TV\", \"Al jazeera\", \"Aljazera\", \"Aljazeera Television\", \"Al Jazeera News\", \"Al-jezeera\", \"Aljazeera\", \"Al Jazeera footage\", \"Al Jezeera\", \"Al Jazeera's\"]", "[\"Marmageddon\", \"Marmite reaction\", \"Marmite\", \"Our Mate\", \"Marmite effect\", \"Where to buy marmite\", \"Ma'amite\"]", "[\"Free Democratic Libya\", \"LIBYA\", \"Islamic Republic of Libya\", \"Libya (National Transitional Council)\", \"Republic of Libya\", \"Libya\", \"State of Libya\", \"Libyan Republic (2011)\", \"Libyan Republic\", \"\\u2d4d\\u2d49\\u2d31\\u2d62\\u2d30\", \"\\u0644\\u064a\\u0628\\u064a\\u0627\", \"Libiyah\", \"LBY\", \"Etymology of Libya\", \"Al-Jamahiriya al-%60Arabiyah al-Libiyah ash-Sha%60biyah al-Ishtirakiyah al-Uzma\", \"Largest cities in Libya\", \"L\\u012bbiy\\u0101\", \"Lybya\", \"Free Libya\", \"Libiya\", \"ISO 3166-1:LY\"]", "[\"Costa Daurada\", \"Costa Dorada\"]", "[\"Corporate entities\", \"Corporation\", \"Corplate\", \"Company law history\", \"History of corporations\", \"Close corporation\", \"Incorporated businesses\", \"Corporate agenda\", \"Mutual Benefit Corporation\", \"Corporate enterprise\", \"Corp.\", \"Incorporated business\", \"Corperation\", \"Shareholder owned\", \"Corporate entity\", \"History of company law\", \"Company history\", \"History of companies\", \"Corporate\", \"Coporation\", \"Corporate enterprises\", \"History of corporate law\", \"Mutual benefit corporation\", \"Corporations\", \"Coportate\"]", "[\"Tikrit, Iraq\", \"Takrit\", \"Tikrit Palace\", \"\\u062a\\u0643\\u0631\\u064a\\u062a\", \"Tikreet\", \"Tekrit\", \"Tikr\\u012bt\", \"The Birthday Palace\", \"Birthday Palace\", \"Tikrit\", \"Tagrit\"]", "[\"Historical change\", \"Histrory\", \"History - BA\", \"Stage (period)\", \"Hi\\u017ftory\", \"Historical sciences\", \"Hist.\", \"Military history (descriptive)\", \"History (etymology)\", \"Historically\", \"Histroy\", \"Historic\", \"Historical events\", \"HISTORY\", \"HiStory\", \"Historical science\", \"Etymology of %22history%22\", \"General history\", \"Bibliography of history\", \"Hisotry\", \"Historical\", \"History\", \"Hisory\", \"Non-historical\", \"Histoire\", \"Historical narrative\", \"History books\", \"Historical Sciences\", \"Traditional History\", \"HisTory\"]", "[\"Salem\", \"Salem (band)\", \"Salem (disambiguation)\"]", "[\"Christoffa Corombo\", \"Christopher columbus\", \"Col\\u00f3n, Crist\\u00f3bal-- Explorer\", \"Crostoforo Colombo\", \"Chistopher Colombus\", \"Christopher Colombus\", \"Cristoforo Colubmo\", \"Christophorus Columbus\", \"Columbus Quincentennial\", \"Crist\\u00f3bal Col\\u00f3n\", \"Columbus's\", \"Christoper Columbus\", \"Crist\\u00f3v\\u00e3o Colombo\", \"Christovao Columbo\", \"Cristoforo Colombo\", \"Cristopher Colombus\", \"Christopher columb\", \"Christopher colub\", \"Christopher Columbus 1st Voyage\", \"Colon, Cristobal-- Explorer\", \"Perceptions of Columbus\", \"Cristobol Colon\", \"Topher columbus\", \"Cristovao Colombo\", \"Christofo Columbo\", \"Christopher Columbus\", \"Christopher coloumbus\", \"Christobal Colon\", \"Admiral of the Ocean Sea\", \"Cristopher Columbus\", \"Cristoforo Columbo\"]", "[\"La Republique francaise\", \"Franciaorsz\\u00e1g\", \"La Republique fran\\u00e7aise\", \"Belle France\", \"FRANCE\", \"Republique fran\\u00e7aise\", \"France\", \"Ranska\", \"Franciaorszag\", \"French Republic\", \"R\\u00e9publique francaise\", \"R\\u00e9publique fran\\u00e7aise\", \"ISO 3166-1:FR\", \"Frankreich\", \"France (country)\", \"Etymology of France\", \"FrancE\", \"La R\\u00e9publique fran\\u00e7aise\", \"People of France\", \"Republic of France\", \"Fracne\", \"Le France\", \"The French Republic\", \"Republique francaise\", \"The Republic of France\", \"La R\\u00e9publique francaise\", \"La France\", \"Rain in France\", \"Republic of france\", \"FRance\", \"Frakkland\", \"Climate of France\", \"Franse\"]" ]
[ "'Russell Hybrids' are a type of which common garden flower?", "In what wrestling move does the wrestler grabs his opponent, turn him upside-down, and drop into a sitting or kneeling position, driving the opponent head-first into the mat?", "In which English county is the source of the River Trent ?", "For which cricket county does former England test batsman Mark Ramprakash play?", "What word is used for the divination of dreams?", "What international news TV network is based in Doha, Qatar?", "Which food company, still in existence today, was founded in 1902 in a disused malthouse in Burton-on-Trent?", "In December, which former Italian colony declared independence in Africa?", "Which of the Spanish ‘Costas’ has a name meaning ‘gold coast’?", "In South Korea a chaebol is a significant family-owned/operated?", "Saddam Hussein was born in which town?", "Provenance, originally relating to an artwork, now extending widely to other created or collectible works, refers specifically to?", "The Crucible, a 1953 play by Arthur Miller, was set in what city?", "After whom is the international airport at Genoa named?", "Which country first tried unsuccessfully to build the Panama Canal?" ]
15
[ 63675, 63676, 63677, 63678, 63679, 63680, 63681, 63682, 63683, 63684, 63685, 63686, 63687, 63688, 63689 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: \"Who wrote the novel \"\"Lovely Bones\"\"?\"\nQuestion 2: Which squash player was unbeaten for over 150 consecutive matches between 1981 and 1986?\nQuestion 3: Nitro-hydrochloric acid was traditionally called what?\nQuestion 4: What type of plants are 'Scandents'?\nQuestion 5: Which UK-based film company, founded in 1934, was best known for producing horror films between the mid 1950’s until the 1970’s?\nQuestion 6: Murophobia is the abnormal fear of what?\nQuestion 7: What year did England's lease on Hong Kong expire?\nQuestion 8: What is the sum of the digits of the product of any number between 1 & 9 multiplied by 9?\nQuestion 9: In which country was the fashion designer Yves St Laurent brn?\nQuestion 10: Which daily newspaper has a column called 'Mandrake'?\nQuestion 11: In which Woody Allen film do a pair of burglars answer the phone and become random contestants in a phone in quiz show\nQuestion 12: The Statue of Liberty was a gift from which country?\nQuestion 13: In Swift's 'Gullivers Travels', what is 'Gulliver's profession?\nQuestion 14: In shillings and pence, how much did the Mad Hatter pay for his hat?\nQuestion 15: Which country does tennis star Marcelo Rios represent", "role": "user" } ]
["[\"Alice Sebold\", \"Alice Seybold\", \"ALICE SEBOLD\"]", "[\"Jahangir Khan\"]", "[\"Koningswater\", \"\\ud83d\\udf07\", \"\\ud83d\\udf06\", \"Aqua regis\", \"Nitrohydrochloric acid\", \"Aqua Regis\", \"Aqua regia\", \"Nitromuriate\", \"King's water\", \"Nitromuriatic acid\", \"Aqua Regia\", \"Royal water\"]", "[\"Twiner\", \"Scandent\", \"Trailing plants\", \"Creeping vines\", \"Climbing plant\", \"Climbing plants\", \"Vine\", \"Vines\", \"Viny\", \"Vine (botany)\", \"Climbing vines\", \"Climbing vine\", \"Twining plant\", \"CLIMBING PLANTS\", \"Creeper plant\", \"Trailing plant\"]", "[\"Hammer Horror\", \"Hammer film\", \"Hammer Productions\", \"Hammer Film Productions\", \"Hammer Film Productions Ltd.\", \"Hammer horror\", \"Hammer Studios\", \"Exclusive Films\", \"Hammer Films\", \"Hammer's House of Horror\"]", "[\"MICE\", \"Mice (disambiguation)\"]", "[\"one thousand, nine hundred and ninety-seven\", \"1997\"]", "[\"9\", \"nine\"]", "[\"Popular Democratic Republic of Algeria\", \"AlgeriA\", \"Name of Algeria\", \"Algerian People's Democratic Republic\", \"Al-Jumh\\u016br\\u012byah al-Jaz\\u0101\\u2019ir\\u012byah\", \"\\u0627\\u0644\\u062c\\u0632\\u0627\\u0626\\u0631\", \"Algeria country\", \"Algerie\", \"ISO 3166-1:DZ\", \"Algeria\", \"Algerian Peoples Democratic Republic\", \"Dzayer\", \"Administrative divisions of Algeria\", \"People\\u2019s Democratic Republic of Algeria\", \"People's Democratic Algerian Republic\", \"Ad-D\\u012bmuqr\\u0101\\u1e6d\\u012byah ash-Sha\\u2019b\\u012byah\", \"ALGERIA\", \"Subdivision of Algeria\", \"Al Jumhuriyah al Jaza'iriyah ad Dimuqratiyah ash Shabiyah\", \"Subdivisions of Algeria\", \"Alg\\u00e9rie\", \"Etymology of Algeria\", \"Algerian State\", \"R\\u00e9publique alg\\u00e9rienne d\\u00e9mocratique et populaire\", \"Republic of Algeria\", \"People's Republic of Algeria\", \"Algery\", \"Al-Jumhuriyah al-Jaza'iriyah\", \"People's Democratic Republic of Algeria\", \"\\u0627\\u0644\\u062c\\u0645\\u0647\\u0648\\u0631\\u064a\\u0629 \\u0627\\u0644\\u062c\\u0632\\u0627\\u0626\\u0631\\u064a\\u0629 \\u0627\\u0644\\u062f\\u064a\\u0645\\u0642\\u0631\\u0627\\u0637\\u064a\\u0629 \\u0627\\u0644\\u0634\\u0639\\u0628\\u064a\\u0629\", \"Ad-Dimuqratiyah ash-Sha'biyah\"]", "[\"Telegraph station\", \"Telegraph signaling\", \"Cable grams\", \"Telegraph office\", \"Telegraph\", \"Telegrams\", \"Cablegrams\", \"Telegraphic\", \"Teletypewriter message\", \"Telegraphy\", \"Telegraphic signal\", \"Telegraphed\", \"RealTelex\", \"Telegramme\", \"Telegraphic communications\", \"Telegrafy\", \"Telegraph signal\", \"Advantages of the telegraph\", \"Cable gram\", \"Telegraph signalling\", \"Telegraphically\", \"History of telegraphy\", \"Telegram\", \"Far writing\", \"Cablegram\"]", "[\"Radio Days\"]", "[\"La Republique francaise\", \"Franciaorsz\\u00e1g\", \"La Republique fran\\u00e7aise\", \"Belle France\", \"FRANCE\", \"Republique fran\\u00e7aise\", \"France\", \"Ranska\", \"Franciaorszag\", \"French Republic\", \"R\\u00e9publique francaise\", \"R\\u00e9publique fran\\u00e7aise\", \"ISO 3166-1:FR\", \"Frankreich\", \"France (country)\", \"Etymology of France\", \"FrancE\", \"La R\\u00e9publique fran\\u00e7aise\", \"People of France\", \"Republic of France\", \"Fracne\", \"Le France\", \"The French Republic\", \"Republique francaise\", \"The Republic of France\", \"La R\\u00e9publique francaise\", \"La France\", \"Rain in France\", \"Republic of france\", \"FRance\", \"Frakkland\", \"Climate of France\", \"Franse\"]", "[\"A SURGEON\", \"Saw bones\", \"General Surgeon\", \"D Surg\", \"Surgeons\", \"Chirurgeon\", \"Chief Surgeon\", \"Chiurgeon\", \"Sawboneses\", \"Doctor of Surgery\", \"Surgeon\", \"War surgeon\", \"Sawbone\"]", "[\"10 shillings and 6 pence\"]", "[\"ISO 3166-1:CL\", \"Cxilio\", \"Cile\", \"Etymology of Chile\", \"Republic of Chile\", \"Chilean Republic\", \"State of Chile\", \"Chile\", \"Name of Chile\", \"Rep\\u00fablica de Chile\", \"Chil\\u00e9\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Alice Sebold\", \"Alice Seybold\", \"ALICE SEBOLD\"]", "[\"Jahangir Khan\"]", "[\"Koningswater\", \"\\ud83d\\udf07\", \"\\ud83d\\udf06\", \"Aqua regis\", \"Nitrohydrochloric acid\", \"Aqua Regis\", \"Aqua regia\", \"Nitromuriate\", \"King's water\", \"Nitromuriatic acid\", \"Aqua Regia\", \"Royal water\"]", "[\"Twiner\", \"Scandent\", \"Trailing plants\", \"Creeping vines\", \"Climbing plant\", \"Climbing plants\", \"Vine\", \"Vines\", \"Viny\", \"Vine (botany)\", \"Climbing vines\", \"Climbing vine\", \"Twining plant\", \"CLIMBING PLANTS\", \"Creeper plant\", \"Trailing plant\"]", "[\"Hammer Horror\", \"Hammer film\", \"Hammer Productions\", \"Hammer Film Productions\", \"Hammer Film Productions Ltd.\", \"Hammer horror\", \"Hammer Studios\", \"Exclusive Films\", \"Hammer Films\", \"Hammer's House of Horror\"]", "[\"MICE\", \"Mice (disambiguation)\"]", "[\"one thousand, nine hundred and ninety-seven\", \"1997\"]", "[\"9\", \"nine\"]", "[\"Popular Democratic Republic of Algeria\", \"AlgeriA\", \"Name of Algeria\", \"Algerian People's Democratic Republic\", \"Al-Jumh\\u016br\\u012byah al-Jaz\\u0101\\u2019ir\\u012byah\", \"\\u0627\\u0644\\u062c\\u0632\\u0627\\u0626\\u0631\", \"Algeria country\", \"Algerie\", \"ISO 3166-1:DZ\", \"Algeria\", \"Algerian Peoples Democratic Republic\", \"Dzayer\", \"Administrative divisions of Algeria\", \"People\\u2019s Democratic Republic of Algeria\", \"People's Democratic Algerian Republic\", \"Ad-D\\u012bmuqr\\u0101\\u1e6d\\u012byah ash-Sha\\u2019b\\u012byah\", \"ALGERIA\", \"Subdivision of Algeria\", \"Al Jumhuriyah al Jaza'iriyah ad Dimuqratiyah ash Shabiyah\", \"Subdivisions of Algeria\", \"Alg\\u00e9rie\", \"Etymology of Algeria\", \"Algerian State\", \"R\\u00e9publique alg\\u00e9rienne d\\u00e9mocratique et populaire\", \"Republic of Algeria\", \"People's Republic of Algeria\", \"Algery\", \"Al-Jumhuriyah al-Jaza'iriyah\", \"People's Democratic Republic of Algeria\", \"\\u0627\\u0644\\u062c\\u0645\\u0647\\u0648\\u0631\\u064a\\u0629 \\u0627\\u0644\\u062c\\u0632\\u0627\\u0626\\u0631\\u064a\\u0629 \\u0627\\u0644\\u062f\\u064a\\u0645\\u0642\\u0631\\u0627\\u0637\\u064a\\u0629 \\u0627\\u0644\\u0634\\u0639\\u0628\\u064a\\u0629\", \"Ad-Dimuqratiyah ash-Sha'biyah\"]", "[\"Telegraph station\", \"Telegraph signaling\", \"Cable grams\", \"Telegraph office\", \"Telegraph\", \"Telegrams\", \"Cablegrams\", \"Telegraphic\", \"Teletypewriter message\", \"Telegraphy\", \"Telegraphic signal\", \"Telegraphed\", \"RealTelex\", \"Telegramme\", \"Telegraphic communications\", \"Telegrafy\", \"Telegraph signal\", \"Advantages of the telegraph\", \"Cable gram\", \"Telegraph signalling\", \"Telegraphically\", \"History of telegraphy\", \"Telegram\", \"Far writing\", \"Cablegram\"]", "[\"Radio Days\"]", "[\"La Republique francaise\", \"Franciaorsz\\u00e1g\", \"La Republique fran\\u00e7aise\", \"Belle France\", \"FRANCE\", \"Republique fran\\u00e7aise\", \"France\", \"Ranska\", \"Franciaorszag\", \"French Republic\", \"R\\u00e9publique francaise\", \"R\\u00e9publique fran\\u00e7aise\", \"ISO 3166-1:FR\", \"Frankreich\", \"France (country)\", \"Etymology of France\", \"FrancE\", \"La R\\u00e9publique fran\\u00e7aise\", \"People of France\", \"Republic of France\", \"Fracne\", \"Le France\", \"The French Republic\", \"Republique francaise\", \"The Republic of France\", \"La R\\u00e9publique francaise\", \"La France\", \"Rain in France\", \"Republic of france\", \"FRance\", \"Frakkland\", \"Climate of France\", \"Franse\"]", "[\"A SURGEON\", \"Saw bones\", \"General Surgeon\", \"D Surg\", \"Surgeons\", \"Chirurgeon\", \"Chief Surgeon\", \"Chiurgeon\", \"Sawboneses\", \"Doctor of Surgery\", \"Surgeon\", \"War surgeon\", \"Sawbone\"]", "[\"10 shillings and 6 pence\"]", "[\"ISO 3166-1:CL\", \"Cxilio\", \"Cile\", \"Etymology of Chile\", \"Republic of Chile\", \"Chilean Republic\", \"State of Chile\", \"Chile\", \"Name of Chile\", \"Rep\\u00fablica de Chile\", \"Chil\\u00e9\"]" ]
[ "\"Who wrote the novel \"\"Lovely Bones\"\"?\"", "Which squash player was unbeaten for over 150 consecutive matches between 1981 and 1986?", "Nitro-hydrochloric acid was traditionally called what?", "What type of plants are 'Scandents'?", "Which UK-based film company, founded in 1934, was best known for producing horror films between the mid 1950’s until the 1970’s?", "Murophobia is the abnormal fear of what?", "What year did England's lease on Hong Kong expire?", "What is the sum of the digits of the product of any number between 1 & 9 multiplied by 9?", "In which country was the fashion designer Yves St Laurent brn?", "Which daily newspaper has a column called 'Mandrake'?", "In which Woody Allen film do a pair of burglars answer the phone and become random contestants in a phone in quiz show", "The Statue of Liberty was a gift from which country?", "In Swift's 'Gullivers Travels', what is 'Gulliver's profession?", "In shillings and pence, how much did the Mad Hatter pay for his hat?", "Which country does tennis star Marcelo Rios represent" ]
15
[ 53385, 53386, 53387, 53388, 53389, 53390, 53391, 53392, 53393, 53394, 53395, 53396, 53397, 53398, 53399 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Amychophobia is the abnormal fear of being what?\nQuestion 2: Which group had a top ten hit in 1972 with All The Young Dudes\nQuestion 3: Which solo instrument features in the Largo from Dvorak's New World Symphony?\nQuestion 4: Which Italian city is served by Gallileo Galilei airport ?\nQuestion 5: Based on their geological formation, what type of mountains are the Alps?\nQuestion 6: How many laps does it take to take to complete the Indianapolis 500\nQuestion 7: Name the twin city to Minneapolis on the other side of the Mississippi.\nQuestion 8: The shortest Greenland-to-Iceland sea-crossing is about how many miles?\nQuestion 9: What is the US state capital of West Virginia?\nQuestion 10: Which honour was conferred by James II on John Dryden in 1630?\nQuestion 11: Name the Italian-born American film producer (of Death Wish, Barbarella, and Hannibal) who died in November 2010 age 91?\nQuestion 12: \"Which one of these characters is from the TV series \"\"ER\"\"?\"\nQuestion 13: What is the national flower of Switzerland?\nQuestion 14: Who was England's most married queen? She had four husbands.\nQuestion 15: What term is used to describe Western European architectural style for the period from the late 10th to the 12th century which was identifiably Medieval and prefigured the Gothic, yet maintained the rounded Roman arch?", "role": "user" } ]
["[\"Scratched or clawed\"]", "[\"Moot the hoople\", \"Alice, song, by Mott the Hoople\", \"Mott the Hoople\", \"Mott The Hoople\"]", "[\"English horn\", \"Cor Anglais\", \"Cor anglias\", \"English hornist\", \"EnHn\", \"Cor anglais (English horn)\", \"English Horn\", \"COR ANGLAIS\", \"Cor anglais\", \"Alto oboe\"]", "[\"Pisa tests\", \"Programme for International Student Assessment\", \"Program for International Student Assessment\", \"PISA\", \"Pisa test\", \"PISA (student assessment)\"]", "[\"Fold (disambiguation)\", \"Folding\", \"Folded\", \"Bifold\", \"Fold\", \"Foldings\", \"Folding (disambiguation)\"]", "[\"200\", \"two hundred\"]", "[\"St Paul, the Apostle\", \"Paul of Tarsos\", \"Saul of Tarsus\", \"St Paul the Apostle\", \"Paul of tarsus\", \"Saint Paul the Apostle\", \"Paul the Apostle\", \"ST PAUL\", \"Pauloftarsus\", \"Saul/Paul of Tarsus\", \"Saul Of Tarsus\", \"Apostel Paul\", \"The apostle Paul\", \"Apostle Paulus\", \"Paul the apostle\", \"Saint Paul of Tarsus\", \"Paul, Saint\", \"St. Paul the Apostle\", \"Saint Paul\", \"Saint Paul, the Apostle\", \"St. Paul of Tarsus\", \"Alexander the Coppersmith\", \"St Paul\", \"Missionary journeys of Paul\", \"Saul of tarsus\", \"The Apostle Paul\", \"Apostle Paul\", \"St. Paul, the Apostle\", \"Saint Paul (apostle)\", \"St.Pauls\", \"The Apostle, Saint Paul\", \"St. paul\", \"Saint paul\", \"Paul of Tarsus\", \"Alexander the coppersmith\", \"Paul of Tsarsis\", \"Saint Pauls\", \"Saint Paul's\", \"Paul (apostle)\", \"Paul, the Apostle\", \"St. Paul\"]", "[\"one hundred and eighty\", \"180\"]", "[\"Charleston\", \"Charleston (disambiguation)\", \"Charleston (Amtrak station)\", \"CharlestoN\", \"Charlston\"]", "[\"Poets Laureate\", \"Poet Laureate\", \"Court poet\", \"Poeta laureatus\", \"Court-poet\", \"Poet laureate\", \"Poets laureate\", \"Poet laureat\"]", "[\"Dino De Laurentiis\", \"Dino de Laurentis\", \"Dino De Laurentiis Company\", \"Dino De Laurentis\", \"Dino De Laurentiis Productions\", \"Dino DeLaurentis\", \"Dino DeLaurentiis\", \"Dino de Laurentiis\"]", "[\"Dr. Corday\", \"Dr. Elizabeth Corday\", \"Dr Elizabeth Corday\", \"Elizabeth Corday (ER)\", \"Elizabeth Corday\"]", "[\"Eidleweis\", \"Leontopodium alpinum\", \"Planika\", \"Edelwei\\u00df\", \"Edelweiss\", \"Eidelweiss\", \"Eidleweiss\", \"Lion's foot\", \"Eidlewise\"]", "[\"Katheryn Parre\", \"Queen Katherine Parr\", \"Kateryn Parre\", \"Katherine Parr\", \"Katharine Parr\", \"Catherine Parr\", \"Catherine Parre\", \"Lady Latimer\", \"Catherine Borough\", \"Katherine Borough\", \"Katheryn Parr\", \"Kateryn Parr\", \"Anthony Martienssen\", \"Katharine Parre\", \"Katherine Parre\", \"Queen Catherine Parr\", \"Lady Lattimer\"]", "[\"Romanesque\", \"ROMANESQUE\", \"Romanesque (disambiguation)\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Scratched or clawed\"]", "[\"Moot the hoople\", \"Alice, song, by Mott the Hoople\", \"Mott the Hoople\", \"Mott The Hoople\"]", "[\"English horn\", \"Cor Anglais\", \"Cor anglias\", \"English hornist\", \"EnHn\", \"Cor anglais (English horn)\", \"English Horn\", \"COR ANGLAIS\", \"Cor anglais\", \"Alto oboe\"]", "[\"Pisa tests\", \"Programme for International Student Assessment\", \"Program for International Student Assessment\", \"PISA\", \"Pisa test\", \"PISA (student assessment)\"]", "[\"Fold (disambiguation)\", \"Folding\", \"Folded\", \"Bifold\", \"Fold\", \"Foldings\", \"Folding (disambiguation)\"]", "[\"200\", \"two hundred\"]", "[\"St Paul, the Apostle\", \"Paul of Tarsos\", \"Saul of Tarsus\", \"St Paul the Apostle\", \"Paul of tarsus\", \"Saint Paul the Apostle\", \"Paul the Apostle\", \"ST PAUL\", \"Pauloftarsus\", \"Saul/Paul of Tarsus\", \"Saul Of Tarsus\", \"Apostel Paul\", \"The apostle Paul\", \"Apostle Paulus\", \"Paul the apostle\", \"Saint Paul of Tarsus\", \"Paul, Saint\", \"St. Paul the Apostle\", \"Saint Paul\", \"Saint Paul, the Apostle\", \"St. Paul of Tarsus\", \"Alexander the Coppersmith\", \"St Paul\", \"Missionary journeys of Paul\", \"Saul of tarsus\", \"The Apostle Paul\", \"Apostle Paul\", \"St. Paul, the Apostle\", \"Saint Paul (apostle)\", \"St.Pauls\", \"The Apostle, Saint Paul\", \"St. paul\", \"Saint paul\", \"Paul of Tarsus\", \"Alexander the coppersmith\", \"Paul of Tsarsis\", \"Saint Pauls\", \"Saint Paul's\", \"Paul (apostle)\", \"Paul, the Apostle\", \"St. Paul\"]", "[\"one hundred and eighty\", \"180\"]", "[\"Charleston\", \"Charleston (disambiguation)\", \"Charleston (Amtrak station)\", \"CharlestoN\", \"Charlston\"]", "[\"Poets Laureate\", \"Poet Laureate\", \"Court poet\", \"Poeta laureatus\", \"Court-poet\", \"Poet laureate\", \"Poets laureate\", \"Poet laureat\"]", "[\"Dino De Laurentiis\", \"Dino de Laurentis\", \"Dino De Laurentiis Company\", \"Dino De Laurentis\", \"Dino De Laurentiis Productions\", \"Dino DeLaurentis\", \"Dino DeLaurentiis\", \"Dino de Laurentiis\"]", "[\"Dr. Corday\", \"Dr. Elizabeth Corday\", \"Dr Elizabeth Corday\", \"Elizabeth Corday (ER)\", \"Elizabeth Corday\"]", "[\"Eidleweis\", \"Leontopodium alpinum\", \"Planika\", \"Edelwei\\u00df\", \"Edelweiss\", \"Eidelweiss\", \"Eidleweiss\", \"Lion's foot\", \"Eidlewise\"]", "[\"Katheryn Parre\", \"Queen Katherine Parr\", \"Kateryn Parre\", \"Katherine Parr\", \"Katharine Parr\", \"Catherine Parr\", \"Catherine Parre\", \"Lady Latimer\", \"Catherine Borough\", \"Katherine Borough\", \"Katheryn Parr\", \"Kateryn Parr\", \"Anthony Martienssen\", \"Katharine Parre\", \"Katherine Parre\", \"Queen Catherine Parr\", \"Lady Lattimer\"]", "[\"Romanesque\", \"ROMANESQUE\", \"Romanesque (disambiguation)\"]" ]
[ "Amychophobia is the abnormal fear of being what?", "Which group had a top ten hit in 1972 with All The Young Dudes", "Which solo instrument features in the Largo from Dvorak's New World Symphony?", "Which Italian city is served by Gallileo Galilei airport ?", "Based on their geological formation, what type of mountains are the Alps?", "How many laps does it take to take to complete the Indianapolis 500", "Name the twin city to Minneapolis on the other side of the Mississippi.", "The shortest Greenland-to-Iceland sea-crossing is about how many miles?", "What is the US state capital of West Virginia?", "Which honour was conferred by James II on John Dryden in 1630?", "Name the Italian-born American film producer (of Death Wish, Barbarella, and Hannibal) who died in November 2010 age 91?", "\"Which one of these characters is from the TV series \"\"ER\"\"?\"", "What is the national flower of Switzerland?", "Who was England's most married queen? She had four husbands.", "What term is used to describe Western European architectural style for the period from the late 10th to the 12th century which was identifiably Medieval and prefigured the Gothic, yet maintained the rounded Roman arch?" ]
15
[ 34065, 34066, 34067, 34068, 34069, 34070, 34071, 34072, 34073, 34074, 34075, 34076, 34077, 34078, 34079 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which vegetable has the Latin name Apium graveolens?\nQuestion 2: What is the green pigment found in most plants that is responsible for absorbing light energy?\nQuestion 3: The popular UK 2010s acronymic 'Towie' fashion/lifestyle derives from what?\nQuestion 4: Which of the Great Lakes is the only one located entirely in the United States of America?\nQuestion 5: In the film ‘Ben Hur’, what was the title character’s first name?\nQuestion 6: Natan Sharansky was released from prison in the USSR to begin a new life where?\nQuestion 7: Who was the New Zealander killed during a protest against the National front in London in 1979?\nQuestion 8: What is the name of the visit attraction in Bodelva, Cornwall, where biodomes house plants from around the world?\nQuestion 9: Cape Farewell is a headland which constitutes the southernmost part of which island?\nQuestion 10: Who is the author of the novel 'Girl with a Pearl Earring'?\nQuestion 11: Who was the first left handed golfer to win one of the four majors?\nQuestion 12: Where were the minerals 'Pyroxferroite', 'Armalcolite' and 'Tranquillityite' first discovered in 1969 and 1971?\nQuestion 13: Which US state was the title of a no. 1 hit for Pussycat in 1976?\nQuestion 14: \"The inhabitants of which Asian city call their city Krung Thep, \"\"the City of Angels\"\"?\"\nQuestion 15: \"Which historical event is illustrated by the Victorian painting \"\"And When Did You Last See Your Father\"\"?\"", "role": "user" } ]
["[\"Celery\", \"Smallage\", \"Celery seed\", \"Apium graveolens\", \"Apium graveolens dulce\", \"Celery (vegetable)\"]", "[\"C55H70O6N4Mg\", \"Chlorophyll\", \"Chorophyll\", \"C55H72O5N4Mg\", \"Chlorophyl\", \"Chlorophylls\", \"Chlorophyllose\", \"Chlorafil\", \"E140 (E number)\", \"Chlorophyllous\", \"C35H30O5N4Mg\", \"Leaf-green\", \"Clorophyl\", \"C54H70O6N4Mg\", \"Chlorophil\", \"Clorofill\", \"Leafgreen\", \"Cholorophyll\", \"Cholorophyl\", \"Leaf green\", \"C35H28O5N4Mg\"]", "[\"Samantha faiers\", \"Charlie Sims (The Only Way Is Essex)\", \"The Only Way is Essex\", \"Cara Kilbey\", \"Elliott Wright\", \"Lucy Mecklenburg\", \"Derbridge\", \"Lucy mecklenburgh\", \"Sam Falcone\", \"Jake Hall\", \"Danni Park-Dempsey\", \"Harry Derbridge\", \"Chloe Lewis (TOWIE)\", \"Darrell Privett\", \"Jack Bennewith\", \"Bennewith\", \"James %22Diags%22 Bennewith\", \"TOWIE\", \"Candy Jacobs\", \"Derbidge\", \"Lydia Rose Bright\", \"Mick Norcross\", \"Ricky Rayment\", \"Carol Wright (The Only Way is Essex)\", \"Thomas Pearce (The Only Way is Essex)\", \"The only way is Essex\", \"Dino Georgiades\", \"Patricia Brooker\", \"Harry Derbidge\", \"Danny Walia\", \"Chris Drake (The Only Way Is Essex)\", \"Danielle Armstrong\", \"Georgina Dorset\", \"James Lock (The Only Way Is Essex)\", \"Danni Park Dempsey\", \"Debbie Douglas (The Only Way Is Essex)\", \"The Only Way Is Essex\", \"Samantha Faiers\", \"The Only way is Essex\", \"James Bennewith\", \"Abi Clark\", \"Pat Brooker\", \"Charlie King (The Only Way Is Essex)\", \"Mucklow\", \"Wayne Lineker\", \"Craig Eastman (The Only Way Is Essex)\", \"Georgio Georgiades\", \"Jamie Reed (The Only Way is Essex)\", \"Lucy Olivia Mecklenburgh\", \"Frankie Essex\", \"Rami Hawash\", \"Charlie Knight\", \"Dan Edgar\"]", "[\"Lago M\\u00edchigan\", \"Michigan Lake\", \"History of Lake Michigan\", \"Michigan, Lake\", \"Lake michigan\", \"Lake Illinois\", \"Lake Michigan\", \"Lago Michigan\"]", "[\"Ioudas\", \"Y'huda\", \"Y'hudah\", \"Yehuda (disambiguation)\", \"Yehudoh\", \"Judah (disambiguation)\", \"Judah\", \"Yihuda\", \"Yehudah\", \"Yhudah\", \"Yehuda\", \"Yehudhah\", \"Yhuda\", \"Jehuda\", \"Yehudo\"]", "[\"\\u0130srail\", \"ISRAEL\", \"Israeli Republic\", \"Isr\\u00e6l\", \"Medinat Yisrael\", \"\\u05de\\u05b0\\u05d3\\u05b4\\u05d9\\u05e0\\u05b7\\u05ea \\u05d9\\u05b4\\u05e9\\u05b0\\u05c2\\u05e8\\u05b8\\u05d0\\u05b5\\u05dc\", \"Istrael\", \"Israeli (nation)\", \"ISO 3166-1:IL\", \"Medinat Israel\", \"Dawlat Isra'il\", \"State of israel\", \"Yisra\\u00e9l\", \"Isra'il\", \"Republic of Israel\", \"\\u062f\\u0648\\u0644\\u0629 \\u0625\\u0633\\u0631\\u0627\\u0626\\u064a\\u0644\", \"Israel\", \"Isra\\u00ebl\", \"Israelim\", \"Medinat Yisra'el\", \"\\u05d9\\u05e9\\u05e8\\u05d0\\u05dc\", \"State of Israel\", \"\\u05d9\\u05b4\\u05e9\\u05b0\\u05e8\\u05b8\\u05d0\\u05b5\\u05dc\", \"\\u05de\\u05d3\\u05d9\\u05e0\\u05ea \\u05d9\\u05e9\\u05e8\\u05d0\\u05dc\", \"Dawlat Isr\\u0101'\\u012bl\", \"Yisra'el\", \"Yisrael\", \"Israeli state\", \"The state of Israel\", \"Jewish Republic\", \"Israil\", \"Jewish Palestine\", \"Etymology of Israel\", \"Isreal\", \"Yisroel\", \"Israyl\", \"Israel (nation)\", \"Modern Israel\", \"Israelian\", \"Hebrew state\", \"M'dinat Yisrael\", \"Israe;\", \"Izrael (state)\", \"Isreael\", \"Isreali\", \"\\u05d9\\u05b4\\u05e9\\u05b0\\u05c2\\u05e8\\u05b8\\u05d0\\u05b5\\u05dc\", \"Med\\u012bnat Yisr\\u0101'el\", \"Yisroeil\", \"Israel (country)\"]", "[\"Southall race riots\", \"Southall riots\", \"Death of Blair Peach\", \"Blair Peach\"]", "[\"Eden Sessions\", \"Eden Project, Cornwall\", \"Eden Project\", \"The Eden Project\", \"Eden project\"]", "[\"Green Land\", \"Greenland Island\", \"Kalaallit Nunaat\", \"Social issues in Greenland\", \"GREENLAND\", \"Kangat Bay\", \"Greenlander\", \"Western Greenland\", \"Eastern Greenland\", \"Grinland\", \"Lupanlunti\", \"Kallaallit Nunaat\", \"Lupanglunti\", \"Greenlanders\", \"Sport in Greenland\", \"Climate of Greenland\", \"Antarctica of The North\", \"Greenland\", \"Name of Greenland\", \"Island of Greenland\", \"ISO 3166-1:GL\", \"Greenland (island)\"]", "[\"Tracy Chevalier\", \"TRACY CHEVALIER\", \"The Last Runaway\", \"Remarkable Creatures\", \"Tracy Chevalier FRSL\"]", "[\"Robert Charles (disambiguation)\", \"Bob Charles\"]", "[\"Moon (disambiguation)\", \"Moon (song)\", \"THE MOON\", \"Moon (album)\", \"MOON\"]", "[\"The Hospitality State\", \"Mississippi\", \"State symbols of Mississippi\", \"U.S. state of Mississippi\", \"Misisippi\", \"Twentieth State\", \"Mississippi, United States\", \"Magnolia State\", \"Mississippi (U.S. state)\", \"Missisipi\", \"Mississipi\", \"Mississippi (State)\", \"Misisipi\", \"US-MS\", \"State of Mississippi\", \"Economy of Mississippi\", \"Demographics of Mississippi\", \"Missisippi\", \"Culture of Mississippi\", \"Religion in Mississippi\", \"Symbols of the State of Mississippi\", \"Geography of Mississippi\", \"Misssissippi\", \"Mississippi (state)\", \"Transportation in Mississippi\", \"Misissipi\", \"Transport in Mississippi\", \"20th State\", \"The Magnolia State\", \"Sports in Mississippi\", \"Misissippi\", \"Climate of Mississippi\"]", "[\"Krung-devamahanagara amararatanakosindra mahindrayudhya mahatilakabhava navaratanarajadhani puriramasya utamarajanivesana mahasthana amaravimana avatarasthitya shakrasdattiya vishnukarmaprasiddhi\", \"Capital of Thailand\", \"Bangkok Bus\", \"Bangkok Special Governed District\", \"Bangkok Province\", \"KrungThepMahaNakhon\", \"Krung Thep Municipality, Thailand\", \"Bangkok province\", \"Bangkock\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharn\", \"Bangkok/weatherbox\", \"Krungthep Mahanakhon Amonrattanakosin Mahintharayutthaya Mahadilokphop Noppharatratchathani Burirom-udomratchaniwet Mahasathan Amonphiman Awatansathit Sakkathattiya Witsanu Kamprasit\", \"Bangkok, Thailand\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop nopparatrajathaniburiromudomrajaniwesmahasatharn amornphimarnavatarnsathitsakkattiyavisanukamprasit\", \"Bangkok\", \"UN/LOCODE:THBKK\", \"Krung Thep Mahanakhon Province, Thailand\", \"Krung Thep municipality, Thailand\", \"\\u0e01\\u0e23\\u0e38\\u0e07\\u0e40\\u0e17\\u0e1e\\u0e21\\u0e2b\\u0e32\\u0e19\\u0e04\\u0e23\", \"Krung Thep Mahanakhon Amon Rattanakosin Mahinthara Ayuthaya Mahadilok Phop Noppharat Ratchathani Burirom Udomratchaniwet Mahasathan Amon Piman Awatan Sathit Sakkathattiya Witsanukam Prasit\", \"Krungthepmahanakhon Amonrattanakosin Mahintharayutthaya Mahadilokphop Noppharatratchathaniburirom Udomratchaniwetmahasathan Amonphimanawatansathit Sakkathattiyawitsanukamprasit\", \"Krung Thep Maha Nakhon\", \"Culture of Bangkok\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimar- navatarnsathitsakkattiyavisanukamprasit\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit\", \"Bangcock\", \"Buses in bangkok\", \"Krung thep mahanakhon bovorn ratanakosin mahintharayutthaya mahadilok pop noparatratchathani burirom udomratchanivetmahasathan amornpiman avatarnsathit sakkathattiyavisnukarmprasit\", \"Krung-d\\u0113vamah\\u0101nagara amararatanakosindra mahindrayudhy\\u0101 mah\\u0101tilakabhava navaratanar\\u0101jadh\\u0101n\\u012b pur\\u012br\\u0101masya utamar\\u0101janiv\\u0113sana mah\\u0101sth\\u0101na amaravim\\u0101na avat\\u0101rasthitya shakrasdattiya vishnukarmaprasiddhi\", \"Krungthep mahanakhon amon rattanakosin mahintara ayuthaya mahadilok popnopparat ratchathani burirom udomratchaniwet mahasathan amonpiman avatansathit sakkathattiya visnukamprasit\", \"Krung Thep Mahanakhon Amon Rattanakosin Mahinthara Yuthaya Mahadilok Phop Noppharat Ratchathani Burirom Udomratchaniwet Mahasathan Amon Piman Awatan Sathit Sakkathattiya Witsanukam Prasit\", \"Krung Thep municipality\", \"Bankok\", \"Bang Makok\", \"Krungthepmahanakornamornratanakosinmahintarayutth...\", \"Krung Thep Maha Nakhon Amon Rattanakosin Mahinthara Ayutthaya Mahadilok Phop Noppharat Ratchathani Burirom Udom Ratchaniwet Mahasathan Amon Phiman Awatan Sathit Sakkathattiya Witsanu Kamprasit\"]", "[\"War of Three Nations\", \"The english civil war\", \"English Civil war\", \"English Civil War\", \"Wars of the English Revolution\", \"Civil war in England\", \"Puritan revolution\", \"Civil War (England)\", \"Puritan Revolution\", \"English civil war\", \"War of the English Revolution\", \"THE ENGLISH CIVIL WAR\", \"British civil war\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Celery\", \"Smallage\", \"Celery seed\", \"Apium graveolens\", \"Apium graveolens dulce\", \"Celery (vegetable)\"]", "[\"C55H70O6N4Mg\", \"Chlorophyll\", \"Chorophyll\", \"C55H72O5N4Mg\", \"Chlorophyl\", \"Chlorophylls\", \"Chlorophyllose\", \"Chlorafil\", \"E140 (E number)\", \"Chlorophyllous\", \"C35H30O5N4Mg\", \"Leaf-green\", \"Clorophyl\", \"C54H70O6N4Mg\", \"Chlorophil\", \"Clorofill\", \"Leafgreen\", \"Cholorophyll\", \"Cholorophyl\", \"Leaf green\", \"C35H28O5N4Mg\"]", "[\"Samantha faiers\", \"Charlie Sims (The Only Way Is Essex)\", \"The Only Way is Essex\", \"Cara Kilbey\", \"Elliott Wright\", \"Lucy Mecklenburg\", \"Derbridge\", \"Lucy mecklenburgh\", \"Sam Falcone\", \"Jake Hall\", \"Danni Park-Dempsey\", \"Harry Derbridge\", \"Chloe Lewis (TOWIE)\", \"Darrell Privett\", \"Jack Bennewith\", \"Bennewith\", \"James %22Diags%22 Bennewith\", \"TOWIE\", \"Candy Jacobs\", \"Derbidge\", \"Lydia Rose Bright\", \"Mick Norcross\", \"Ricky Rayment\", \"Carol Wright (The Only Way is Essex)\", \"Thomas Pearce (The Only Way is Essex)\", \"The only way is Essex\", \"Dino Georgiades\", \"Patricia Brooker\", \"Harry Derbidge\", \"Danny Walia\", \"Chris Drake (The Only Way Is Essex)\", \"Danielle Armstrong\", \"Georgina Dorset\", \"James Lock (The Only Way Is Essex)\", \"Danni Park Dempsey\", \"Debbie Douglas (The Only Way Is Essex)\", \"The Only Way Is Essex\", \"Samantha Faiers\", \"The Only way is Essex\", \"James Bennewith\", \"Abi Clark\", \"Pat Brooker\", \"Charlie King (The Only Way Is Essex)\", \"Mucklow\", \"Wayne Lineker\", \"Craig Eastman (The Only Way Is Essex)\", \"Georgio Georgiades\", \"Jamie Reed (The Only Way is Essex)\", \"Lucy Olivia Mecklenburgh\", \"Frankie Essex\", \"Rami Hawash\", \"Charlie Knight\", \"Dan Edgar\"]", "[\"Lago M\\u00edchigan\", \"Michigan Lake\", \"History of Lake Michigan\", \"Michigan, Lake\", \"Lake michigan\", \"Lake Illinois\", \"Lake Michigan\", \"Lago Michigan\"]", "[\"Ioudas\", \"Y'huda\", \"Y'hudah\", \"Yehuda (disambiguation)\", \"Yehudoh\", \"Judah (disambiguation)\", \"Judah\", \"Yihuda\", \"Yehudah\", \"Yhudah\", \"Yehuda\", \"Yehudhah\", \"Yhuda\", \"Jehuda\", \"Yehudo\"]", "[\"\\u0130srail\", \"ISRAEL\", \"Israeli Republic\", \"Isr\\u00e6l\", \"Medinat Yisrael\", \"\\u05de\\u05b0\\u05d3\\u05b4\\u05d9\\u05e0\\u05b7\\u05ea \\u05d9\\u05b4\\u05e9\\u05b0\\u05c2\\u05e8\\u05b8\\u05d0\\u05b5\\u05dc\", \"Istrael\", \"Israeli (nation)\", \"ISO 3166-1:IL\", \"Medinat Israel\", \"Dawlat Isra'il\", \"State of israel\", \"Yisra\\u00e9l\", \"Isra'il\", \"Republic of Israel\", \"\\u062f\\u0648\\u0644\\u0629 \\u0625\\u0633\\u0631\\u0627\\u0626\\u064a\\u0644\", \"Israel\", \"Isra\\u00ebl\", \"Israelim\", \"Medinat Yisra'el\", \"\\u05d9\\u05e9\\u05e8\\u05d0\\u05dc\", \"State of Israel\", \"\\u05d9\\u05b4\\u05e9\\u05b0\\u05e8\\u05b8\\u05d0\\u05b5\\u05dc\", \"\\u05de\\u05d3\\u05d9\\u05e0\\u05ea \\u05d9\\u05e9\\u05e8\\u05d0\\u05dc\", \"Dawlat Isr\\u0101'\\u012bl\", \"Yisra'el\", \"Yisrael\", \"Israeli state\", \"The state of Israel\", \"Jewish Republic\", \"Israil\", \"Jewish Palestine\", \"Etymology of Israel\", \"Isreal\", \"Yisroel\", \"Israyl\", \"Israel (nation)\", \"Modern Israel\", \"Israelian\", \"Hebrew state\", \"M'dinat Yisrael\", \"Israe;\", \"Izrael (state)\", \"Isreael\", \"Isreali\", \"\\u05d9\\u05b4\\u05e9\\u05b0\\u05c2\\u05e8\\u05b8\\u05d0\\u05b5\\u05dc\", \"Med\\u012bnat Yisr\\u0101'el\", \"Yisroeil\", \"Israel (country)\"]", "[\"Southall race riots\", \"Southall riots\", \"Death of Blair Peach\", \"Blair Peach\"]", "[\"Eden Sessions\", \"Eden Project, Cornwall\", \"Eden Project\", \"The Eden Project\", \"Eden project\"]", "[\"Green Land\", \"Greenland Island\", \"Kalaallit Nunaat\", \"Social issues in Greenland\", \"GREENLAND\", \"Kangat Bay\", \"Greenlander\", \"Western Greenland\", \"Eastern Greenland\", \"Grinland\", \"Lupanlunti\", \"Kallaallit Nunaat\", \"Lupanglunti\", \"Greenlanders\", \"Sport in Greenland\", \"Climate of Greenland\", \"Antarctica of The North\", \"Greenland\", \"Name of Greenland\", \"Island of Greenland\", \"ISO 3166-1:GL\", \"Greenland (island)\"]", "[\"Tracy Chevalier\", \"TRACY CHEVALIER\", \"The Last Runaway\", \"Remarkable Creatures\", \"Tracy Chevalier FRSL\"]", "[\"Robert Charles (disambiguation)\", \"Bob Charles\"]", "[\"Moon (disambiguation)\", \"Moon (song)\", \"THE MOON\", \"Moon (album)\", \"MOON\"]", "[\"The Hospitality State\", \"Mississippi\", \"State symbols of Mississippi\", \"U.S. state of Mississippi\", \"Misisippi\", \"Twentieth State\", \"Mississippi, United States\", \"Magnolia State\", \"Mississippi (U.S. state)\", \"Missisipi\", \"Mississipi\", \"Mississippi (State)\", \"Misisipi\", \"US-MS\", \"State of Mississippi\", \"Economy of Mississippi\", \"Demographics of Mississippi\", \"Missisippi\", \"Culture of Mississippi\", \"Religion in Mississippi\", \"Symbols of the State of Mississippi\", \"Geography of Mississippi\", \"Misssissippi\", \"Mississippi (state)\", \"Transportation in Mississippi\", \"Misissipi\", \"Transport in Mississippi\", \"20th State\", \"The Magnolia State\", \"Sports in Mississippi\", \"Misissippi\", \"Climate of Mississippi\"]", "[\"Krung-devamahanagara amararatanakosindra mahindrayudhya mahatilakabhava navaratanarajadhani puriramasya utamarajanivesana mahasthana amaravimana avatarasthitya shakrasdattiya vishnukarmaprasiddhi\", \"Capital of Thailand\", \"Bangkok Bus\", \"Bangkok Special Governed District\", \"Bangkok Province\", \"KrungThepMahaNakhon\", \"Krung Thep Municipality, Thailand\", \"Bangkok province\", \"Bangkock\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharn\", \"Bangkok/weatherbox\", \"Krungthep Mahanakhon Amonrattanakosin Mahintharayutthaya Mahadilokphop Noppharatratchathani Burirom-udomratchaniwet Mahasathan Amonphiman Awatansathit Sakkathattiya Witsanu Kamprasit\", \"Bangkok, Thailand\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop nopparatrajathaniburiromudomrajaniwesmahasatharn amornphimarnavatarnsathitsakkattiyavisanukamprasit\", \"Bangkok\", \"UN/LOCODE:THBKK\", \"Krung Thep Mahanakhon Province, Thailand\", \"Krung Thep municipality, Thailand\", \"\\u0e01\\u0e23\\u0e38\\u0e07\\u0e40\\u0e17\\u0e1e\\u0e21\\u0e2b\\u0e32\\u0e19\\u0e04\\u0e23\", \"Krung Thep Mahanakhon Amon Rattanakosin Mahinthara Ayuthaya Mahadilok Phop Noppharat Ratchathani Burirom Udomratchaniwet Mahasathan Amon Piman Awatan Sathit Sakkathattiya Witsanukam Prasit\", \"Krungthepmahanakhon Amonrattanakosin Mahintharayutthaya Mahadilokphop Noppharatratchathaniburirom Udomratchaniwetmahasathan Amonphimanawatansathit Sakkathattiyawitsanukamprasit\", \"Krung Thep Maha Nakhon\", \"Culture of Bangkok\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimar- navatarnsathitsakkattiyavisanukamprasit\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit\", \"Bangcock\", \"Buses in bangkok\", \"Krung thep mahanakhon bovorn ratanakosin mahintharayutthaya mahadilok pop noparatratchathani burirom udomratchanivetmahasathan amornpiman avatarnsathit sakkathattiyavisnukarmprasit\", \"Krung-d\\u0113vamah\\u0101nagara amararatanakosindra mahindrayudhy\\u0101 mah\\u0101tilakabhava navaratanar\\u0101jadh\\u0101n\\u012b pur\\u012br\\u0101masya utamar\\u0101janiv\\u0113sana mah\\u0101sth\\u0101na amaravim\\u0101na avat\\u0101rasthitya shakrasdattiya vishnukarmaprasiddhi\", \"Krungthep mahanakhon amon rattanakosin mahintara ayuthaya mahadilok popnopparat ratchathani burirom udomratchaniwet mahasathan amonpiman avatansathit sakkathattiya visnukamprasit\", \"Krung Thep Mahanakhon Amon Rattanakosin Mahinthara Yuthaya Mahadilok Phop Noppharat Ratchathani Burirom Udomratchaniwet Mahasathan Amon Piman Awatan Sathit Sakkathattiya Witsanukam Prasit\", \"Krung Thep municipality\", \"Bankok\", \"Bang Makok\", \"Krungthepmahanakornamornratanakosinmahintarayutth...\", \"Krung Thep Maha Nakhon Amon Rattanakosin Mahinthara Ayutthaya Mahadilok Phop Noppharat Ratchathani Burirom Udom Ratchaniwet Mahasathan Amon Phiman Awatan Sathit Sakkathattiya Witsanu Kamprasit\"]", "[\"War of Three Nations\", \"The english civil war\", \"English Civil war\", \"English Civil War\", \"Wars of the English Revolution\", \"Civil war in England\", \"Puritan revolution\", \"Civil War (England)\", \"Puritan Revolution\", \"English civil war\", \"War of the English Revolution\", \"THE ENGLISH CIVIL WAR\", \"British civil war\"]" ]
[ "Which vegetable has the Latin name Apium graveolens?", "What is the green pigment found in most plants that is responsible for absorbing light energy?", "The popular UK 2010s acronymic 'Towie' fashion/lifestyle derives from what?", "Which of the Great Lakes is the only one located entirely in the United States of America?", "In the film ‘Ben Hur’, what was the title character’s first name?", "Natan Sharansky was released from prison in the USSR to begin a new life where?", "Who was the New Zealander killed during a protest against the National front in London in 1979?", "What is the name of the visit attraction in Bodelva, Cornwall, where biodomes house plants from around the world?", "Cape Farewell is a headland which constitutes the southernmost part of which island?", "Who is the author of the novel 'Girl with a Pearl Earring'?", "Who was the first left handed golfer to win one of the four majors?", "Where were the minerals 'Pyroxferroite', 'Armalcolite' and 'Tranquillityite' first discovered in 1969 and 1971?", "Which US state was the title of a no. 1 hit for Pussycat in 1976?", "\"The inhabitants of which Asian city call their city Krung Thep, \"\"the City of Angels\"\"?\"", "\"Which historical event is illustrated by the Victorian painting \"\"And When Did You Last See Your Father\"\"?\"" ]
15
[ 84825, 84826, 84827, 84828, 84829, 84830, 84831, 84832, 84833, 84834, 84835, 84836, 84837, 84838, 84839 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which band returned to the top of the charts in 1999 with 'Maria', more than 18 years after their previous chart-topper, 'The Tide is High'?\nQuestion 2: What is the gamekeeper's name in D H Lawrence's 1928 novel Lady Chatterley's Lover?\nQuestion 3: In which ocean are the Canary Islands\nQuestion 4: Which Austrian Formula One racing driver was killed while qualifying for the 1994 San Marino Grand Prix?\nQuestion 5: The Spectre organisation first featured in which James Bond film?\nQuestion 6: Which is North America's largest desert?\nQuestion 7: Which hard ring-shaped bread product takes its name from the Old German for 'bracelet'?\nQuestion 8: What would Del boy expect to get if he ordered a Ruby Murray\nQuestion 9: Which US President was given the nickname ‘The Great Emancipator’?\nQuestion 10: Drakes ship the Golden Hind(e) was originally called what?\nQuestion 11: What was the name of Butch Cassidy's gang?\nQuestion 12: Which sea is part of the Arctic Ocean north of Siberia, bounded on the west by Novaya Zemlya and to the east by the Severnaya Zemlya?\nQuestion 13: Guadalupe Island, in the Pacific Ocean, belongs to which country?\nQuestion 14: Whose 'Symphony No.8' is known as the 'Symphony of a Thousand'?\nQuestion 15: In the the tv cartoon series ‘The Simpsons’ what is Grandpa Simpson’s first name?", "role": "user" } ]
["[\"BLONDIE\", \"Blondie (disambiguation)\", \"Blondie\", \"Blondie (movie)\", \"Blondie (TV series)\", \"Blondie (film)\"]", "[\"Mellors\"]", "[\"Sea of Atlas\", \"The Pond\", \"Ethiopic Ocean\", \"Across the pond\", \"North Atlantic\", \"The Atlantic Ocean\", \"North Atlantic ocean\", \"Northern Atlantic\", \"Altantic Ocean\", \"Atlantis Thalassa\", \"Atlantic basic\", \"The pond\", \"Atlantic basin\", \"Atlantic\", \"Atlantic Oceans\", \"Occidental Ocean\", \"Ethiopian Ocean\", \"North Atlantic fisheries\", \"Atlantic Basic\", \"North-East Atlantic\", \"Atlantic Basin\", \"Atlantic ocean\", \"Atlantic (ocean)\", \"Antlantic Ocean\", \"South Atlantic Ocean\", \"Oceanvs Occidentalis\", \"Atlantic Ocean\", \"Central Atlantic\", \"South Atlantic\", \"East Atlantic\", \"North Atlantic Ocean\", \"Altantic ocean\", \"Atlantic coast\"]", "[\"Death of Roland Ratzenberger\", \"Roland Ratzenburger\", \"Roland Ratzenberger\"]", "[\"James Bond/Dr. No\", \"Dr. No (disambiguation)\", \"Dr. No\", \"Dr no\", \"Doctor No\", \"Dr.No\", \"Dr No\"]", "[\"Sonoran\", \"Sonoran Basin and Range (ecoregion)\", \"Sonoran desert\", \"Sonora Desert\", \"Gila Desert\", \"Sonora desert\", \"Arizona desert\", \"Sonoran Desert\"]", "[\"New York bagel\", \"American bagel\", \"Biegel\", \"BAGEL\", \"Bagels\", \"Beygl\", \"\\u201ceverything\\u201d bagel\", \"Bagel\", \"New York-style bagel\", \"Water bagel\", \"%22Everything%22 Bagel\", \"Everything bagel\", \"Salt bagel\", \"BAGELS\", \"%22everything%22 bagel\", \"Beigel\", \"Bagles\", \"New York style bagel\", \"Everything Bagel\"]", "[\"Chinese chicken curry\", \"Goat curry\", \"Curry of Pakistan\", \"Curries\", \"Sabji\", \"Korean curry\", \"Balti curry\", \"Bengali curries\", \"Oriya curries\", \"Northeast Indian and Nepalese curries\", \"Malay curry\", \"Bangladeshi curries\", \"Kaeng kari\", \"Curries of the Maldives\", \"Curries of Oriya\", \"Curries of Bangladeshi\", \"Curries of Nepal\", \"Curry (food)\", \"Indian curry\", \"Curries of Pakistan\", \"Curries of Balochistan\", \"Curries of Bengali\", \"Curry (dish)\", \"British curry house\", \"Tiyula Itum\", \"Luke Dundon\", \"Balti curries\", \"Curry\", \"Bhuna\", \"Pakistani curry\", \"Curry in Great Britain\", \"Curries of the Philippines\", \"Curries of Northeast India\", \"West Indies curries\", \"British curry house terminology\", \"Pakistani curries\"]", "[\"Abaraham lincoln\", \"Abe licnoln\", \"President Lincoln\", \"Abe Lincon\", \"A Lincoln\", \"Lincoln (president)\", \"President Abraham\", \"President Abraham Lincoln\", \"Abraham (president)\", \"The Rail Splitter\", \"Abe Lincoln\", \"Honest Abe\", \"Lincoln's cabinet\", \"Lincoln, Abraham\", \"Abraham Lincon\", \"Abraham Lincoln\", \"Abraham Lincoln and the American Civil War\", \"Great Emancipator\", \"Aberham lincoln\", \"Abraham Lincoln (president)\", \"Lincolnian\", \"President Abe Lincoln\", \"Honest Abe Lincoln\", \"Abraham lincoln\", \"A. Lincoln\", \"Presedent Lincon\", \"Abrahm Lincoln\", \"Abraham Lincoln's Life\", \"Abe lincolin\", \"Abaham lincoln\", \"The Great Emancipator\", \"16th President of the United States\"]", "[\"The Pelican\", \"Pelican (disambiguation)\", \"French ship P\\u00e9lican\"]", "[\"Hole in the Wall gang\", \"Hole in the Wall Gang\", \"Hole in the wall gang\", \"The Hole-in-the-Wall Gang\", \"The Hole in the Wall Gang\", \"The Hole In The Wall Gang\"]", "[\"Kara Sea\", \"Karskoe More\", \"South Kara Sea\", \"North Kara Sea\"]", "[\"Mexican Republic\", \"MEXICO\", \"Estados Unidos de M\\u00e9xico\", \"Sierra de la Estrella\", \"Mexico (country)\", \"Mexic\\u00f3\", \"The United Mexican States\", \"Estados Unidos de Mexico\", \"Central Mexico\", \"ISO 3166-1:MX\", \"Mexiko\", \"M\\u00e9jico\", \"Mexique\", \"Mexican United States\", \"Mexican'\", \"The United State of Mexico\", \"Mountains of Mexico\", \"Old Mexico\", \"United states of mexico\", \"EUM\", \"Messico\", \"Mejico\", \"The United States of Mexicans\", \"Untied Mexican States\", \"M\\u00e9xico\", \"Etymology of Mexico\", \"Meixcan\", \"Estados Unidos Mexicanos\", \"Mexic\", \"Mexxico\", \"Mexican Union\", \"The United States of Mexico\", \"United State of Mexico\", \"Mexico\", \"Republic of Mexico\", \"Mexican Federal Republic\", \"United Mexican States\", \"Mexican coast\", \"Mehico\", \"United States of Mexicans\", \"United States of Mexico\"]", "[\"Gustav Mahler\", \"Mahler, Gustav\", \"Gustave Mahler\", \"Gustav mahler\", \"MAHLER\", \"Gus Mahler\", \"Mahler symphonies\", \"Mahlerian\", \"Mahler\"]", "[\"Abraham/Proposed Chronology Edits\", \"Ibraaheem\", \"\\u2019Abhr\\u0101h\\u0101m\", \"Abhram\", \"Abhraham\", \"Ibrahim\", \"Plains of Isaac\", \"\\u02bcAbr\\u0259ham\", \"Abiraham\", \"Abraham (Hebrew Bible)\", \"Ibulaxin\", \"\\u05d0\\u05b7\\u05d1\\u05b0\\u05e8\\u05b8\\u05d4\\u05b8\\u05dd\", \"Abraham and Sarah\", \"Seed of Abraham\", \"Avram\", \"Abraham\", \"Abram\", \"\\u0130brahim\", \"Avraham\", \"\\u0625\\u0628\\u0631\\u0627\\u0647\\u064a\\u0645\", \"\\u02bcA\\u1e07r\\u0101h\\u0101m\", \"Avrohom\", \"Patriarch Abraham\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"BLONDIE\", \"Blondie (disambiguation)\", \"Blondie\", \"Blondie (movie)\", \"Blondie (TV series)\", \"Blondie (film)\"]", "[\"Mellors\"]", "[\"Sea of Atlas\", \"The Pond\", \"Ethiopic Ocean\", \"Across the pond\", \"North Atlantic\", \"The Atlantic Ocean\", \"North Atlantic ocean\", \"Northern Atlantic\", \"Altantic Ocean\", \"Atlantis Thalassa\", \"Atlantic basic\", \"The pond\", \"Atlantic basin\", \"Atlantic\", \"Atlantic Oceans\", \"Occidental Ocean\", \"Ethiopian Ocean\", \"North Atlantic fisheries\", \"Atlantic Basic\", \"North-East Atlantic\", \"Atlantic Basin\", \"Atlantic ocean\", \"Atlantic (ocean)\", \"Antlantic Ocean\", \"South Atlantic Ocean\", \"Oceanvs Occidentalis\", \"Atlantic Ocean\", \"Central Atlantic\", \"South Atlantic\", \"East Atlantic\", \"North Atlantic Ocean\", \"Altantic ocean\", \"Atlantic coast\"]", "[\"Death of Roland Ratzenberger\", \"Roland Ratzenburger\", \"Roland Ratzenberger\"]", "[\"James Bond/Dr. No\", \"Dr. No (disambiguation)\", \"Dr. No\", \"Dr no\", \"Doctor No\", \"Dr.No\", \"Dr No\"]", "[\"Sonoran\", \"Sonoran Basin and Range (ecoregion)\", \"Sonoran desert\", \"Sonora Desert\", \"Gila Desert\", \"Sonora desert\", \"Arizona desert\", \"Sonoran Desert\"]", "[\"New York bagel\", \"American bagel\", \"Biegel\", \"BAGEL\", \"Bagels\", \"Beygl\", \"\\u201ceverything\\u201d bagel\", \"Bagel\", \"New York-style bagel\", \"Water bagel\", \"%22Everything%22 Bagel\", \"Everything bagel\", \"Salt bagel\", \"BAGELS\", \"%22everything%22 bagel\", \"Beigel\", \"Bagles\", \"New York style bagel\", \"Everything Bagel\"]", "[\"Chinese chicken curry\", \"Goat curry\", \"Curry of Pakistan\", \"Curries\", \"Sabji\", \"Korean curry\", \"Balti curry\", \"Bengali curries\", \"Oriya curries\", \"Northeast Indian and Nepalese curries\", \"Malay curry\", \"Bangladeshi curries\", \"Kaeng kari\", \"Curries of the Maldives\", \"Curries of Oriya\", \"Curries of Bangladeshi\", \"Curries of Nepal\", \"Curry (food)\", \"Indian curry\", \"Curries of Pakistan\", \"Curries of Balochistan\", \"Curries of Bengali\", \"Curry (dish)\", \"British curry house\", \"Tiyula Itum\", \"Luke Dundon\", \"Balti curries\", \"Curry\", \"Bhuna\", \"Pakistani curry\", \"Curry in Great Britain\", \"Curries of the Philippines\", \"Curries of Northeast India\", \"West Indies curries\", \"British curry house terminology\", \"Pakistani curries\"]", "[\"Abaraham lincoln\", \"Abe licnoln\", \"President Lincoln\", \"Abe Lincon\", \"A Lincoln\", \"Lincoln (president)\", \"President Abraham\", \"President Abraham Lincoln\", \"Abraham (president)\", \"The Rail Splitter\", \"Abe Lincoln\", \"Honest Abe\", \"Lincoln's cabinet\", \"Lincoln, Abraham\", \"Abraham Lincon\", \"Abraham Lincoln\", \"Abraham Lincoln and the American Civil War\", \"Great Emancipator\", \"Aberham lincoln\", \"Abraham Lincoln (president)\", \"Lincolnian\", \"President Abe Lincoln\", \"Honest Abe Lincoln\", \"Abraham lincoln\", \"A. Lincoln\", \"Presedent Lincon\", \"Abrahm Lincoln\", \"Abraham Lincoln's Life\", \"Abe lincolin\", \"Abaham lincoln\", \"The Great Emancipator\", \"16th President of the United States\"]", "[\"The Pelican\", \"Pelican (disambiguation)\", \"French ship P\\u00e9lican\"]", "[\"Hole in the Wall gang\", \"Hole in the Wall Gang\", \"Hole in the wall gang\", \"The Hole-in-the-Wall Gang\", \"The Hole in the Wall Gang\", \"The Hole In The Wall Gang\"]", "[\"Kara Sea\", \"Karskoe More\", \"South Kara Sea\", \"North Kara Sea\"]", "[\"Mexican Republic\", \"MEXICO\", \"Estados Unidos de M\\u00e9xico\", \"Sierra de la Estrella\", \"Mexico (country)\", \"Mexic\\u00f3\", \"The United Mexican States\", \"Estados Unidos de Mexico\", \"Central Mexico\", \"ISO 3166-1:MX\", \"Mexiko\", \"M\\u00e9jico\", \"Mexique\", \"Mexican United States\", \"Mexican'\", \"The United State of Mexico\", \"Mountains of Mexico\", \"Old Mexico\", \"United states of mexico\", \"EUM\", \"Messico\", \"Mejico\", \"The United States of Mexicans\", \"Untied Mexican States\", \"M\\u00e9xico\", \"Etymology of Mexico\", \"Meixcan\", \"Estados Unidos Mexicanos\", \"Mexic\", \"Mexxico\", \"Mexican Union\", \"The United States of Mexico\", \"United State of Mexico\", \"Mexico\", \"Republic of Mexico\", \"Mexican Federal Republic\", \"United Mexican States\", \"Mexican coast\", \"Mehico\", \"United States of Mexicans\", \"United States of Mexico\"]", "[\"Gustav Mahler\", \"Mahler, Gustav\", \"Gustave Mahler\", \"Gustav mahler\", \"MAHLER\", \"Gus Mahler\", \"Mahler symphonies\", \"Mahlerian\", \"Mahler\"]", "[\"Abraham/Proposed Chronology Edits\", \"Ibraaheem\", \"\\u2019Abhr\\u0101h\\u0101m\", \"Abhram\", \"Abhraham\", \"Ibrahim\", \"Plains of Isaac\", \"\\u02bcAbr\\u0259ham\", \"Abiraham\", \"Abraham (Hebrew Bible)\", \"Ibulaxin\", \"\\u05d0\\u05b7\\u05d1\\u05b0\\u05e8\\u05b8\\u05d4\\u05b8\\u05dd\", \"Abraham and Sarah\", \"Seed of Abraham\", \"Avram\", \"Abraham\", \"Abram\", \"\\u0130brahim\", \"Avraham\", \"\\u0625\\u0628\\u0631\\u0627\\u0647\\u064a\\u0645\", \"\\u02bcA\\u1e07r\\u0101h\\u0101m\", \"Avrohom\", \"Patriarch Abraham\"]" ]
[ "Which band returned to the top of the charts in 1999 with 'Maria', more than 18 years after their previous chart-topper, 'The Tide is High'?", "What is the gamekeeper's name in D H Lawrence's 1928 novel Lady Chatterley's Lover?", "In which ocean are the Canary Islands", "Which Austrian Formula One racing driver was killed while qualifying for the 1994 San Marino Grand Prix?", "The Spectre organisation first featured in which James Bond film?", "Which is North America's largest desert?", "Which hard ring-shaped bread product takes its name from the Old German for 'bracelet'?", "What would Del boy expect to get if he ordered a Ruby Murray", "Which US President was given the nickname ‘The Great Emancipator’?", "Drakes ship the Golden Hind(e) was originally called what?", "What was the name of Butch Cassidy's gang?", "Which sea is part of the Arctic Ocean north of Siberia, bounded on the west by Novaya Zemlya and to the east by the Severnaya Zemlya?", "Guadalupe Island, in the Pacific Ocean, belongs to which country?", "Whose 'Symphony No.8' is known as the 'Symphony of a Thousand'?", "In the the tv cartoon series ‘The Simpsons’ what is Grandpa Simpson’s first name?" ]
15
[ 106545, 106546, 106547, 106548, 106549, 106550, 106551, 106552, 106553, 106554, 106555, 106556, 106557, 106558, 106559 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Who was the military commander of 'EOKA' - the Greek terrorist organisation in Cyprus?\nQuestion 2: What connects Alan Sillitoe, John Travolta and The Drifters\nQuestion 3: Which ministry was run by Jim Hacker before he became Prime Minister in the TV sitcom Yes Prime Minister\nQuestion 4: In 1973, which club became the first Second Division side to win the FA Cup since the war?\nQuestion 5: Which famous actress was born on exactly the same day as gymnast Olga Korbut?\nQuestion 6: \"Complete the title of this James Bond film: \"\"You Only Live ... \"\"\"\nQuestion 7: What was the name of the British Army officer who, in 1953, gained recognition as the leader of the successful British expedition to Mount Everest?\nQuestion 8: In what year does Demolition Man take place?\nQuestion 9: \"Who had a UK hit in the 1960s with the song\"\" Juliet\"\"?\"\nQuestion 10: What country suffered 100,000 earthquake-related deaths in 2010?\nQuestion 11: Which jazz musician had the forenames Leon Bismark?\nQuestion 12: Late Formula One racing drive Roland Ratzenberger was born in which country?\nQuestion 13: The nations highest military decoration, what medal is awarded to members of the armed forces, who ho distinguish themselves \"conspicuously by gallantry and intrepidity at the risk of his or her life above and beyond the call of duty while engaged in a action against an enemy of the United States.\"\nQuestion 14: An eye for an eye makes the whole world what?\nQuestion 15: What is the Italian dessert of egg yolks whipped with Marsala and sugar?", "role": "user" } ]
["[\"General Grivas\", \"GENERAL GRIVAS\", \"Georgios Grivas\", \"George Grivas\", \"George Theodorus Grivas\", \"Georgios Theodoros Grivas\"]", "[\"Saturday Night (disambiguation)\", \"Saturday Night\", \"Saturday Night Magazine\", \"Saturday Night (film)\", \"Saturday Night (song)\", \"Saturday night\", \"Saturday Night (album)\"]", "[\"Administrative Affairs\"]", "[\"Sunlun\", \"Sunderland\", \"SUNDERLAND\", \"Sunderland (disambiguation)\"]", "[\"Mary Debra Winger\", \"Debra Winger\", \"Deborah Winger\"]", "[\"Twice\", \"Twice (disambiguation)\"]", "[\"John Hunt (disambiguation)\", \"Hunt, John\", \"JOHN HUNT\", \"John Hunt\"]", "[\"2032\", \"two thousand and thirty-two\"]", "[\"Fritz Fryer\", \"The Four Pennies\", \"Four Pennies\"]", "[\"Haitian Ancestry\", \"Ha\\u00efti\", \"Name of Haiti\", \"Republic of haiti\", \"Haidi\", \"Subdivisions of Haiti\", \"ISO 3166-1:HT\", \"Administrative divisions of Haiti\", \"Republic of Haiti\", \"R\\u00e9publique d'Ha\\u00efti\", \"Arrondissements and communes of haiti\", \"Repiblik Ayiti\", \"History of Haitian Nationality\", \"Departements of Haiti\", \"People of Haiti\", \"Haiti\", \"Ayiti\", \"Hait\\u00ed\", \"Hayti\", \"Haitian Declaration of Independence\"]", "[\"Bix BEIDERBECK\"]", "[\"The Republic of Austria\", \"Oesterreich\", \"Eastreach\", \"\\u00d6sterrike\", \"Easterrealm\", \"Austurriki\", \"Republik \\u00d6sterreich\", \"Osterreich\", \"Austurr\\u00edki\", \"Austrian Republic\", \"Republik Osterreich\", \"Avstria\", \"\\u00d6sterreich\", \"Republik Oesterreich\", \"Administrative divisions of Austria\", \"Ostria\", \"ISO 3166-1:AT\", \"Alpine Deutschen\", \"Austria\", \"Oostenrijk\", \"Architecture of Austria\", \"Republic of Austria\", \"Etymology of Austria\", \"Autriche\", \"Austrian architecture\"]", "[\"Medal of Honor Flag\", \"US Army Medal of Honor\", \"CMOH\", \"Medal Of Honor\", \"Congressional medal of honour\", \"Valor 24\", \"Congressional medal of honor\", \"Medal of Honor (United States)\", \"Congressional Medal of Honor Society of the United States of America\", \"Congressional Medal Of Honor\", \"Medal of honor\", \"Medals of Honor\", \"Congressional Medal of Honour\", \"Civil War Medal of Honor\", \"Medal of Honor\", \"Congressional Medal of Honor\"]", "[\"Blind\", \"Blind (single)\", \"Blind (album)\", \"Blind (song)\", \"Blind (film)\", \"Blind (disambiguation)\"]", "[\"Zabaglione\", \"Zabajone\", \"Sabyon\", \"Zabaione\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"General Grivas\", \"GENERAL GRIVAS\", \"Georgios Grivas\", \"George Grivas\", \"George Theodorus Grivas\", \"Georgios Theodoros Grivas\"]", "[\"Saturday Night (disambiguation)\", \"Saturday Night\", \"Saturday Night Magazine\", \"Saturday Night (film)\", \"Saturday Night (song)\", \"Saturday night\", \"Saturday Night (album)\"]", "[\"Administrative Affairs\"]", "[\"Sunlun\", \"Sunderland\", \"SUNDERLAND\", \"Sunderland (disambiguation)\"]", "[\"Mary Debra Winger\", \"Debra Winger\", \"Deborah Winger\"]", "[\"Twice\", \"Twice (disambiguation)\"]", "[\"John Hunt (disambiguation)\", \"Hunt, John\", \"JOHN HUNT\", \"John Hunt\"]", "[\"2032\", \"two thousand and thirty-two\"]", "[\"Fritz Fryer\", \"The Four Pennies\", \"Four Pennies\"]", "[\"Haitian Ancestry\", \"Ha\\u00efti\", \"Name of Haiti\", \"Republic of haiti\", \"Haidi\", \"Subdivisions of Haiti\", \"ISO 3166-1:HT\", \"Administrative divisions of Haiti\", \"Republic of Haiti\", \"R\\u00e9publique d'Ha\\u00efti\", \"Arrondissements and communes of haiti\", \"Repiblik Ayiti\", \"History of Haitian Nationality\", \"Departements of Haiti\", \"People of Haiti\", \"Haiti\", \"Ayiti\", \"Hait\\u00ed\", \"Hayti\", \"Haitian Declaration of Independence\"]", "[\"Bix BEIDERBECK\"]", "[\"The Republic of Austria\", \"Oesterreich\", \"Eastreach\", \"\\u00d6sterrike\", \"Easterrealm\", \"Austurriki\", \"Republik \\u00d6sterreich\", \"Osterreich\", \"Austurr\\u00edki\", \"Austrian Republic\", \"Republik Osterreich\", \"Avstria\", \"\\u00d6sterreich\", \"Republik Oesterreich\", \"Administrative divisions of Austria\", \"Ostria\", \"ISO 3166-1:AT\", \"Alpine Deutschen\", \"Austria\", \"Oostenrijk\", \"Architecture of Austria\", \"Republic of Austria\", \"Etymology of Austria\", \"Autriche\", \"Austrian architecture\"]", "[\"Medal of Honor Flag\", \"US Army Medal of Honor\", \"CMOH\", \"Medal Of Honor\", \"Congressional medal of honour\", \"Valor 24\", \"Congressional medal of honor\", \"Medal of Honor (United States)\", \"Congressional Medal of Honor Society of the United States of America\", \"Congressional Medal Of Honor\", \"Medal of honor\", \"Medals of Honor\", \"Congressional Medal of Honour\", \"Civil War Medal of Honor\", \"Medal of Honor\", \"Congressional Medal of Honor\"]", "[\"Blind\", \"Blind (single)\", \"Blind (album)\", \"Blind (song)\", \"Blind (film)\", \"Blind (disambiguation)\"]", "[\"Zabaglione\", \"Zabajone\", \"Sabyon\", \"Zabaione\"]" ]
[ "Who was the military commander of 'EOKA' - the Greek terrorist organisation in Cyprus?", "What connects Alan Sillitoe, John Travolta and The Drifters", "Which ministry was run by Jim Hacker before he became Prime Minister in the TV sitcom Yes Prime Minister", "In 1973, which club became the first Second Division side to win the FA Cup since the war?", "Which famous actress was born on exactly the same day as gymnast Olga Korbut?", "\"Complete the title of this James Bond film: \"\"You Only Live ... \"\"\"", "What was the name of the British Army officer who, in 1953, gained recognition as the leader of the successful British expedition to Mount Everest?", "In what year does Demolition Man take place?", "\"Who had a UK hit in the 1960s with the song\"\" Juliet\"\"?\"", "What country suffered 100,000 earthquake-related deaths in 2010?", "Which jazz musician had the forenames Leon Bismark?", "Late Formula One racing drive Roland Ratzenberger was born in which country?", "The nations highest military decoration, what medal is awarded to members of the armed forces, who ho distinguish themselves \"conspicuously by gallantry and intrepidity at the risk of his or her life above and beyond the call of duty while engaged in a action against an enemy of the United States.\"", "An eye for an eye makes the whole world what?", "What is the Italian dessert of egg yolks whipped with Marsala and sugar?" ]
15
[ 11835, 11836, 11837, 11838, 11839, 11840, 11841, 11842, 11843, 11844, 11845, 11846, 11847, 11848, 11849 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: In Britain, a portcullis has been used on whose stationery since 1967?\nQuestion 2: Who wrote the children's book 'Heidi'?\nQuestion 3: Which nation's Supreme Court legalized same sex marriage in June 2015?\nQuestion 4: Who was the leader of Albania from 1944 to 1985?\nQuestion 5: Which James Bond film features two female bodyguards named Bambi and Thumper ?\nQuestion 6: Singer Alvin Stardust played pub landlord Greg Andersen in which UK tv soap?\nQuestion 7: Deriving ultimately from the Geek for 'knowledge, or study, of custom', what name is given to the study of animal behaviour?\nQuestion 8: The City of London financial district is known traditionally as The Square?\nQuestion 9: Which Willie, satirist and co-founder of Private Eye, died on 11th December 1996?\nQuestion 10: Richard, Duke of York, the father of the English kings Edward IV and Richard II, was killed at the Battle of Wakefield in which ongoing campaign?\nQuestion 11: Menchie's is a popular US international chain founded to supply what frozen product?\nQuestion 12: How many ways can a batsman be dismissed in cricket?\nQuestion 13: What circus billed itself as “The Greatest Show on Earth”?\nQuestion 14: Apple Inc's 'digital wallet' virtual banking service is called Apple?\nQuestion 15: What prize was won in 2010 by Liu Xiaobo?", "role": "user" } ]
["[\"House of commons\", \"House of Commons\", \"House Of Commons\"]", "[\"Johanna Spyri\", \"JOHANNA SPYRI\"]", "[\"The United States of America\", \"United States Of Amerca\", \"Us of a\", \"U.\\u2013S.\\u2013A.\", \"Americaland\", \"United States (U.S.A.)\", \"Amurika\", \"Unite states of america\", \"United States of America (redirect)\", \"The U S A\", \"Unietd States\", \"EE UU\", \"The U.S.A.\", \"U.-S.-A.\", \"Usa\", \"United Staets of America\", \"Unites States\", \"\\u00c9tats-Unis d'Am\\u00e9rique\", \"Verenigde State\", \"U.\\u2013S.\", \"The United States of America.\", \"The U-S-A\", \"EEUU\", \"U. S. A.\", \"Nagkaisang mga Estado\", \"The U. S. of America\", \"The USA\", \"America (United States)\", \"The U. S. A.\", \"U S of America\", \"UNITED STATES\", \"Estados Unidos\", \"The U\\u2013S\", \"American United States\", \"US and A\", \"Unitd states\", \"The US of A\", \"EE.UU.\", \"U-S\", \"The U-S\", \"Etymology of the United States\", \"U.S.A.)\", \"EE. UU.\", \"United states of america\", \"US of america\", \"Verenigde State van Amerika\", \"Nited States\", \"United-States\", \"Unite States\", \"Estados Unidos de Am\\u00e9rica\", \"UnitedStates\", \"Estaos Unios\", \"US of America\", \"The Usa\", \"United states of America\", \"Untied States of America\", \"The U S of America\", \"THE AMERICAN UNITED STATES\", \"The United-States\", \"U S A\", \"AmericA\", \"Estados Unidos de America\", \"United states\", \"The U.S. of America\", \"Amerka\", \"United\\u2013States\", \"U.s.a.\", \"United States of America\", \"United State of America\", \"United States (US)\", \"The U.S. of A\", \"America\", \"Amercia\", \"Stati Uniti d'America\", \"Los Estados Unidos de America\", \"United Stated\", \"U.S.\", \"United States (of America)\", \"United States\", \"States of America\", \"America-class\", \"Los Estados Unidos\", \"U,S,\", \"United States (country)\", \"Federal United States\", \"ISO 3166-1:US\", \"Untied States\", \"The U.\\u2013S.\\u2013A.\", \"VS America\", \"Amurica\", \"Etats-Unis d'Amerique\", \"US\", \"U.S. OF A\", \"USofA\", \"Etats-Unis\", \"U.S. of A\", \"United States of America (U.S.A.)\", \"Amarica\", \"The United States\", \"U-S-A\", \"United States/Introduction\", \"The Us\", \"Unitesd states\", \"The U S of A\", \"America class\", \"America magazine\", \"\\u0627\\u0644\\u0648\\u0644\\u0627\\u064a\\u0627\\u062a \\u0627\\u0644\\u0645\\u062a\\u062d\\u062f\\u0629 \\u0627\\u0644\\u0623\\u0645\\u0631\\u064a\\u0643\\u064a\\u0629\", \"The U. S. of A\", \"U S\", \"(USA)\", \"The United\\u2013States\", \"United States (U.S.)\", \"U.-S.\", \"United States of America (USA)\", \"'merica\", \"The US\", \"United States of America.\", \"UNited States\", \"The U.S.\", \"AMERICA\", \"United States of America/OldPage\", \"United+States\", \"The U S\", \"United Sates\", \"THE UNITED STATES OF AMERICA\", \"U\\u2013S\\u2013A\", \"United States Of America\", \"U.S. of America\", \"U\\u2013S\", \"Los Estados Unidos de Am\\u00e9rica\", \"The U.-S.\", \"United sates\", \"The United States Of America\", \"America (country)\", \"United States of American\", \"United state of america\", \"The U.\\u2013S.\", \"Amurka\", \"U. S. of A\", \"The U. S.\", \"United States America\", \"US of A\", \"\\u00c9tats-Unis\", \"USoA\", \"USA\", \"Estaos Un\\u00edos\", \"America, United States of\", \"U. S. of America\", \"U.S.American\", \"(US)\", \"The U\\u2013S\\u2013A\", \"U. S.\", \"U.S. America\", \"U.S. A\", \"Yankee land\", \"America (US)\", \"U.S\", \"America (United States of)\", \"US (country)\", \"UNITED STATES OF AMERICA\", \"U.S.A\", \"Estados unidos\", \"Americia\", \"The US of america\", \"Vereinigte Staaten\", \"US America\", \"These United States of America\", \"VS Amerika\", \"Name of the United States\", \"The united states of america\", \"Estatos Unitos\", \"America (USA)\", \"The U.-S.-A.\", \"United States of America/Introduction\", \"The US of America\", \"Americophile\", \"V.S. America\", \"U.S.A.\", \"U S of A\", \"V.S. Amerika\", \"United+States+of+America\", \"The Unites States of America\"]", "[\"Pranvera Kolaneci\", \"Pranvera Hoxha\", \"Enver Hoxha\", \"Enva Hoxha\", \"Enver Hoxfa\", \"Sokol Hoxha\", \"Enver Hoxa\", \"Enver Hozha\", \"Enver Hohxa\", \"ENVER HOXHA\", \"Enver Hodja\", \"Enver Hoxja\", \"Enver Hoja\", \"Envar Hoxa\", \"Enver Halil Hoxha\", \"Enver Hodga\", \"Enver Hoxxa\", \"E. Hoxha\", \"Hoaxhaism\"]", "[\"Diamonds Are Forever (album)\", \"Diamonds Are Forever (disambiguation)\", \"Diamonds are forever\", \"Diamonds are Forever\", \"Diamonds Are Forever\", \"DIAMONDS ARE FOREVER\"]", "[\"Danny Tennant\", \"Storylines of hollyoaks\", \"Hollyoaks (TV series)\", \"Hollyoaks\", \"Runners (TV serial)\", \"Holly Oaks\", \"H\\u2640LLY\\u2642AKS\", \"HLLYAKS\"]", "[\"Animal behavior\", \"Behavioural biology\", \"Behavioral Biology\", \"Social ethology\", \"Animal behaviorist\", \"Behavior (biology)\", \"Natural Behavior\", \"Ethological\", \"Animal Learning\", \"Behaviour (biology)\", \"Ethography\", \"Animal behaviour\", \"Animal Behavior\", \"Ethology\", \"Bestial Instinct\", \"Animal Behaviour\", \"Ethologist\", \"History of ethology\", \"Behavioral biology\", \"ETHOLOGY\", \"Behavior, animal\", \"Ethologists\", \"Etology\"]", "[\"Mile (Scottish)\", \"Myle\", \"Statute mile\", \"Roman mile\", \"Mile\", \"Greek mile\", \"Mille passus\", \"Scottish mile\", \"US mile\", \"Old English mile\", \"Statute miles\", \"Miglio\", \"English mile\", \"Survey mile\", \"Prussian mile\", \"M\\u00e9rf\\u00f6ld\", \"German mile\", \"Danish mile\", \"Milion (unit)\", \"Mile (Scottish length)\", \"Russian mile\", \"Million (unit)\", \"Portuguese mile\", \"International mile\", \"English miles\", \"Mile rate\", \"Hungarian mile\", \"Scots mile\", \"63360\", \"Mile (Scots)\", \"Byzantine mile\", \"Land mile\", \"Italian mile\", \"Statute Mile\", \"Roman miles\", \"Statute mile in the UK\", \"Austrian mile\", \"Miles\", \"Mile (unit)\", \"Miglia\", \"US survey mile\"]", "[\"Willy Rushton\", \"Willie Rushden\", \"Willie Rushton\", \"Willie Rushdon\"]", "[\"War of the roses\", \"War of the Roses\", \"The war of the roses\", \"War of roses\", \"The War Of The Roses\", \"Wars of the roses\", \"The War of the Roses\", \"Wars of the Roses\", \"Wars of Roses\", \"War of Roses\", \"War Of The Roses\", \"Rebellion of 1483\", \"Wars of the Cousins\", \"The Wars of the Roses\", \"The War of The Roses\"]", "[\"Drinkable yogurt\", \"Yogurt Ice-cream\", \"Sweetened yogurt\", \"Yoghurd\", \"Maast\", \"Yogu\", \"Yogurt\", \"Yoghurt\", \"Joghourt\", \"Zabady\", \"Yoghourt\", \"Jogurt\", \"Yogurt maker\", \"Youghurt\", \"Yogourt\", \"Yougert\", \"Bulgarian yogurt (Kiselo mlyako)\", \"Yoghurt smoothie\", \"Yo\\u011furt\", \"Fruit bottom\", \"Yahourt\", \"Drinkable yoghurt\", \"Joghurt\", \"Yogurt smoothie\", \"Bulgarian yogurt\", \"Sweetened Yogurt\", \"Yaghourt\"]", "[\"10\", \"ten\"]", "[\"Ringling Bros. and Barnum & Bailey Circus\", \"Barnum & Bailey\", \"Ringling Brothers Barnum and Bailey Circus\", \"Ringling Brothers and Barnum & Bailey\", \"Ringling Bros. and Barnum & Bailey\", \"Ringling Bros. Barnum & Bailey Circus\", \"Ringling Brothers & Barnum and Bailey Circus\", \"Ringling Bros.\", \"Barnum and Bailey Circus\", \"Barnum & Bailey Circus\", \"Ringling Brothers and Barnum and Bailey Circus\", \"Ringling Bros. & Barnum and Bailey Circus\", \"Barnum and Bailey\", \"RBBX\", \"Barnum circus\", \"Ringmasters of Ringling Bros. and Barnum & Bailey Circus\", \"List of ringmasters of the Ringling Bros. and Barnum & Bailey Circus\", \"Ringling Bros. And Barnum & Bailey Circus\", \"Ringmasters of the Ringling Bros. and Barnum & Bailey Circus\", \"Ringling Brothers, Barnum and Bailey Circus\", \"Ringling Bros\", \"Ringling Brothers and Barnum & Bailey Circus\"]", "[\"Pay\", \"Pay (disambiguation)\", \"PAY\"]", "[\"Nobel Prize in peace\", \"Peace Nobel\", \"NobelPrize/PeacE\", \"Nobel Peace Prize 2013\", \"Nobel peace prize\", \"Nobel Prize/Peace\", \"Nobel Peace Laureate\", \"Nobels fredspris\", \"Nobel Prize in Peace\", \"Nobel Peace Prizes\", \"Nobel Peace prize\", \"Noble Peace Prize\", \"Nobel Prize for Peace\", \"Nobel prize peace\", \"Nobel peace\", \"NOBEL PEACE PRIZE\", \"Nobel Peace Prize\", \"Nobel peace laureate\", \"NobelPrize/Peace\", \"Nobel Peace Prize Winner\", \"Nobel Peace Price\", \"Nobel Peace\", \"Nobel Peace Prixe\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"House of commons\", \"House of Commons\", \"House Of Commons\"]", "[\"Johanna Spyri\", \"JOHANNA SPYRI\"]", "[\"The United States of America\", \"United States Of Amerca\", \"Us of a\", \"U.\\u2013S.\\u2013A.\", \"Americaland\", \"United States (U.S.A.)\", \"Amurika\", \"Unite states of america\", \"United States of America (redirect)\", \"The U S A\", \"Unietd States\", \"EE UU\", \"The U.S.A.\", \"U.-S.-A.\", \"Usa\", \"United Staets of America\", \"Unites States\", \"\\u00c9tats-Unis d'Am\\u00e9rique\", \"Verenigde State\", \"U.\\u2013S.\", \"The United States of America.\", \"The U-S-A\", \"EEUU\", \"U. S. A.\", \"Nagkaisang mga Estado\", \"The U. S. of America\", \"The USA\", \"America (United States)\", \"The U. S. A.\", \"U S of America\", \"UNITED STATES\", \"Estados Unidos\", \"The U\\u2013S\", \"American United States\", \"US and A\", \"Unitd states\", \"The US of A\", \"EE.UU.\", \"U-S\", \"The U-S\", \"Etymology of the United States\", \"U.S.A.)\", \"EE. UU.\", \"United states of america\", \"US of america\", \"Verenigde State van Amerika\", \"Nited States\", \"United-States\", \"Unite States\", \"Estados Unidos de Am\\u00e9rica\", \"UnitedStates\", \"Estaos Unios\", \"US of America\", \"The Usa\", \"United states of America\", \"Untied States of America\", \"The U S of America\", \"THE AMERICAN UNITED STATES\", \"The United-States\", \"U S A\", \"AmericA\", \"Estados Unidos de America\", \"United states\", \"The U.S. of America\", \"Amerka\", \"United\\u2013States\", \"U.s.a.\", \"United States of America\", \"United State of America\", \"United States (US)\", \"The U.S. of A\", \"America\", \"Amercia\", \"Stati Uniti d'America\", \"Los Estados Unidos de America\", \"United Stated\", \"U.S.\", \"United States (of America)\", \"United States\", \"States of America\", \"America-class\", \"Los Estados Unidos\", \"U,S,\", \"United States (country)\", \"Federal United States\", \"ISO 3166-1:US\", \"Untied States\", \"The U.\\u2013S.\\u2013A.\", \"VS America\", \"Amurica\", \"Etats-Unis d'Amerique\", \"US\", \"U.S. OF A\", \"USofA\", \"Etats-Unis\", \"U.S. of A\", \"United States of America (U.S.A.)\", \"Amarica\", \"The United States\", \"U-S-A\", \"United States/Introduction\", \"The Us\", \"Unitesd states\", \"The U S of A\", \"America class\", \"America magazine\", \"\\u0627\\u0644\\u0648\\u0644\\u0627\\u064a\\u0627\\u062a \\u0627\\u0644\\u0645\\u062a\\u062d\\u062f\\u0629 \\u0627\\u0644\\u0623\\u0645\\u0631\\u064a\\u0643\\u064a\\u0629\", \"The U. S. of A\", \"U S\", \"(USA)\", \"The United\\u2013States\", \"United States (U.S.)\", \"U.-S.\", \"United States of America (USA)\", \"'merica\", \"The US\", \"United States of America.\", \"UNited States\", \"The U.S.\", \"AMERICA\", \"United States of America/OldPage\", \"United+States\", \"The U S\", \"United Sates\", \"THE UNITED STATES OF AMERICA\", \"U\\u2013S\\u2013A\", \"United States Of America\", \"U.S. of America\", \"U\\u2013S\", \"Los Estados Unidos de Am\\u00e9rica\", \"The U.-S.\", \"United sates\", \"The United States Of America\", \"America (country)\", \"United States of American\", \"United state of america\", \"The U.\\u2013S.\", \"Amurka\", \"U. S. of A\", \"The U. S.\", \"United States America\", \"US of A\", \"\\u00c9tats-Unis\", \"USoA\", \"USA\", \"Estaos Un\\u00edos\", \"America, United States of\", \"U. S. of America\", \"U.S.American\", \"(US)\", \"The U\\u2013S\\u2013A\", \"U. S.\", \"U.S. America\", \"U.S. A\", \"Yankee land\", \"America (US)\", \"U.S\", \"America (United States of)\", \"US (country)\", \"UNITED STATES OF AMERICA\", \"U.S.A\", \"Estados unidos\", \"Americia\", \"The US of america\", \"Vereinigte Staaten\", \"US America\", \"These United States of America\", \"VS Amerika\", \"Name of the United States\", \"The united states of america\", \"Estatos Unitos\", \"America (USA)\", \"The U.-S.-A.\", \"United States of America/Introduction\", \"The US of America\", \"Americophile\", \"V.S. America\", \"U.S.A.\", \"U S of A\", \"V.S. Amerika\", \"United+States+of+America\", \"The Unites States of America\"]", "[\"Pranvera Kolaneci\", \"Pranvera Hoxha\", \"Enver Hoxha\", \"Enva Hoxha\", \"Enver Hoxfa\", \"Sokol Hoxha\", \"Enver Hoxa\", \"Enver Hozha\", \"Enver Hohxa\", \"ENVER HOXHA\", \"Enver Hodja\", \"Enver Hoxja\", \"Enver Hoja\", \"Envar Hoxa\", \"Enver Halil Hoxha\", \"Enver Hodga\", \"Enver Hoxxa\", \"E. Hoxha\", \"Hoaxhaism\"]", "[\"Diamonds Are Forever (album)\", \"Diamonds Are Forever (disambiguation)\", \"Diamonds are forever\", \"Diamonds are Forever\", \"Diamonds Are Forever\", \"DIAMONDS ARE FOREVER\"]", "[\"Danny Tennant\", \"Storylines of hollyoaks\", \"Hollyoaks (TV series)\", \"Hollyoaks\", \"Runners (TV serial)\", \"Holly Oaks\", \"H\\u2640LLY\\u2642AKS\", \"HLLYAKS\"]", "[\"Animal behavior\", \"Behavioural biology\", \"Behavioral Biology\", \"Social ethology\", \"Animal behaviorist\", \"Behavior (biology)\", \"Natural Behavior\", \"Ethological\", \"Animal Learning\", \"Behaviour (biology)\", \"Ethography\", \"Animal behaviour\", \"Animal Behavior\", \"Ethology\", \"Bestial Instinct\", \"Animal Behaviour\", \"Ethologist\", \"History of ethology\", \"Behavioral biology\", \"ETHOLOGY\", \"Behavior, animal\", \"Ethologists\", \"Etology\"]", "[\"Mile (Scottish)\", \"Myle\", \"Statute mile\", \"Roman mile\", \"Mile\", \"Greek mile\", \"Mille passus\", \"Scottish mile\", \"US mile\", \"Old English mile\", \"Statute miles\", \"Miglio\", \"English mile\", \"Survey mile\", \"Prussian mile\", \"M\\u00e9rf\\u00f6ld\", \"German mile\", \"Danish mile\", \"Milion (unit)\", \"Mile (Scottish length)\", \"Russian mile\", \"Million (unit)\", \"Portuguese mile\", \"International mile\", \"English miles\", \"Mile rate\", \"Hungarian mile\", \"Scots mile\", \"63360\", \"Mile (Scots)\", \"Byzantine mile\", \"Land mile\", \"Italian mile\", \"Statute Mile\", \"Roman miles\", \"Statute mile in the UK\", \"Austrian mile\", \"Miles\", \"Mile (unit)\", \"Miglia\", \"US survey mile\"]", "[\"Willy Rushton\", \"Willie Rushden\", \"Willie Rushton\", \"Willie Rushdon\"]", "[\"War of the roses\", \"War of the Roses\", \"The war of the roses\", \"War of roses\", \"The War Of The Roses\", \"Wars of the roses\", \"The War of the Roses\", \"Wars of the Roses\", \"Wars of Roses\", \"War of Roses\", \"War Of The Roses\", \"Rebellion of 1483\", \"Wars of the Cousins\", \"The Wars of the Roses\", \"The War of The Roses\"]", "[\"Drinkable yogurt\", \"Yogurt Ice-cream\", \"Sweetened yogurt\", \"Yoghurd\", \"Maast\", \"Yogu\", \"Yogurt\", \"Yoghurt\", \"Joghourt\", \"Zabady\", \"Yoghourt\", \"Jogurt\", \"Yogurt maker\", \"Youghurt\", \"Yogourt\", \"Yougert\", \"Bulgarian yogurt (Kiselo mlyako)\", \"Yoghurt smoothie\", \"Yo\\u011furt\", \"Fruit bottom\", \"Yahourt\", \"Drinkable yoghurt\", \"Joghurt\", \"Yogurt smoothie\", \"Bulgarian yogurt\", \"Sweetened Yogurt\", \"Yaghourt\"]", "[\"10\", \"ten\"]", "[\"Ringling Bros. and Barnum & Bailey Circus\", \"Barnum & Bailey\", \"Ringling Brothers Barnum and Bailey Circus\", \"Ringling Brothers and Barnum & Bailey\", \"Ringling Bros. and Barnum & Bailey\", \"Ringling Bros. Barnum & Bailey Circus\", \"Ringling Brothers & Barnum and Bailey Circus\", \"Ringling Bros.\", \"Barnum and Bailey Circus\", \"Barnum & Bailey Circus\", \"Ringling Brothers and Barnum and Bailey Circus\", \"Ringling Bros. & Barnum and Bailey Circus\", \"Barnum and Bailey\", \"RBBX\", \"Barnum circus\", \"Ringmasters of Ringling Bros. and Barnum & Bailey Circus\", \"List of ringmasters of the Ringling Bros. and Barnum & Bailey Circus\", \"Ringling Bros. And Barnum & Bailey Circus\", \"Ringmasters of the Ringling Bros. and Barnum & Bailey Circus\", \"Ringling Brothers, Barnum and Bailey Circus\", \"Ringling Bros\", \"Ringling Brothers and Barnum & Bailey Circus\"]", "[\"Pay\", \"Pay (disambiguation)\", \"PAY\"]", "[\"Nobel Prize in peace\", \"Peace Nobel\", \"NobelPrize/PeacE\", \"Nobel Peace Prize 2013\", \"Nobel peace prize\", \"Nobel Prize/Peace\", \"Nobel Peace Laureate\", \"Nobels fredspris\", \"Nobel Prize in Peace\", \"Nobel Peace Prizes\", \"Nobel Peace prize\", \"Noble Peace Prize\", \"Nobel Prize for Peace\", \"Nobel prize peace\", \"Nobel peace\", \"NOBEL PEACE PRIZE\", \"Nobel Peace Prize\", \"Nobel peace laureate\", \"NobelPrize/Peace\", \"Nobel Peace Prize Winner\", \"Nobel Peace Price\", \"Nobel Peace\", \"Nobel Peace Prixe\"]" ]
[ "In Britain, a portcullis has been used on whose stationery since 1967?", "Who wrote the children's book 'Heidi'?", "Which nation's Supreme Court legalized same sex marriage in June 2015?", "Who was the leader of Albania from 1944 to 1985?", "Which James Bond film features two female bodyguards named Bambi and Thumper ?", "Singer Alvin Stardust played pub landlord Greg Andersen in which UK tv soap?", "Deriving ultimately from the Geek for 'knowledge, or study, of custom', what name is given to the study of animal behaviour?", "The City of London financial district is known traditionally as The Square?", "Which Willie, satirist and co-founder of Private Eye, died on 11th December 1996?", "Richard, Duke of York, the father of the English kings Edward IV and Richard II, was killed at the Battle of Wakefield in which ongoing campaign?", "Menchie's is a popular US international chain founded to supply what frozen product?", "How many ways can a batsman be dismissed in cricket?", "What circus billed itself as “The Greatest Show on Earth”?", "Apple Inc's 'digital wallet' virtual banking service is called Apple?", "What prize was won in 2010 by Liu Xiaobo?" ]
15
[ 91650, 91651, 91652, 91653, 91654, 91655, 91656, 91657, 91658, 91659, 91660, 91661, 91662, 91663, 91664 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Pullet describes the young (less than 1 year of age) of what species of domesticated animal?\nQuestion 2: What is the bonus for placing a letter of a word on a red square in a game of 'Scrabble'?\nQuestion 3: \"Who directed the 1980 film \"\"Ordinary People\"\"?\"\nQuestion 4: Which bottled sauce is made using malt vinegar, spirit vinegar, molasses, sugar, salt, anchovies, tamarind extract, onions, garlic, spice, and flavouring?\nQuestion 5: Who was the last English monarch to win the throne on the battlefield?\nQuestion 6: Complete the name of the album 'Noel Gallagher's '?\nQuestion 7: Which department store headquartered in Piccadilly, London was founded as a grocery store in 1707?\nQuestion 8: Who won the 1966 World Cup?\nQuestion 9: Which famous Belfast born guitarist, who played with Thin Lizzy for a while, died on 6th February 2011?\nQuestion 10: \"Which classic film ends with the line \"\" .... After all, tomorrow is another day.\"\"?\"\nQuestion 11: Which English king was killed by Walter Tyrell?\nQuestion 12: Which infamous monk was murdered in Petrograd (St Petersburg) in 1916?\nQuestion 13: Who was the field marshal who commanded the 8th army during the Battle of El Alamein?\nQuestion 14: In architecture, what is the name for an ornamental vertical groove in a column?\nQuestion 15: Sn is the symbol for which chemical element?", "role": "user" } ]
["[\"Domestic cock\", \"Muff/beard\", \"Domestic fowl\", \"Chiken\", \"Layer hen\", \"Chicken legs\", \"Chicken Tagine\", \"Chicken (bird)\", \"\\ud83d\\udc14\", \"G. domesticus\", \"Pet chicken\", \"Bock bock\", \"Common domestic fowl\", \"Gallus gallus domesticus\", \"G. gallus domesticus\", \"Chicken (Domestic)\", \"Pullets\", \"Chooks\", \"Chicken tagine\", \"Chicken Chasseur\", \"Domesticated chicken\", \"Muff (chicken)\", \"Pullet\", \"Chickens\", \"Chicken Drumsticks\", \"Chicken chasseur\", \"Domestic chicken\", \"Chickon\", \"Gallus domesticus\", \"Chook\", \"Chicket\", \"Chicken Legs\", \"Hen (bird)\", \"Murgh\", \"Chicken drumsticks\", \"Domestic Chicken\", \"Poulet\", \"Chicken\"]", "[\"Scrabble puzzle\", \"Vowel dump\", \"Skip a cross\", \"Crossed words\", \"Scrabble by Mattel\", \"Triple word score\", \"Word for Word\", \"Triple letter score\", \"Skip across\", \"Blank (Scrabble)\", \"Scrabble board\", \"Scrabbble\", \"Alphapet\", \"Scrabble (board game)\", \"Funworder\", \"Palabras Cruzadas\", \"Scrable\", \"Skip-A-Cross\", \"Spelofun\", \"Scrabble\", \"TRIPLE WORD SCORE\", \"Skip-across\"]", "[\"Bob Redford\", \"Charles Robert Redford\", \"Zoom (restaurant)\", \"Robert Redford Jr.\", \"Zoom (Restaurant)\", \"Robert Redford filmography\", \"Robert Redford, Jr.\", \"Robert Redford\", \"Charles Redford\", \"Charles Robert Redford, Jr.\", \"Charles Redford, Jr.\"]", "[\"Worcester Sause\", \"Worchestire sauce\", \"Salsa inglesa\", \"Worcestershire Sauce\", \"Worchestershire sauce\", \"Worcestershire sauce\", \"Worstershire\", \"Wooster sauce\", \"Worcester sauce\", \"Worcester Sauce\", \"Worstershire sauce\", \"Tonkatsu sauce\", \"Worcesterchire sauce\"]", "[\"Hendrik VII\", \"Heindrik VII\", \"Henry VII (disambiguation)\", \"Heinrich VII\", \"Henry the Seventh\", \"Henry 7\", \"Henry vii\", \"Henry VII\"]", "[\"Noel Gallagher's High Flying Birds\", \"Noel Gallagher's High Flying Birds (band)\", \"High Flying Birds\", \"NGHFB\", \"List of Noel Gallagher's High Flying Birds songs\"]", "[\"Fortnums\", \"Fortnum and Mason\", \"Fortnum's\", \"William Fortnum\", \"Plc Fortnum & Mason\", \"Fortnum & Mason\"]", "[\"Englnad\", \"The land of the Angles\", \"Sasainn\", \"England, U.K.\", \"Engla land\", \"England's\", \"Starks Field School\", \"Englaland\", \"English Nation\", \"Ingland\", \"Engelond\", \"Englistan\", \"Languages of England\", \"England, UK\", \"Name of England\", \"Auld enemy\", \"Sasana\", \"England, United Kingdom\", \"\\u00c6ngland\", \"Lloegr\", \"Land of the Angles\", \"Engla rice\", \"Aengland\", \"UK, (England)\", \"\\u00c6nglaland\", \"England\", \"Life in England\", \"Aenglaland\", \"ENGLAND\", \"Anglica\", \"Etymology of England\", \"Pow Sows\", \"\\u00c6ngla land\"]", "[\"Gary moore\", \"Robert William Gary Moore\", \"Moore, Gary\", \"Gary Moore\"]", "[\"Gone with teh wind\", \"Gone With The Wind\", \"GWTW\", \"Gone With the Wind (novel)\", \"Gone with The Wind\", \"Characters in Gone With the Wind\", \"The Winds of Tara\", \"Gone with the wind\", \"Gone with the Win\", \"Gone w/ the wind\", \"Gone With the Wind\", \"Mammy (Gone with the Wind)\", \"Gone with the Wind\", \"Charles Hamilton (Gone with the Wind)\", \"GONE WITH THE WIND\", \"Gone with the Wind (novel)\"]", "[\"King William II\", \"William II (disambiguation)\", \"William II\", \"William 2\", \"William ii\", \"William the Second\"]", "[\"Grigory Rasputin\", \"Rasputin's penis\", \"\\u0413\\u0440\\u0438\\u0433\\u043e\\u0301\\u0440\\u0438\\u0439 \\u0420\\u0430\\u0441\\u043f\\u0443\\u0301\\u0442\\u0438\\u043d\", \"RasPutin\", \"Grigory Efimovich Rasputin\", \"Grigori Efimovich\", \"The Staircase Notes\", \"Grigori Efimovich Rasputin\", \"Grigori Yefimovich\", \"Gregory Rasputin\", \"Rasputin's Penis\", \"Rasputin, Grigory Yefimovich\", \"\\u0413\\u0440\\u0438\\u0433\\u043e\\u0301\\u0440\\u0438\\u0439 \\u0415\\u0444\\u0438\\u0301\\u043c\\u043e\\u0432\\u0438\\u0447 \\u0420\\u0430\\u0441\\u043f\\u0443\\u0301\\u0442\\u0438\\u043d\", \"Grigorii Rasputin\", \"Grigory Yefimovich Rasputin\", \"Rasputan\", \"Rasputain\", \"Murder of Rasputin\", \"Grigori Efimovich Novykh\", \"Gregory Efimovich Rasputin\", \"Grigori Yefimovich Rasputin\", \"Grigorij Rasputin\", \"Greg Rasputin\", \"Rasputin\", \"Grigori Rasputin\"]", "[\"Bernard L. Montgomery\", \"Field Marshal Montgomery, Viscount of Alamein\", \"Bernard Law Montgomery, 1st Viscount Montgomery\", \"Field Marshal Montgomery\", \"Bernard Law Montgomery, 1st Viscount Montgomery of Alamein\", \"General Bernard Montgomery\", \"FM Monty\", \"Lord Montgomery\", \"Montgomery of Alamein\", \"Bernard Montgomery, 1st Viscount Montgomery of Alamein\", \"Bernard Montgomery\", \"Field marshal montgomery\", \"Bernard MONTGOMERY\", \"Field Marshal Lord Montgomery\", \"B. L. Montgomery\", \"Field Marshall Montgomery\", \"Bernard Law Montgomery\", \"Field Marshal Bernard Law Montgomery\", \"Montgomery, Bernard Law, 1st Viscount Montgomery of Al 'Alamayn\", \"Bernard Law, 1st Viscount Montgomery of Al 'Alamayn Montgomery\"]", "[\"Fl\\u00f6te\", \"Floutist\", \"Edge-blown aerophone\", \"Flautista\", \"Fluteplayer\", \"The Flute\", \"Flutist\", \"Flute\", \"Flautist\", \"Floete\", \"Fluteplaying\", \"Flute player\", \"Classical flautist\", \"Wooden flute\", \"Flute playing\", \"Flute-playing\", \"Flute-player\", \"Fluter\", \"Flutes\"]", "[\"Tin Processing\", \"Tin (element)\", \"Sn (element)\", \"Element 50\", \"Stannic\", \"Tin\", \"Tin metallurgy\", \"Tin lepsory\", \"Stannous\", \"Tin compounds\", \"Stannous ion\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Domestic cock\", \"Muff/beard\", \"Domestic fowl\", \"Chiken\", \"Layer hen\", \"Chicken legs\", \"Chicken Tagine\", \"Chicken (bird)\", \"\\ud83d\\udc14\", \"G. domesticus\", \"Pet chicken\", \"Bock bock\", \"Common domestic fowl\", \"Gallus gallus domesticus\", \"G. gallus domesticus\", \"Chicken (Domestic)\", \"Pullets\", \"Chooks\", \"Chicken tagine\", \"Chicken Chasseur\", \"Domesticated chicken\", \"Muff (chicken)\", \"Pullet\", \"Chickens\", \"Chicken Drumsticks\", \"Chicken chasseur\", \"Domestic chicken\", \"Chickon\", \"Gallus domesticus\", \"Chook\", \"Chicket\", \"Chicken Legs\", \"Hen (bird)\", \"Murgh\", \"Chicken drumsticks\", \"Domestic Chicken\", \"Poulet\", \"Chicken\"]", "[\"Scrabble puzzle\", \"Vowel dump\", \"Skip a cross\", \"Crossed words\", \"Scrabble by Mattel\", \"Triple word score\", \"Word for Word\", \"Triple letter score\", \"Skip across\", \"Blank (Scrabble)\", \"Scrabble board\", \"Scrabbble\", \"Alphapet\", \"Scrabble (board game)\", \"Funworder\", \"Palabras Cruzadas\", \"Scrable\", \"Skip-A-Cross\", \"Spelofun\", \"Scrabble\", \"TRIPLE WORD SCORE\", \"Skip-across\"]", "[\"Bob Redford\", \"Charles Robert Redford\", \"Zoom (restaurant)\", \"Robert Redford Jr.\", \"Zoom (Restaurant)\", \"Robert Redford filmography\", \"Robert Redford, Jr.\", \"Robert Redford\", \"Charles Redford\", \"Charles Robert Redford, Jr.\", \"Charles Redford, Jr.\"]", "[\"Worcester Sause\", \"Worchestire sauce\", \"Salsa inglesa\", \"Worcestershire Sauce\", \"Worchestershire sauce\", \"Worcestershire sauce\", \"Worstershire\", \"Wooster sauce\", \"Worcester sauce\", \"Worcester Sauce\", \"Worstershire sauce\", \"Tonkatsu sauce\", \"Worcesterchire sauce\"]", "[\"Hendrik VII\", \"Heindrik VII\", \"Henry VII (disambiguation)\", \"Heinrich VII\", \"Henry the Seventh\", \"Henry 7\", \"Henry vii\", \"Henry VII\"]", "[\"Noel Gallagher's High Flying Birds\", \"Noel Gallagher's High Flying Birds (band)\", \"High Flying Birds\", \"NGHFB\", \"List of Noel Gallagher's High Flying Birds songs\"]", "[\"Fortnums\", \"Fortnum and Mason\", \"Fortnum's\", \"William Fortnum\", \"Plc Fortnum & Mason\", \"Fortnum & Mason\"]", "[\"Englnad\", \"The land of the Angles\", \"Sasainn\", \"England, U.K.\", \"Engla land\", \"England's\", \"Starks Field School\", \"Englaland\", \"English Nation\", \"Ingland\", \"Engelond\", \"Englistan\", \"Languages of England\", \"England, UK\", \"Name of England\", \"Auld enemy\", \"Sasana\", \"England, United Kingdom\", \"\\u00c6ngland\", \"Lloegr\", \"Land of the Angles\", \"Engla rice\", \"Aengland\", \"UK, (England)\", \"\\u00c6nglaland\", \"England\", \"Life in England\", \"Aenglaland\", \"ENGLAND\", \"Anglica\", \"Etymology of England\", \"Pow Sows\", \"\\u00c6ngla land\"]", "[\"Gary moore\", \"Robert William Gary Moore\", \"Moore, Gary\", \"Gary Moore\"]", "[\"Gone with teh wind\", \"Gone With The Wind\", \"GWTW\", \"Gone With the Wind (novel)\", \"Gone with The Wind\", \"Characters in Gone With the Wind\", \"The Winds of Tara\", \"Gone with the wind\", \"Gone with the Win\", \"Gone w/ the wind\", \"Gone With the Wind\", \"Mammy (Gone with the Wind)\", \"Gone with the Wind\", \"Charles Hamilton (Gone with the Wind)\", \"GONE WITH THE WIND\", \"Gone with the Wind (novel)\"]", "[\"King William II\", \"William II (disambiguation)\", \"William II\", \"William 2\", \"William ii\", \"William the Second\"]", "[\"Grigory Rasputin\", \"Rasputin's penis\", \"\\u0413\\u0440\\u0438\\u0433\\u043e\\u0301\\u0440\\u0438\\u0439 \\u0420\\u0430\\u0441\\u043f\\u0443\\u0301\\u0442\\u0438\\u043d\", \"RasPutin\", \"Grigory Efimovich Rasputin\", \"Grigori Efimovich\", \"The Staircase Notes\", \"Grigori Efimovich Rasputin\", \"Grigori Yefimovich\", \"Gregory Rasputin\", \"Rasputin's Penis\", \"Rasputin, Grigory Yefimovich\", \"\\u0413\\u0440\\u0438\\u0433\\u043e\\u0301\\u0440\\u0438\\u0439 \\u0415\\u0444\\u0438\\u0301\\u043c\\u043e\\u0432\\u0438\\u0447 \\u0420\\u0430\\u0441\\u043f\\u0443\\u0301\\u0442\\u0438\\u043d\", \"Grigorii Rasputin\", \"Grigory Yefimovich Rasputin\", \"Rasputan\", \"Rasputain\", \"Murder of Rasputin\", \"Grigori Efimovich Novykh\", \"Gregory Efimovich Rasputin\", \"Grigori Yefimovich Rasputin\", \"Grigorij Rasputin\", \"Greg Rasputin\", \"Rasputin\", \"Grigori Rasputin\"]", "[\"Bernard L. Montgomery\", \"Field Marshal Montgomery, Viscount of Alamein\", \"Bernard Law Montgomery, 1st Viscount Montgomery\", \"Field Marshal Montgomery\", \"Bernard Law Montgomery, 1st Viscount Montgomery of Alamein\", \"General Bernard Montgomery\", \"FM Monty\", \"Lord Montgomery\", \"Montgomery of Alamein\", \"Bernard Montgomery, 1st Viscount Montgomery of Alamein\", \"Bernard Montgomery\", \"Field marshal montgomery\", \"Bernard MONTGOMERY\", \"Field Marshal Lord Montgomery\", \"B. L. Montgomery\", \"Field Marshall Montgomery\", \"Bernard Law Montgomery\", \"Field Marshal Bernard Law Montgomery\", \"Montgomery, Bernard Law, 1st Viscount Montgomery of Al 'Alamayn\", \"Bernard Law, 1st Viscount Montgomery of Al 'Alamayn Montgomery\"]", "[\"Fl\\u00f6te\", \"Floutist\", \"Edge-blown aerophone\", \"Flautista\", \"Fluteplayer\", \"The Flute\", \"Flutist\", \"Flute\", \"Flautist\", \"Floete\", \"Fluteplaying\", \"Flute player\", \"Classical flautist\", \"Wooden flute\", \"Flute playing\", \"Flute-playing\", \"Flute-player\", \"Fluter\", \"Flutes\"]", "[\"Tin Processing\", \"Tin (element)\", \"Sn (element)\", \"Element 50\", \"Stannic\", \"Tin\", \"Tin metallurgy\", \"Tin lepsory\", \"Stannous\", \"Tin compounds\", \"Stannous ion\"]" ]
[ "Pullet describes the young (less than 1 year of age) of what species of domesticated animal?", "What is the bonus for placing a letter of a word on a red square in a game of 'Scrabble'?", "\"Who directed the 1980 film \"\"Ordinary People\"\"?\"", "Which bottled sauce is made using malt vinegar, spirit vinegar, molasses, sugar, salt, anchovies, tamarind extract, onions, garlic, spice, and flavouring?", "Who was the last English monarch to win the throne on the battlefield?", "Complete the name of the album 'Noel Gallagher's '?", "Which department store headquartered in Piccadilly, London was founded as a grocery store in 1707?", "Who won the 1966 World Cup?", "Which famous Belfast born guitarist, who played with Thin Lizzy for a while, died on 6th February 2011?", "\"Which classic film ends with the line \"\" .... After all, tomorrow is another day.\"\"?\"", "Which English king was killed by Walter Tyrell?", "Which infamous monk was murdered in Petrograd (St Petersburg) in 1916?", "Who was the field marshal who commanded the 8th army during the Battle of El Alamein?", "In architecture, what is the name for an ornamental vertical groove in a column?", "Sn is the symbol for which chemical element?" ]
15
[ 73635, 73636, 73637, 73638, 73639, 73640, 73641, 73642, 73643, 73644, 73645, 73646, 73647, 73648, 73649 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: In the general theory of relativity, what is the term for a boundary in spacetime beyond which events cannot affect the observer?\nQuestion 2: Which rapper's real name is Louise Harman\nQuestion 3: Wet Chemical, Dry Powder, CO2, and Foam are all types of which appliance?\nQuestion 4: \"What is the \"\"twin city\"\" of Minneapolis?\"\nQuestion 5: On 17 June 1994, what vehicle was O J Simpson driving in a slow-speed chase by police at 35 miles per hour (56 km/h)?\nQuestion 6: Which motor manufacturer makes the models Roomster and Superb?\nQuestion 7: From the 1970s many international passengers on charter flights cleared US customs during a refuelling stop at Bangor Airport. In which state is it?\nQuestion 8: Which element was named Dephlogisticated Air by its discoverer, the French chemist Lavoisier who gave it this common name?\nQuestion 9: What was the former name of Surinam?\nQuestion 10: In the human body, where is the atrium?\nQuestion 11: A dish described as la Bretonne' is garnished with which vegetable?\nQuestion 12: What was the name of the dog in the secret seven books by Enid Blyton?\nQuestion 13: How is musician William Lee Conley better known?\nQuestion 14: General Benedict Arnold switched allegiance to the British side during which war?\nQuestion 15: Much of the action in Shakespeare's 'A Midsummer Night's Dream' is set in a wood near which city?", "role": "user" } ]
["[\"Event horizon\", \"Horizon (black hole)\", \"Event Horizon\", \"Event horizons\"]", "[\"Lady sovereign\", \"Lady soverign\", \"Lady sovereign discography\", \"Lady Sovreign\", \"Lady Sovereign\", \"Lady Soverign\", \"Louise Amanda Harman\", \"Louise Harman\", \"Lady Sovereign discography\", \"Lady Sov\"]", "[\"Extinguisher\", \"Fire extinguishers\", \"Fire grenades\", \"Portable fire extinguisher\", \"Fire extinguisher\", \"Fireextinguisher\", \"Fire-extinguisher\", \"Wet Chemical\", \"Brandblusser\", \"Fire grenade\", \"Dry chemical fire extinguisher\", \"Fire Extinguisher\", \"Water Mist\", \"Class D Fire Extinguisher\", \"Class D fire extinguisher\", \"Extinguish\", \"Fire Extinguisher Balls\", \"Extuingisher\"]", "[\"St Paul, the Apostle\", \"Paul of Tarsos\", \"Saul of Tarsus\", \"St Paul the Apostle\", \"Paul of tarsus\", \"Saint Paul the Apostle\", \"Paul the Apostle\", \"Pauloftarsus\", \"Saul/Paul of Tarsus\", \"Saul Of Tarsus\", \"Apostel Paul\", \"The apostle Paul\", \"Apostle Paulus\", \"Paul the apostle\", \"Saint Paul of Tarsus\", \"Paul, Saint\", \"St. Paul the Apostle\", \"Saint Paul\", \"Saint Paul, the Apostle\", \"St. Paul of Tarsus\", \"Alexander the Coppersmith\", \"St Paul\", \"Missionary journeys of Paul\", \"Saul of tarsus\", \"The Apostle Paul\", \"Apostle Paul\", \"St. Paul, the Apostle\", \"Saint Paul (apostle)\", \"St.Pauls\", \"The Apostle, Saint Paul\", \"St. paul\", \"Saint paul\", \"Paul of Tarsus\", \"Alexander the coppersmith\", \"Paul of Tsarsis\", \"Saint Pauls\", \"Saint Paul's\", \"Paul (apostle)\", \"Paul, the Apostle\", \"St. Paul\"]", "[\"Ford Bronco\"]", "[\"Skoda\", \"Skoda (disambiguation)\"]", "[\"Religion in Maine\", \"Sports in Maine\", \"Etat du Maine\", \"State symbols of Maine\", \"23rd State\", \"Demographics of Maine\", \"Department of Maine\", \"Maine.gov\", \"Maine, United States\", \"Www.maine.gov\", \"Twenty-third State\", \"Transport in Maine\", \"Symbols of the State of Maine\", \"Maine (U.S. state)\", \"State of Maine\", \"Politics of Maine\", \"Twenty-Third State\", \"Climate of Maine\", \"Maine Atlantic Coast\", \"The Pine Tree State\", \"\\u00c9tat du Maine\", \"US-ME\", \"Maine (state)\", \"Transportation in Maine\", \"Pine Tree State\", \"Government of Maine\", \"Maine lakes\", \"Maine Lake Country\", \"Geography of Maine\", \"Katahdin Elementary School\", \"Maine\", \"Economy of Maine\"]", "[\"Oxyjunn\", \"Oxygen rings\", \"Active oxygen\", \"Vital air\", \"ATC code V03AN01\", \"ATCvet code QV03AN01\", \"History of oxygen\", \"Atomic number 8\", \"Oxygyn\", \"Oxygen gas\", \"O\\u2082\", \"Dioxygen molecule\", \"Diatomic oxide\", \"Diatomic Oxygen\", \"Oxygen ion\", \"Sauerstoff\", \"Oxygen\", \"Oxygen partial pressure\", \"Pure oxygen\", \"Oxygen atom\", \"Molecular oxygen\", \"Oxygen Atom\", \"Element 8\", \"O (element)\", \"0xygen\", \"Oxigen\", \"E948\"]", "[\"DUTCH GUIANA\", \"Netherlands Guiana\", \"Dutch Guiana\", \"Dutch Guiana (disambiguation)\", \"Dutch Guyana\"]", "[\"Four chambered heart\", \"Atria of the heart\", \"Cardiac chambers\", \"Left heart\", \"Sternocostal surface of heart\", \"Heart\", \"Cardiogenic\", \"Cardiac chamber\", \"\\u2764\\ufe0f\", \"Heart chambers\", \"Heart (anatomy)\", \"Sternocostal surface\", \"Base of heart\", \"Anterior surface of the heart\", \"Base of the heart\", \"Facies cordis\", \"Heart in literature\", \"The heart\", \"Systemic heart\", \"Heart Symbolism and Metaphor\", \"Heart (symbolism)\", \"Cardiac\", \"Facies diaphragmatica cordis\", \"The human heart\", \"Basis cordis\", \"Chambers of the heart\", \"Heart chamber\", \"Heart (Symbolism and Metaphor)\", \"Left side of the heart\", \"Right heart\", \"Heart (biology)\", \"Diaphragmatic surface of heart\", \"Dorsal tube\", \"Apex cordis\", \"Heart (metaphor)\", \"Facies anterior cordis\", \"Human heart\", \"Heart (food)\", \"Anterior wall of heart\", \"Apex of heart\", \"Right side of the heart\", \"Heart (organ)\", \"Atlas of Human Cardiac Anatomy\", \"Facies sternocostalis cordis\"]", "[\"Bean\", \"Beans\"]", "[\"Scamper\", \"Scamper (disambiguation)\"]", "[\"Bill Broonzy\", \"Big Bill Broonzey\", \"William Lee Conley Broonzy\", \"Big Bill Broonzy\", \"William Broonzy\"]", "[\"U.S. War of Independence\", \"American War of Indepedence\", \"American Revolution War\", \"American Revolution, military history\", \"American War of Independance\", \"American War for Independence\", \"American Revolutionary war\", \"American Revolutionary War (1911 Encyclopedia, part 2)\", \"Revolutionary War\", \"War of American Independence\", \"United Colonies War of Indepedence\", \"U.S. Revolutionary War\", \"United States War of Independence\", \"American revolutionary war\", \"American Revolutionary War/Article from the 1911 Encyclopedia Part 2\", \"American Revolutionary War/Article from the 1911 Encyclopedia Part 1\", \"Foreign involvement in the American Revolutionary War\", \"Revolutionary war\", \"American war of ind\", \"American War of Independence\", \"American war of Independence\", \"British-American War (1776)\", \"American War of Independece\", \"1776 War of Independence\", \"West Indies and Gulf Coast campaigns\", \"Us war of independence\", \"Revolutionary war 1775\", \"United Colonies Revolutionary War\", \"American Revolutionary War (1911 Encyclopedia, part 1)\", \"American War of Indpendence\", \"American Wars of Independence\", \"Liberation War of the United States of America\", \"American war of independence\", \"United States Revolutionary War\", \"The American Revolutionary War\", \"War of the American Revolution\", \"American Revolutionary War (Global)\", \"American war of Independance\", \"Revolutionary War (United States)\", \"Wars of the American Revolution\", \"American Revolutionary War\", \"American rev war\", \"US Revolutionary War\"]", "[\"ATHENS (disambiguation)\", \"ATHENS\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Event horizon\", \"Horizon (black hole)\", \"Event Horizon\", \"Event horizons\"]", "[\"Lady sovereign\", \"Lady soverign\", \"Lady sovereign discography\", \"Lady Sovreign\", \"Lady Sovereign\", \"Lady Soverign\", \"Louise Amanda Harman\", \"Louise Harman\", \"Lady Sovereign discography\", \"Lady Sov\"]", "[\"Extinguisher\", \"Fire extinguishers\", \"Fire grenades\", \"Portable fire extinguisher\", \"Fire extinguisher\", \"Fireextinguisher\", \"Fire-extinguisher\", \"Wet Chemical\", \"Brandblusser\", \"Fire grenade\", \"Dry chemical fire extinguisher\", \"Fire Extinguisher\", \"Water Mist\", \"Class D Fire Extinguisher\", \"Class D fire extinguisher\", \"Extinguish\", \"Fire Extinguisher Balls\", \"Extuingisher\"]", "[\"St Paul, the Apostle\", \"Paul of Tarsos\", \"Saul of Tarsus\", \"St Paul the Apostle\", \"Paul of tarsus\", \"Saint Paul the Apostle\", \"Paul the Apostle\", \"Pauloftarsus\", \"Saul/Paul of Tarsus\", \"Saul Of Tarsus\", \"Apostel Paul\", \"The apostle Paul\", \"Apostle Paulus\", \"Paul the apostle\", \"Saint Paul of Tarsus\", \"Paul, Saint\", \"St. Paul the Apostle\", \"Saint Paul\", \"Saint Paul, the Apostle\", \"St. Paul of Tarsus\", \"Alexander the Coppersmith\", \"St Paul\", \"Missionary journeys of Paul\", \"Saul of tarsus\", \"The Apostle Paul\", \"Apostle Paul\", \"St. Paul, the Apostle\", \"Saint Paul (apostle)\", \"St.Pauls\", \"The Apostle, Saint Paul\", \"St. paul\", \"Saint paul\", \"Paul of Tarsus\", \"Alexander the coppersmith\", \"Paul of Tsarsis\", \"Saint Pauls\", \"Saint Paul's\", \"Paul (apostle)\", \"Paul, the Apostle\", \"St. Paul\"]", "[\"Ford Bronco\"]", "[\"Skoda\", \"Skoda (disambiguation)\"]", "[\"Religion in Maine\", \"Sports in Maine\", \"Etat du Maine\", \"State symbols of Maine\", \"23rd State\", \"Demographics of Maine\", \"Department of Maine\", \"Maine.gov\", \"Maine, United States\", \"Www.maine.gov\", \"Twenty-third State\", \"Transport in Maine\", \"Symbols of the State of Maine\", \"Maine (U.S. state)\", \"State of Maine\", \"Politics of Maine\", \"Twenty-Third State\", \"Climate of Maine\", \"Maine Atlantic Coast\", \"The Pine Tree State\", \"\\u00c9tat du Maine\", \"US-ME\", \"Maine (state)\", \"Transportation in Maine\", \"Pine Tree State\", \"Government of Maine\", \"Maine lakes\", \"Maine Lake Country\", \"Geography of Maine\", \"Katahdin Elementary School\", \"Maine\", \"Economy of Maine\"]", "[\"Oxyjunn\", \"Oxygen rings\", \"Active oxygen\", \"Vital air\", \"ATC code V03AN01\", \"ATCvet code QV03AN01\", \"History of oxygen\", \"Atomic number 8\", \"Oxygyn\", \"Oxygen gas\", \"O\\u2082\", \"Dioxygen molecule\", \"Diatomic oxide\", \"Diatomic Oxygen\", \"Oxygen ion\", \"Sauerstoff\", \"Oxygen\", \"Oxygen partial pressure\", \"Pure oxygen\", \"Oxygen atom\", \"Molecular oxygen\", \"Oxygen Atom\", \"Element 8\", \"O (element)\", \"0xygen\", \"Oxigen\", \"E948\"]", "[\"DUTCH GUIANA\", \"Netherlands Guiana\", \"Dutch Guiana\", \"Dutch Guiana (disambiguation)\", \"Dutch Guyana\"]", "[\"Four chambered heart\", \"Atria of the heart\", \"Cardiac chambers\", \"Left heart\", \"Sternocostal surface of heart\", \"Heart\", \"Cardiogenic\", \"Cardiac chamber\", \"\\u2764\\ufe0f\", \"Heart chambers\", \"Heart (anatomy)\", \"Sternocostal surface\", \"Base of heart\", \"Anterior surface of the heart\", \"Base of the heart\", \"Facies cordis\", \"Heart in literature\", \"The heart\", \"Systemic heart\", \"Heart Symbolism and Metaphor\", \"Heart (symbolism)\", \"Cardiac\", \"Facies diaphragmatica cordis\", \"The human heart\", \"Basis cordis\", \"Chambers of the heart\", \"Heart chamber\", \"Heart (Symbolism and Metaphor)\", \"Left side of the heart\", \"Right heart\", \"Heart (biology)\", \"Diaphragmatic surface of heart\", \"Dorsal tube\", \"Apex cordis\", \"Heart (metaphor)\", \"Facies anterior cordis\", \"Human heart\", \"Heart (food)\", \"Anterior wall of heart\", \"Apex of heart\", \"Right side of the heart\", \"Heart (organ)\", \"Atlas of Human Cardiac Anatomy\", \"Facies sternocostalis cordis\"]", "[\"Bean\", \"Beans\"]", "[\"Scamper\", \"Scamper (disambiguation)\"]", "[\"Bill Broonzy\", \"Big Bill Broonzey\", \"William Lee Conley Broonzy\", \"Big Bill Broonzy\", \"William Broonzy\"]", "[\"U.S. War of Independence\", \"American War of Indepedence\", \"American Revolution War\", \"American Revolution, military history\", \"American War of Independance\", \"American War for Independence\", \"American Revolutionary war\", \"American Revolutionary War (1911 Encyclopedia, part 2)\", \"Revolutionary War\", \"War of American Independence\", \"United Colonies War of Indepedence\", \"U.S. Revolutionary War\", \"United States War of Independence\", \"American revolutionary war\", \"American Revolutionary War/Article from the 1911 Encyclopedia Part 2\", \"American Revolutionary War/Article from the 1911 Encyclopedia Part 1\", \"Foreign involvement in the American Revolutionary War\", \"Revolutionary war\", \"American war of ind\", \"American War of Independence\", \"American war of Independence\", \"British-American War (1776)\", \"American War of Independece\", \"1776 War of Independence\", \"West Indies and Gulf Coast campaigns\", \"Us war of independence\", \"Revolutionary war 1775\", \"United Colonies Revolutionary War\", \"American Revolutionary War (1911 Encyclopedia, part 1)\", \"American War of Indpendence\", \"American Wars of Independence\", \"Liberation War of the United States of America\", \"American war of independence\", \"United States Revolutionary War\", \"The American Revolutionary War\", \"War of the American Revolution\", \"American Revolutionary War (Global)\", \"American war of Independance\", \"Revolutionary War (United States)\", \"Wars of the American Revolution\", \"American Revolutionary War\", \"American rev war\", \"US Revolutionary War\"]", "[\"ATHENS (disambiguation)\", \"ATHENS\"]" ]
[ "In the general theory of relativity, what is the term for a boundary in spacetime beyond which events cannot affect the observer?", "Which rapper's real name is Louise Harman", "Wet Chemical, Dry Powder, CO2, and Foam are all types of which appliance?", "\"What is the \"\"twin city\"\" of Minneapolis?\"", "On 17 June 1994, what vehicle was O J Simpson driving in a slow-speed chase by police at 35 miles per hour (56 km/h)?", "Which motor manufacturer makes the models Roomster and Superb?", "From the 1970s many international passengers on charter flights cleared US customs during a refuelling stop at Bangor Airport. In which state is it?", "Which element was named Dephlogisticated Air by its discoverer, the French chemist Lavoisier who gave it this common name?", "What was the former name of Surinam?", "In the human body, where is the atrium?", "A dish described as la Bretonne' is garnished with which vegetable?", "What was the name of the dog in the secret seven books by Enid Blyton?", "How is musician William Lee Conley better known?", "General Benedict Arnold switched allegiance to the British side during which war?", "Much of the action in Shakespeare's 'A Midsummer Night's Dream' is set in a wood near which city?" ]
15
[ 128820, 128821, 128822, 128823, 128824, 128825, 128826, 128827, 128828, 128829, 128830, 128831, 128832, 128833, 128834 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Bill Sykes dog in Oliver Twist\nQuestion 2: We the People, which started a new direction in the wargame movement and is very influential in current wargame design, is what kind of game?\nQuestion 3: Which island is known as The Pearl of the Indian Ocean'?\nQuestion 4: What are the names of Marge's twin sisters in The Simpsons?\nQuestion 5: Spelunking is the recreational pastime of exploring what?\nQuestion 6: Which Victorian scientist said man who dares to waste one hour of life has not discovered the value of life”?\nQuestion 7: Edward the Confessor became King of England in which century?\nQuestion 8: Fred the Red is the mascot of which English football club?\nQuestion 9: Complete the name of the US baseball team the Atlanta _______.\nQuestion 10: Bohol, Masbate, Luzon and Jolo are all part of which island group?\nQuestion 11: Esther Lederer spent 47 years writing a newspaper advice column under what pseudonym, competing with her twin sister Abigail Van Buren?\nQuestion 12: Which Roman poet is most renowned for his poetry about love, seduction and adultery?\nQuestion 13: The disused Vajont (or Vaiont) Dam is in which European country?\nQuestion 14: Who killed Martin Luther King?\nQuestion 15: Eleanor of Provence was the queen of which English monarch?", "role": "user" } ]
["[\"Bulls eye\", \"Bullseye (game show)\", \"Bullseyes\", \"Bullseye\", \"Bullseye (disambiguation)\"]", "[\"The Cards\", \"Card (disambiguation)\", \"CARD (disambiguation)\", \"The Card (film)\", \"CARD\", \"Cards\", \"Card\"]", "[\"Sri Lanka government\", \"Republic of Sri Lanka\", \"Ceilan\", \"Ceilao\", \"Free, Sovereign and Independent Republic of Sri Lanka\", \"Etymology of Sri Lanka\", \"Administrative divisions of Sri Lanka\", \"Ceylon\", \"Sri Lanka\", \"Independence of Sri Lanka\", \"Socialist Republic of Sri Lanka\", \"Provincial capitals of Sri Lanka\", \"Ilankai Jananayaka\", \"Sri-Lanka\", \"\\u0b87\\u0bb2\\u0b99\\u0bcd\\u0b95\\u0bc8\", \"Sir Lanka\", \"Ilankai Jananayaka Choshalichak Kutiyarachu\", \"Subdivisions of Sri Lanka\", \"Choshalichak Kutiyarachu\", \"Hela Diva\", \"Free Sovereign and Independent Republic of Sri Lanka\", \"Srilanka\", \"\\u0b87\\u0bb2\\u0b99\\u0bcd\\u0b95\\u0bc8 \\u0b9a\\u0ba9\\u0ba8\\u0bbe\\u0baf\\u0b95 \\u0b9a\\u0bcb\\u0b9a\\u0bb2\\u0bbf\\u0b9a\\u0b95\\u0bcd \\u0b95\\u0bc1\\u0b9f\\u0bbf\\u0baf\\u0bb0\\u0b9a\\u0bc1\", \"Cejlon\", \"Sri Lanca\", \"Ceylonese\", \"Sri Lankan Republic\", \"Sri Lanak\", \"\\u0dc1\\u0dca\\u200d\\u0dbb\\u0dd3 \\u0dbd\\u0d82\\u0d9a\\u0dcf \\u0db4\\u0dca\\u200d\\u0dbb\\u0da2\\u0dcf\\u0dad\\u0dcf\\u0db1\\u0dca\\u0dad\\u0dca\\u200d\\u0dbb\\u0dd2\\u0d9a \\u0dc3\\u0db8\\u0dcf\\u0da2\\u0dc0\\u0dcf\\u0daf\\u0dd3 \\u0da2\\u0db1\\u0dbb\\u0da2\\u0dba\", \"Sulloon\", \"Sr\\u00ed Lanka\", \"ISO 3166-1:LK\", \"S Lanka\", \"Democratic Socialist Republic of Sri Lanka\", \"Ila\\u1e45kai Ja\\u1e49an\\u0101yaka Cho\\u1e63halichak Ku\\u1e6diyarachu\", \"Venerable Island\", \"Sri lankan\", \"Sri lanka\", \"Helaya\", \"Shri Lamka Prajatantrika Samajaya di Janarajaya\", \"The Democratic Socialist Republic of Sri Lanka\", \"Sri Lankan Martial Arts\", \"Heladiva\", \"Ila\\u1e45kai\", \"\\u015ar\\u012b La\\u1e43k\\u0101va\", \"SriLanka\", \"Sri Lamka\", \"Seilan\", \"Tourist Sri Lanka\", \"Sielediva\", \"Ilankai\", \"Island of Ceylon\"]", "[\"Selma Bouvier Terwilliger Hutz McClure Stu Simpson\", \"Selma McClure\", \"Patty Bouvier\", \"Selma Stu\", \"Selma Bouvier-Terwilliger-Hutz-McClure-Stu-Simpson\", \"Patty and Selma Bouvier\", \"Patty and Selma\", \"Bouvier sisters\", \"The Simpsons/Selma\", \"Selma and Patty\", \"Selma Terwilliger\", \"Selma Bouvier\", \"Paddy and Selma\", \"Selma Simpson\", \"Selma Hutz\", \"Patty and selma bouvier\", \"Selma and Patty Bouvier\", \"Patricia Bouvier\", \"The Simpsons/Patty\"]", "[\"River cave\", \"Dry cave\", \"Cave\", \"Natural cave\", \"World's deepest cave\", \"Sacred cave\", \"Caves\", \"Fossil cave\", \"Primary caves\", \"Collapse cave\", \"Cave system\", \"Cave systems\", \"Dripstone cave\", \"Cave records\", \"Karst Cave\", \"Primary cave\", \"Caverns\", \"Collapse cavern\", \"Cave complex\", \"Cavern\", \"Natural caves\", \"Cave (natural)\", \"Water cave\"]", "[\"Charles R. Darwin\", \"Www.darwin200.org.uk\", \"Charles R Darwin\", \"Darwin200\", \"Darwin 200\", \"CHARLES DARWIN\", \"Charles Darwin's\", \"Darwin's\", \"Charlesdarwin\", \"CR Darwin\", \"C. R. Darwin\", \"Charles darwin\", \"Charles Robert Darwin\", \"Chuck Darwin\", \"C darwin\", \"Darwin's theory\", \"Charles Darwin\", \"Mary Darwin\", \"Darwin, Charles\", \"Charels darwin\"]", "[\"11\", \"eleven\", \"11th\"]", "[\"Manchester Utd.\", \"Manchester United\", \"Donald Love\", \"Manchester U\", \"Manchester Red Devils\", \"Man UTD\", \"Manchester unted\", \"Manc united\", \"Manchester Utd FC\", \"Manchester United Football Club\", \"Manchester United F.C.\", \"Manchester united\", \"Kieran O'Hara\", \"F.c. man utd\", \"Manchester United F. C.\", \"Manchester United FC\", \"Manchester+United\", \"Man. United\", \"Man. u\", \"Newton Heath L&YR F.C.\", \"Manchester united squad\", \"Manchester United F C\", \"Manchester Utd\", \"Manutd\", \"Man u\", \"Manchester United F.C\", \"Newton Heath F.C.\", \"Manchester united F.C.\", \"ManYoo\", \"Man Utd\", \"Fc man utd\", \"Mufc\", \"Newton Heath LYR F.C.\", \"Man-U\", \"Manchester United Football Squad\", \"M.U.F.C.\", \"Manchester United plc\", \"Newton Heath L&YR FC\", \"ManU\", \"ManUtd\", \"Man Yoo\", \"Man U\", \"Man utd\", \"MUFC\", \"Man United\", \"Machester United\"]", "[\"List of Atlanta Braves captains\", \"The Atlanta Braves\", \"Boston Doves\", \"Boston Beaneaters (NL)\", \"Milwaukee Braves\", \"Boston Rustlers\", \"Atlanta Braves 1990s pitching rotation\", \"Braves Roster\", \"Braves\", \"Atlanta Braves\", \"Boston Braves To Milwaukee\", \"Boston Red Caps\", \"Atlanta Braves (sports)\", \"Tlanta braves\", \"Atlanta Braves 1990's pitching rotation\", \"Boston Beaneaters\", \"Atl braves\", \"The braves\", \"BRAVES\", \"Red Caps Baseball\"]", "[\"Islas Filipinas\", \"The Republic of the Philippines\", \"Philippines Republic\", \"Pinas (country)\", \"Philipine\", \"Phillipines\", \"Republic of Philippines\", \"ISO 3166-1:PH\", \"Republic of Pilipinas\", \"PHILIPPINE\", \"Regional population of the Philippines\", \"Fillipines\", \"The Philipines\", \"Filippines\", \"Phillippenes\", \"Las Islas Filipinas\", \"Islas de Filipinas\", \"Filipines\", \"Legazpi Boulevard\", \"Republic of the Philippines\", \"Philippines\", \"Fillippines\", \"Philippine archipelago\", \"Philippine islands\", \"Philippinan\", \"The Phillipines\", \"PHILIPPINES\", \"The Phillippines\", \"Lu Sung\", \"Philippine republic\", \"Philipines\", \"Philippine Islands\", \"Phillipine\", \"Etymology of the Philippines\", \"Philippine Archipelago\", \"Filipino Republic\", \"Philippines Colonial History\", \"Phillippines\", \"Republika ng Pilipinas\", \"Philippines archipelago\", \"Pilipinas\", \"The Philippines\", \"Philippine\", \"Philiphines\", \"Department of Health-Center for Health Development\", \"Philippenes\", \"Phillippine\", \"Phillipenes\"]", "[\"Ask Ann Landers\", \"Ruth Crowley\", \"Ann Landers\", \"Annie's Mailbox\", \"Esther Pauline Friedman\", \"Ask Ann Landers (advice column)\"]", "[\"OVID\", \"Ovidius\", \"Publius Ovidius Nasso\", \"Ovidius Naso\", \"Publius Ovidius Naso\", \"Halieutica (Ovid)\", \"Ovid\", \"Ovid inspired\", \"Consolatio ad Liviam\", \"Ovidian\", \"Nux (poem)\"]", "[\"Environment of Italy\", \"Itali\\u00ebn\", \"Subdivisions of Italy\", \"Republic of Italy\", \"ItalY\", \"ISO 3166-1:IT\", \"Etymology of Italy\", \"Itali\", \"Pollution in Italy\", \"Administrative divisions of Italy\", \"Austrian Empire (Italy)\", \"Italija\", \"Italie\", \"Italia\", \"Italian Republic\", \"Second Italian Republic\", \"Italy\", \"Italio\", \"Repubblica Italiana\", \"It\\u00e0lia\", \"The Italian republic\"]", "[\"James E. Ray\", \"James Earl Ray\", \"Ray, James Earl\"]", "[\"Henry III\", \"Enrique III\", \"Heinrich III\", \"Hendrik III\", \"HENRY THE THIRD\", \"Henry iii\", \"Henry the Third\", \"Henry 3\", \"Henry III (disambiguation)\", \"Enrico III\", \"King Henry III\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Bulls eye\", \"Bullseye (game show)\", \"Bullseyes\", \"Bullseye\", \"Bullseye (disambiguation)\"]", "[\"The Cards\", \"Card (disambiguation)\", \"CARD (disambiguation)\", \"The Card (film)\", \"CARD\", \"Cards\", \"Card\"]", "[\"Sri Lanka government\", \"Republic of Sri Lanka\", \"Ceilan\", \"Ceilao\", \"Free, Sovereign and Independent Republic of Sri Lanka\", \"Etymology of Sri Lanka\", \"Administrative divisions of Sri Lanka\", \"Ceylon\", \"Sri Lanka\", \"Independence of Sri Lanka\", \"Socialist Republic of Sri Lanka\", \"Provincial capitals of Sri Lanka\", \"Ilankai Jananayaka\", \"Sri-Lanka\", \"\\u0b87\\u0bb2\\u0b99\\u0bcd\\u0b95\\u0bc8\", \"Sir Lanka\", \"Ilankai Jananayaka Choshalichak Kutiyarachu\", \"Subdivisions of Sri Lanka\", \"Choshalichak Kutiyarachu\", \"Hela Diva\", \"Free Sovereign and Independent Republic of Sri Lanka\", \"Srilanka\", \"\\u0b87\\u0bb2\\u0b99\\u0bcd\\u0b95\\u0bc8 \\u0b9a\\u0ba9\\u0ba8\\u0bbe\\u0baf\\u0b95 \\u0b9a\\u0bcb\\u0b9a\\u0bb2\\u0bbf\\u0b9a\\u0b95\\u0bcd \\u0b95\\u0bc1\\u0b9f\\u0bbf\\u0baf\\u0bb0\\u0b9a\\u0bc1\", \"Cejlon\", \"Sri Lanca\", \"Ceylonese\", \"Sri Lankan Republic\", \"Sri Lanak\", \"\\u0dc1\\u0dca\\u200d\\u0dbb\\u0dd3 \\u0dbd\\u0d82\\u0d9a\\u0dcf \\u0db4\\u0dca\\u200d\\u0dbb\\u0da2\\u0dcf\\u0dad\\u0dcf\\u0db1\\u0dca\\u0dad\\u0dca\\u200d\\u0dbb\\u0dd2\\u0d9a \\u0dc3\\u0db8\\u0dcf\\u0da2\\u0dc0\\u0dcf\\u0daf\\u0dd3 \\u0da2\\u0db1\\u0dbb\\u0da2\\u0dba\", \"Sulloon\", \"Sr\\u00ed Lanka\", \"ISO 3166-1:LK\", \"S Lanka\", \"Democratic Socialist Republic of Sri Lanka\", \"Ila\\u1e45kai Ja\\u1e49an\\u0101yaka Cho\\u1e63halichak Ku\\u1e6diyarachu\", \"Venerable Island\", \"Sri lankan\", \"Sri lanka\", \"Helaya\", \"Shri Lamka Prajatantrika Samajaya di Janarajaya\", \"The Democratic Socialist Republic of Sri Lanka\", \"Sri Lankan Martial Arts\", \"Heladiva\", \"Ila\\u1e45kai\", \"\\u015ar\\u012b La\\u1e43k\\u0101va\", \"SriLanka\", \"Sri Lamka\", \"Seilan\", \"Tourist Sri Lanka\", \"Sielediva\", \"Ilankai\", \"Island of Ceylon\"]", "[\"Selma Bouvier Terwilliger Hutz McClure Stu Simpson\", \"Selma McClure\", \"Patty Bouvier\", \"Selma Stu\", \"Selma Bouvier-Terwilliger-Hutz-McClure-Stu-Simpson\", \"Patty and Selma Bouvier\", \"Patty and Selma\", \"Bouvier sisters\", \"The Simpsons/Selma\", \"Selma and Patty\", \"Selma Terwilliger\", \"Selma Bouvier\", \"Paddy and Selma\", \"Selma Simpson\", \"Selma Hutz\", \"Patty and selma bouvier\", \"Selma and Patty Bouvier\", \"Patricia Bouvier\", \"The Simpsons/Patty\"]", "[\"River cave\", \"Dry cave\", \"Cave\", \"Natural cave\", \"World's deepest cave\", \"Sacred cave\", \"Caves\", \"Fossil cave\", \"Primary caves\", \"Collapse cave\", \"Cave system\", \"Cave systems\", \"Dripstone cave\", \"Cave records\", \"Karst Cave\", \"Primary cave\", \"Caverns\", \"Collapse cavern\", \"Cave complex\", \"Cavern\", \"Natural caves\", \"Cave (natural)\", \"Water cave\"]", "[\"Charles R. Darwin\", \"Www.darwin200.org.uk\", \"Charles R Darwin\", \"Darwin200\", \"Darwin 200\", \"CHARLES DARWIN\", \"Charles Darwin's\", \"Darwin's\", \"Charlesdarwin\", \"CR Darwin\", \"C. R. Darwin\", \"Charles darwin\", \"Charles Robert Darwin\", \"Chuck Darwin\", \"C darwin\", \"Darwin's theory\", \"Charles Darwin\", \"Mary Darwin\", \"Darwin, Charles\", \"Charels darwin\"]", "[\"11\", \"eleven\", \"11th\"]", "[\"Manchester Utd.\", \"Manchester United\", \"Donald Love\", \"Manchester U\", \"Manchester Red Devils\", \"Man UTD\", \"Manchester unted\", \"Manc united\", \"Manchester Utd FC\", \"Manchester United Football Club\", \"Manchester United F.C.\", \"Manchester united\", \"Kieran O'Hara\", \"F.c. man utd\", \"Manchester United F. C.\", \"Manchester United FC\", \"Manchester+United\", \"Man. United\", \"Man. u\", \"Newton Heath L&YR F.C.\", \"Manchester united squad\", \"Manchester United F C\", \"Manchester Utd\", \"Manutd\", \"Man u\", \"Manchester United F.C\", \"Newton Heath F.C.\", \"Manchester united F.C.\", \"ManYoo\", \"Man Utd\", \"Fc man utd\", \"Mufc\", \"Newton Heath LYR F.C.\", \"Man-U\", \"Manchester United Football Squad\", \"M.U.F.C.\", \"Manchester United plc\", \"Newton Heath L&YR FC\", \"ManU\", \"ManUtd\", \"Man Yoo\", \"Man U\", \"Man utd\", \"MUFC\", \"Man United\", \"Machester United\"]", "[\"List of Atlanta Braves captains\", \"The Atlanta Braves\", \"Boston Doves\", \"Boston Beaneaters (NL)\", \"Milwaukee Braves\", \"Boston Rustlers\", \"Atlanta Braves 1990s pitching rotation\", \"Braves Roster\", \"Braves\", \"Atlanta Braves\", \"Boston Braves To Milwaukee\", \"Boston Red Caps\", \"Atlanta Braves (sports)\", \"Tlanta braves\", \"Atlanta Braves 1990's pitching rotation\", \"Boston Beaneaters\", \"Atl braves\", \"The braves\", \"BRAVES\", \"Red Caps Baseball\"]", "[\"Islas Filipinas\", \"The Republic of the Philippines\", \"Philippines Republic\", \"Pinas (country)\", \"Philipine\", \"Phillipines\", \"Republic of Philippines\", \"ISO 3166-1:PH\", \"Republic of Pilipinas\", \"PHILIPPINE\", \"Regional population of the Philippines\", \"Fillipines\", \"The Philipines\", \"Filippines\", \"Phillippenes\", \"Las Islas Filipinas\", \"Islas de Filipinas\", \"Filipines\", \"Legazpi Boulevard\", \"Republic of the Philippines\", \"Philippines\", \"Fillippines\", \"Philippine archipelago\", \"Philippine islands\", \"Philippinan\", \"The Phillipines\", \"PHILIPPINES\", \"The Phillippines\", \"Lu Sung\", \"Philippine republic\", \"Philipines\", \"Philippine Islands\", \"Phillipine\", \"Etymology of the Philippines\", \"Philippine Archipelago\", \"Filipino Republic\", \"Philippines Colonial History\", \"Phillippines\", \"Republika ng Pilipinas\", \"Philippines archipelago\", \"Pilipinas\", \"The Philippines\", \"Philippine\", \"Philiphines\", \"Department of Health-Center for Health Development\", \"Philippenes\", \"Phillippine\", \"Phillipenes\"]", "[\"Ask Ann Landers\", \"Ruth Crowley\", \"Ann Landers\", \"Annie's Mailbox\", \"Esther Pauline Friedman\", \"Ask Ann Landers (advice column)\"]", "[\"OVID\", \"Ovidius\", \"Publius Ovidius Nasso\", \"Ovidius Naso\", \"Publius Ovidius Naso\", \"Halieutica (Ovid)\", \"Ovid\", \"Ovid inspired\", \"Consolatio ad Liviam\", \"Ovidian\", \"Nux (poem)\"]", "[\"Environment of Italy\", \"Itali\\u00ebn\", \"Subdivisions of Italy\", \"Republic of Italy\", \"ItalY\", \"ISO 3166-1:IT\", \"Etymology of Italy\", \"Itali\", \"Pollution in Italy\", \"Administrative divisions of Italy\", \"Austrian Empire (Italy)\", \"Italija\", \"Italie\", \"Italia\", \"Italian Republic\", \"Second Italian Republic\", \"Italy\", \"Italio\", \"Repubblica Italiana\", \"It\\u00e0lia\", \"The Italian republic\"]", "[\"James E. Ray\", \"James Earl Ray\", \"Ray, James Earl\"]", "[\"Henry III\", \"Enrique III\", \"Heinrich III\", \"Hendrik III\", \"HENRY THE THIRD\", \"Henry iii\", \"Henry the Third\", \"Henry 3\", \"Henry III (disambiguation)\", \"Enrico III\", \"King Henry III\"]" ]
[ "Bill Sykes dog in Oliver Twist", "We the People, which started a new direction in the wargame movement and is very influential in current wargame design, is what kind of game?", "Which island is known as The Pearl of the Indian Ocean'?", "What are the names of Marge's twin sisters in The Simpsons?", "Spelunking is the recreational pastime of exploring what?", "Which Victorian scientist said man who dares to waste one hour of life has not discovered the value of life”?", "Edward the Confessor became King of England in which century?", "Fred the Red is the mascot of which English football club?", "Complete the name of the US baseball team the Atlanta _______.", "Bohol, Masbate, Luzon and Jolo are all part of which island group?", "Esther Lederer spent 47 years writing a newspaper advice column under what pseudonym, competing with her twin sister Abigail Van Buren?", "Which Roman poet is most renowned for his poetry about love, seduction and adultery?", "The disused Vajont (or Vaiont) Dam is in which European country?", "Who killed Martin Luther King?", "Eleanor of Provence was the queen of which English monarch?" ]
15
[ 29445, 29446, 29447, 29448, 29449, 29450, 29451, 29452, 29453, 29454, 29455, 29456, 29457, 29458, 29459 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What cereal is for kids, silly rabbit?\nQuestion 2: Because of his advocation for the use of direct current (DC) for electric power distribution, Thomas Edison developed a bitter rivalry with which other genius who advocated alternating current (AC)?\nQuestion 3: What does the musical term 'Crescendo' mean?\nQuestion 4: What name is given to a second full moon in a month?\nQuestion 5: Wiki, as in Wikipedia, is a word that means fast or quick - in what language?\nQuestion 6: Can you name the last King of Egypt?\nQuestion 7: 'ETIHAD Airways' is based in which of the United Arab Emirates?\nQuestion 8: The Princess Royal's daughter Zara is married to which English sportsman?\nQuestion 9: Which Russian port was the scene of the Potemkin Mutiny in 1905?\nQuestion 10: William Harvey the man who discovered the circulation of the blood was born in which English town?\nQuestion 11: The daily newspaper The Tennessean' is published in which city?\nQuestion 12: Which band performed a massive controversial concert at the Brandenberg Gate celebrating the 20th Anniversary of the fall of the Berlin Wall?\nQuestion 13: According to legend, King Arthur's queen consort, Guinevere, had a torrid affair with which Knight of the Round Table?\nQuestion 14: Which pasta dish is the favourite food of Garfield in the comic strip by Jim Davis ?\nQuestion 15: Who is the U.S. interstate highway system named for?", "role": "user" } ]
["[\"Trix\", \"Trix (disambiguation)\"]", "[\"Nichola Tesla\", \"Tesla's Flying Machine\", \"Dr. Nikola Tesla (1856-1943)\", \"Duka Mandic\", \"\\u0110uka Mandi\\u0107\", \"Students of Nikola Tesla\", \"Dynamic theory of gravity\", \"\\u041d\\u0438\\u043a\\u043e\\u043b\\u0430 \\u0422\\u0435\\u0441\\u043b\\u0430\", \"Biography of Nikola Tesla\", \"Nicola Tesla\", \"Tesla (physicist)\", \"Milutin Tesla\", \"Nikola Telsa\", \"Tesla, Nikola\", \"Nikola Tesla\", \"Tesla Cannon\", \"Nikolai Tesla\", \"Nikoli Tesla\", \"Nikola tesla\"]", "[\"GRADUALLY INCREASING\"]", "[\"Blue Moon\", \"Blue moon\"]", "[\"Hawaiian (disambiguation)\", \"Hawaiian\", \"Hawai'ian\"]", "[\"Faruk I\", \"Faruq of Egypt\", \"Farouk I\", \"King Faruk\", \"Farouk Muhammad Ali\", \"King Farook\", \"King Farouk of Egypt\", \"Faruk I of Egypt\", \"Farouk of egypt\", \"King Farouk I of Egypt\", \"Farouk I of Egypt\", \"HRH Crown Prince Farouk\", \"King Farouk\", \"Faruq I\", \"King Farouk I\", \"Farouk of Egypt\"]", "[\"Abu Dhabi, United Arab Emirates\", \"Abu dhabi\", \"Municipality of Abu Dhabi City\", \"Ab\\u00fb Zabi\", \"Abou Dhabi\", \"Abu Zabi\", \"Abu Dhabi\", \"Abu Dhaby\", \"Capital of the United Arab Emirates\", \"Abu Dhabi (city)\", \"Abu Dhabi, U.A.E.\", \"Abu-Dabi\", \"Abu Dabhi\", \"Abu-Zabi\", \"Abu \\u1e92aby\", \"Abu Dabi\", \"\\u0623\\u0628\\u0648\\u0638\\u0628\\u064a\", \"Abu-Zaby\", \"\\u0623\\u0628\\u0648 \\u0638\\u0628\", \"Abu Zaby\", \"Ab\\u016b Z\\u0327aby\", \"Abou-Dhabi\", \"ABU DHABI\", \"Alu Zaly\", \"Abu-Dhabi\"]", "[\"Michael Tindall\", \"Mike Tindall\", \"MIKE TINDALL\"]", "[\"Odessa City Council\", \"\\u041e\\u0434\\u0435\\u0441\\u0430\", \"Sister cities of Odessa\", \"Eni-Dunia\", \"\\u041e\\u0434\\u0435\\u0441\\u0441\\u0430\", \"Odessa, Ukraine\", \"Odessa, USSR\", \"Chadzibejus\", \"Odesa, Ukraine\", \"City of Odessa\", \"Odessa, Russia\", \"UN/LOCODE:UAODS\", \"Odesa\", \"Hacibey\", \"Chad\\u017eib\\u0117jus\", \"Odessa\"]", "[\"Folkestone, Kent\", \"Folkestone, England\", \"Folkstone, Kent\", \"Folkestone\", \"Folkstone\", \"St Martins C.E.P. School Folkestone\"]", "[\"Cashville, Tennessee\", \"Nashville (TN)\", \"Nashville & Davidson County, Tennessee\", \"Nashville neighborhoods\", \"Nashville, USA\", \"Nashville, TN, USA\", \"Nashville-Davidson (city), Davidson County, TN\", \"Nashville-Davidson (city), TN\", \"Nash Vegas\", \"Nashville-Davidson (city), Tennessee\", \"Nashville, United States\", \"Nashville-Davidson, Tennessee\", \"Metropolitan Government of Nashville and Davidson County\", \"Nashville\", \"Nashville-Davidson\", \"Nashville, Tennessee\", \"Nashville-Davidson (city), Davidson County, Tennessee\", \"Nashville, TN\", \"The weather in Nashville\", \"Businesses in Nashville\", \"Nashville Tenn\", \"Nashville-Davidson County\", \"Nashville, tn\", \"Protestant vatican\", \"Little Kurdistan\", \"Capital of Tennessee\", \"Nashville-Davidson, TN\", \"Music City\", \"Nashville, Tennesee\", \"City of Nashville\", \"Little kurdistan\", \"Downtown Nashville\", \"Music City (disambiguation)\", \"Nashville (AFL)\", \"Neighborhoods of Nashville\", \"Nashvillian\", \"Music City USA\", \"South Nashville\", \"Nashville, Tenn.\", \"Nashville Tennessee\", \"Nashville Neighborhoods\", \"West Nashville\", \"North Nashville\", \"Nashville tn\"]", "[\"U2 band\", \"U2 (band)\", \"U2 (music)\", \"Flowering rose of glastonbury\", \"U2\", \"U2.com\", \"You 2\", \"Dennis Sheehan\", \"Flowering Rose of Glastonbury\", \"U2 Lyrics\"]", "[\"Lancelot du Lac\", \"Chevalier mal fet\", \"Evaine\", \"Lancelot of the Lake\", \"Sir launcelot du lake\", \"Aroundight\", \"Arondight\", \"Sir Lancelot\", \"Sir Lancelot Du Lac\", \"Lancelot\", \"Llenlleawg\", \"Joyousgard\", \"Sir Launcelot\", \"Sir lancealot\", \"Joyous Gard\", \"Llwch Llenlleawg\", \"Launcelot\", \"Joyous Guard\", \"Launcelot du Lac\", \"Joyous Garde\"]", "[\"Veggie lasagne\", \"Beef lasagne\", \"Beef lasagna\", \"Lazzania\", \"Lasagne verdi\", \"Lazagna\", \"Courgette Lasagne\", \"Vegetable Lasagna\", \"Lasagne\", \"Lasagnia\", \"Courgette lasagne\", \"Lasagna\", \"Lasagne al forno\", \"Lasagnotte\", \"LASAGNE\", \"Lasanga\", \"Vegetable lasagna\"]", "[\"Eisenhower Dwight\", \"Health issues of Dwight D. Eisenhower\", \"D. D. Eisenhower\", \"Dynamic Conservatism\", \"General Dwight Eisenhower\", \"David Jacob Eisenhower\", \"Dweight Eisenhower\", \"34th President of the United States\", \"Dwight E Eisenhower\", \"Eisehower\", \"President Dwight D. Eisenhower\", \"David Dwight Eisenhower\", \"Ike (nickname)\", \"Eisenhower\", \"Eishenhower\", \"General Dwight David Eisenhower\", \"Dwight D. Eisenhower\", \"President Eisenhower\", \"Ike Eisenhower\", \"Dwight Eisenhower\", \"D. Eisenhower\", \"General Eisenhower\", \"David D. Eisenhower\", \"President Dwight Eisenhower\", \"Dwight eisenhower\", \"Dwight Eisenhour\", \"Dwight Eisienhower\", \"Dwight Eisenhauer\", \"Dwight David Eisenhower\", \"Dwight D Eisenhower\", \"General of the Army Dwight Eisenhower\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Trix\", \"Trix (disambiguation)\"]", "[\"Nichola Tesla\", \"Tesla's Flying Machine\", \"Dr. Nikola Tesla (1856-1943)\", \"Duka Mandic\", \"\\u0110uka Mandi\\u0107\", \"Students of Nikola Tesla\", \"Dynamic theory of gravity\", \"\\u041d\\u0438\\u043a\\u043e\\u043b\\u0430 \\u0422\\u0435\\u0441\\u043b\\u0430\", \"Biography of Nikola Tesla\", \"Nicola Tesla\", \"Tesla (physicist)\", \"Milutin Tesla\", \"Nikola Telsa\", \"Tesla, Nikola\", \"Nikola Tesla\", \"Tesla Cannon\", \"Nikolai Tesla\", \"Nikoli Tesla\", \"Nikola tesla\"]", "[\"GRADUALLY INCREASING\"]", "[\"Blue Moon\", \"Blue moon\"]", "[\"Hawaiian (disambiguation)\", \"Hawaiian\", \"Hawai'ian\"]", "[\"Faruk I\", \"Faruq of Egypt\", \"Farouk I\", \"King Faruk\", \"Farouk Muhammad Ali\", \"King Farook\", \"King Farouk of Egypt\", \"Faruk I of Egypt\", \"Farouk of egypt\", \"King Farouk I of Egypt\", \"Farouk I of Egypt\", \"HRH Crown Prince Farouk\", \"King Farouk\", \"Faruq I\", \"King Farouk I\", \"Farouk of Egypt\"]", "[\"Abu Dhabi, United Arab Emirates\", \"Abu dhabi\", \"Municipality of Abu Dhabi City\", \"Ab\\u00fb Zabi\", \"Abou Dhabi\", \"Abu Zabi\", \"Abu Dhabi\", \"Abu Dhaby\", \"Capital of the United Arab Emirates\", \"Abu Dhabi (city)\", \"Abu Dhabi, U.A.E.\", \"Abu-Dabi\", \"Abu Dabhi\", \"Abu-Zabi\", \"Abu \\u1e92aby\", \"Abu Dabi\", \"\\u0623\\u0628\\u0648\\u0638\\u0628\\u064a\", \"Abu-Zaby\", \"\\u0623\\u0628\\u0648 \\u0638\\u0628\", \"Abu Zaby\", \"Ab\\u016b Z\\u0327aby\", \"Abou-Dhabi\", \"ABU DHABI\", \"Alu Zaly\", \"Abu-Dhabi\"]", "[\"Michael Tindall\", \"Mike Tindall\", \"MIKE TINDALL\"]", "[\"Odessa City Council\", \"\\u041e\\u0434\\u0435\\u0441\\u0430\", \"Sister cities of Odessa\", \"Eni-Dunia\", \"\\u041e\\u0434\\u0435\\u0441\\u0441\\u0430\", \"Odessa, Ukraine\", \"Odessa, USSR\", \"Chadzibejus\", \"Odesa, Ukraine\", \"City of Odessa\", \"Odessa, Russia\", \"UN/LOCODE:UAODS\", \"Odesa\", \"Hacibey\", \"Chad\\u017eib\\u0117jus\", \"Odessa\"]", "[\"Folkestone, Kent\", \"Folkestone, England\", \"Folkstone, Kent\", \"Folkestone\", \"Folkstone\", \"St Martins C.E.P. School Folkestone\"]", "[\"Cashville, Tennessee\", \"Nashville (TN)\", \"Nashville & Davidson County, Tennessee\", \"Nashville neighborhoods\", \"Nashville, USA\", \"Nashville, TN, USA\", \"Nashville-Davidson (city), Davidson County, TN\", \"Nashville-Davidson (city), TN\", \"Nash Vegas\", \"Nashville-Davidson (city), Tennessee\", \"Nashville, United States\", \"Nashville-Davidson, Tennessee\", \"Metropolitan Government of Nashville and Davidson County\", \"Nashville\", \"Nashville-Davidson\", \"Nashville, Tennessee\", \"Nashville-Davidson (city), Davidson County, Tennessee\", \"Nashville, TN\", \"The weather in Nashville\", \"Businesses in Nashville\", \"Nashville Tenn\", \"Nashville-Davidson County\", \"Nashville, tn\", \"Protestant vatican\", \"Little Kurdistan\", \"Capital of Tennessee\", \"Nashville-Davidson, TN\", \"Music City\", \"Nashville, Tennesee\", \"City of Nashville\", \"Little kurdistan\", \"Downtown Nashville\", \"Music City (disambiguation)\", \"Nashville (AFL)\", \"Neighborhoods of Nashville\", \"Nashvillian\", \"Music City USA\", \"South Nashville\", \"Nashville, Tenn.\", \"Nashville Tennessee\", \"Nashville Neighborhoods\", \"West Nashville\", \"North Nashville\", \"Nashville tn\"]", "[\"U2 band\", \"U2 (band)\", \"U2 (music)\", \"Flowering rose of glastonbury\", \"U2\", \"U2.com\", \"You 2\", \"Dennis Sheehan\", \"Flowering Rose of Glastonbury\", \"U2 Lyrics\"]", "[\"Lancelot du Lac\", \"Chevalier mal fet\", \"Evaine\", \"Lancelot of the Lake\", \"Sir launcelot du lake\", \"Aroundight\", \"Arondight\", \"Sir Lancelot\", \"Sir Lancelot Du Lac\", \"Lancelot\", \"Llenlleawg\", \"Joyousgard\", \"Sir Launcelot\", \"Sir lancealot\", \"Joyous Gard\", \"Llwch Llenlleawg\", \"Launcelot\", \"Joyous Guard\", \"Launcelot du Lac\", \"Joyous Garde\"]", "[\"Veggie lasagne\", \"Beef lasagne\", \"Beef lasagna\", \"Lazzania\", \"Lasagne verdi\", \"Lazagna\", \"Courgette Lasagne\", \"Vegetable Lasagna\", \"Lasagne\", \"Lasagnia\", \"Courgette lasagne\", \"Lasagna\", \"Lasagne al forno\", \"Lasagnotte\", \"LASAGNE\", \"Lasanga\", \"Vegetable lasagna\"]", "[\"Eisenhower Dwight\", \"Health issues of Dwight D. Eisenhower\", \"D. D. Eisenhower\", \"Dynamic Conservatism\", \"General Dwight Eisenhower\", \"David Jacob Eisenhower\", \"Dweight Eisenhower\", \"34th President of the United States\", \"Dwight E Eisenhower\", \"Eisehower\", \"President Dwight D. Eisenhower\", \"David Dwight Eisenhower\", \"Ike (nickname)\", \"Eisenhower\", \"Eishenhower\", \"General Dwight David Eisenhower\", \"Dwight D. Eisenhower\", \"President Eisenhower\", \"Ike Eisenhower\", \"Dwight Eisenhower\", \"D. Eisenhower\", \"General Eisenhower\", \"David D. Eisenhower\", \"President Dwight Eisenhower\", \"Dwight eisenhower\", \"Dwight Eisenhour\", \"Dwight Eisienhower\", \"Dwight Eisenhauer\", \"Dwight David Eisenhower\", \"Dwight D Eisenhower\", \"General of the Army Dwight Eisenhower\"]" ]
[ "What cereal is for kids, silly rabbit?", "Because of his advocation for the use of direct current (DC) for electric power distribution, Thomas Edison developed a bitter rivalry with which other genius who advocated alternating current (AC)?", "What does the musical term 'Crescendo' mean?", "What name is given to a second full moon in a month?", "Wiki, as in Wikipedia, is a word that means fast or quick - in what language?", "Can you name the last King of Egypt?", "'ETIHAD Airways' is based in which of the United Arab Emirates?", "The Princess Royal's daughter Zara is married to which English sportsman?", "Which Russian port was the scene of the Potemkin Mutiny in 1905?", "William Harvey the man who discovered the circulation of the blood was born in which English town?", "The daily newspaper The Tennessean' is published in which city?", "Which band performed a massive controversial concert at the Brandenberg Gate celebrating the 20th Anniversary of the fall of the Berlin Wall?", "According to legend, King Arthur's queen consort, Guinevere, had a torrid affair with which Knight of the Round Table?", "Which pasta dish is the favourite food of Garfield in the comic strip by Jim Davis ?", "Who is the U.S. interstate highway system named for?" ]
15
[ 5040, 5041, 5042, 5043, 5044, 5045, 5046, 5047, 5048, 5049, 5050, 5051, 5052, 5053, 5054 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What type of creature is an Antiguan Racer?\nQuestion 2: \"\"\"The Count of Monte Cristo\"\" was originally written in which language?\"\nQuestion 3: How is the Rowan tree also known in the UK?\nQuestion 4: The air we breathe is made up of 78.09% of what gas?\nQuestion 5: Dr Benjamin Spock wrote books on what subject?\nQuestion 6: In 2012, Charles Taylor was sentenced to 50 years in jail for war crimes, of which country had he been president?\nQuestion 7: Who lived at 221B Baker Street?\nQuestion 8: Which fruit is traditionally used in the recipe for Liverpool Tart?\nQuestion 9: What is the title of the 1944 film in which Lauren Bacall made her movie debut?\nQuestion 10: Who plays Mr Brown in the new Paddington Bear movie?\nQuestion 11: Which channel of water separates the two parts of Istanbul?\nQuestion 12: In the Sermon on the Mount, what was promised to the poor?\nQuestion 13: What traditional term from the late 1800s refers to the difference between a price paid for a company or business, and the actual (lower) 'book value' of its assets?\nQuestion 14: On which island was Napoleon Bonaparte born in 1769?\nQuestion 15: The white ball in snooker is called the what ball?", "role": "user" } ]
["[\"Snkae\", \"Snakes\", \"Serpentes\", \"Serpentigenous\", \"Snake anatomy\", \"\\ud83d\\udc0d\", \"Snakey\", \"Snake diet\", \"Snake locomotion\", \"Serpentiform\", \"Snake\", \"Snake food\", \"Snake (zoology)\", \"Coronellidae\", \"Snakiest\"]", "[\"Fran\\u00e7ais\", \"Francaise\", \"The French\", \"Frenchness\", \"French\", \"Francais\", \"French (disambiguation)\", \"Frrench\"]", "[\"Mountain ash (botany)\", \"Mountain-ash\", \"Mountain ash\", \"Mountain Ash (disambiguation)\", \"Mountain Ash\", \"Mountain ash (disambiguation)\"]", "[\"Nitrogens\", \"Noxious air\", \"N\\u2261N\", \"ATCvet code QV03AN04\", \"Atomic number 7\", \"S2 2S2 2P3\", \"Molecular nitrogen\", \"Nitrogenous\", \"Dinitrogen\", \"Nitrogen compounds\", \"Mephitic\", \"Nitrogen atom\", \"Nitrogen gas\", \"Industrial nitrogen\", \"Dinitrogen (n2)\", \"Burnt air\", \"Mephitic air\", \"Nitrum\", \"Azote\", \"Nitrogen gases\", \"Nitrogenation\", \"Element 7\", \"ATC code V03AN04\", \"Organic nitrogen\", \"Phlogisticated air\", \"Biological role of nitrogen\", \"Azotic air\", \"N\\u2082\", \"Nitrogen\", \"E941\"]", "[\"Childminding\", \"Child-care\", \"Program For Infant and Toddler Caregiving\", \"Child supervision\", \"Child care\", \"Childcare\", \"Child Care\", \"Babycare\", \"Afterschoolcare\", \"Baby care\"]", "[\"Liberia\", \"Liberia, West Africa\", \"Subdivisions of Liberia\", \"Liberian Republic\", \"Republic of Liberia\", \"Lib\\u00e9ria\", \"Republic of liberia\", \"ISO 3166-1:LR\", \"Name of Liberia\", \"Health care in Liberia\", \"LIBERIA, West Africa\", \"Sport in Liberia\"]", "[\"Sherlock Holmes (character)\", \"Inspector Holmes\", \"Holmes and Watson\", \"Shrlock holmes\", \"Elementary, My Dear Watson\", \"Sherlock Homes\", \"Sherlock Holmes\", \"Elementary, my dear Watson\", \"SherlockHolmes\", \"Shirlock Holmes\", \"Three pipe problem\", \"Sherlock-Holmes-Fallacy\", \"Sherlock holmes\"]", "[\"Lemon\", \"\\ud83c\\udf4b\", \"Lemon (fruit)\", \"Lemon juice\", \"Lemon oil\", \"Citrus x limon\", \"Lemons\", \"Nimbu\", \"Citrus \\u00d7limon\", \"Citrus \\u00d7 limon\", \"Citrus limon\"]", "[\"To Have And Have Not\", \"To Have and Have Not\", \"To Have and Have Not (novel)\", \"To Have and To Have Not\", \"To have and have not\", \"To have and to have not\"]", "[\"Hugh Bonneville\"]", "[\"Bosphorous\", \"Bosporus\", \"Bosforus\", \"Bosphorus Strait\", \"Istanbul Bogazi\", \"\\u0130stanbul Bo\\u011faz\\u0131\", \"Bosphoros\", \"Bosporous\", \"Bosphorus strait\", \"Bosporus Straits\", \"Istanbul Strait\", \"The Bosphorus\", \"Bosfor\", \"\\u0392\\u03cc\\u03c3\\u03c0\\u03bf\\u03c1\\u03bf\\u03c2\", \"Istanbul Straits\", \"\\u0130stanbul Bo\\u011faz\\u0131 (station)\", \"Bosphorus\", \"Bosporus Strait\", \"Strait of Istanbul\", \"Bosphorous straits\", \"B\\u00f3sporos\", \"Straight of Bosphorus\"]", "[\"Kingdom of Heaven\", \"Kingdom of Heaven (disambiguation)\", \"The Kingdom of Heaven\", \"Kingdom Of Heaven\", \"Kingdom of heaven\"]", "[\"Good Will\", \"Goodwill (disambiguation)\", \"Goodwill\", \"Good-will\", \"Good will\"]", "[\"La Corse\", \"Corsica, France\", \"Corsica (Journal)\", \"Cyrnos\", \"Cyrnus\", \"Corsic\", \"Corse\", \"Korsika\", \"Corsica\"]", "[\"Cueing\", \"Cue\", \"Cues\", \"CUE\", \"Cue (disambiguation)\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Snkae\", \"Snakes\", \"Serpentes\", \"Serpentigenous\", \"Snake anatomy\", \"\\ud83d\\udc0d\", \"Snakey\", \"Snake diet\", \"Snake locomotion\", \"Serpentiform\", \"Snake\", \"Snake food\", \"Snake (zoology)\", \"Coronellidae\", \"Snakiest\"]", "[\"Fran\\u00e7ais\", \"Francaise\", \"The French\", \"Frenchness\", \"French\", \"Francais\", \"French (disambiguation)\", \"Frrench\"]", "[\"Mountain ash (botany)\", \"Mountain-ash\", \"Mountain ash\", \"Mountain Ash (disambiguation)\", \"Mountain Ash\", \"Mountain ash (disambiguation)\"]", "[\"Nitrogens\", \"Noxious air\", \"N\\u2261N\", \"ATCvet code QV03AN04\", \"Atomic number 7\", \"S2 2S2 2P3\", \"Molecular nitrogen\", \"Nitrogenous\", \"Dinitrogen\", \"Nitrogen compounds\", \"Mephitic\", \"Nitrogen atom\", \"Nitrogen gas\", \"Industrial nitrogen\", \"Dinitrogen (n2)\", \"Burnt air\", \"Mephitic air\", \"Nitrum\", \"Azote\", \"Nitrogen gases\", \"Nitrogenation\", \"Element 7\", \"ATC code V03AN04\", \"Organic nitrogen\", \"Phlogisticated air\", \"Biological role of nitrogen\", \"Azotic air\", \"N\\u2082\", \"Nitrogen\", \"E941\"]", "[\"Childminding\", \"Child-care\", \"Program For Infant and Toddler Caregiving\", \"Child supervision\", \"Child care\", \"Childcare\", \"Child Care\", \"Babycare\", \"Afterschoolcare\", \"Baby care\"]", "[\"Liberia\", \"Liberia, West Africa\", \"Subdivisions of Liberia\", \"Liberian Republic\", \"Republic of Liberia\", \"Lib\\u00e9ria\", \"Republic of liberia\", \"ISO 3166-1:LR\", \"Name of Liberia\", \"Health care in Liberia\", \"LIBERIA, West Africa\", \"Sport in Liberia\"]", "[\"Sherlock Holmes (character)\", \"Inspector Holmes\", \"Holmes and Watson\", \"Shrlock holmes\", \"Elementary, My Dear Watson\", \"Sherlock Homes\", \"Sherlock Holmes\", \"Elementary, my dear Watson\", \"SherlockHolmes\", \"Shirlock Holmes\", \"Three pipe problem\", \"Sherlock-Holmes-Fallacy\", \"Sherlock holmes\"]", "[\"Lemon\", \"\\ud83c\\udf4b\", \"Lemon (fruit)\", \"Lemon juice\", \"Lemon oil\", \"Citrus x limon\", \"Lemons\", \"Nimbu\", \"Citrus \\u00d7limon\", \"Citrus \\u00d7 limon\", \"Citrus limon\"]", "[\"To Have And Have Not\", \"To Have and Have Not\", \"To Have and Have Not (novel)\", \"To Have and To Have Not\", \"To have and have not\", \"To have and to have not\"]", "[\"Hugh Bonneville\"]", "[\"Bosphorous\", \"Bosporus\", \"Bosforus\", \"Bosphorus Strait\", \"Istanbul Bogazi\", \"\\u0130stanbul Bo\\u011faz\\u0131\", \"Bosphoros\", \"Bosporous\", \"Bosphorus strait\", \"Bosporus Straits\", \"Istanbul Strait\", \"The Bosphorus\", \"Bosfor\", \"\\u0392\\u03cc\\u03c3\\u03c0\\u03bf\\u03c1\\u03bf\\u03c2\", \"Istanbul Straits\", \"\\u0130stanbul Bo\\u011faz\\u0131 (station)\", \"Bosphorus\", \"Bosporus Strait\", \"Strait of Istanbul\", \"Bosphorous straits\", \"B\\u00f3sporos\", \"Straight of Bosphorus\"]", "[\"Kingdom of Heaven\", \"Kingdom of Heaven (disambiguation)\", \"The Kingdom of Heaven\", \"Kingdom Of Heaven\", \"Kingdom of heaven\"]", "[\"Good Will\", \"Goodwill (disambiguation)\", \"Goodwill\", \"Good-will\", \"Good will\"]", "[\"La Corse\", \"Corsica, France\", \"Corsica (Journal)\", \"Cyrnos\", \"Cyrnus\", \"Corsic\", \"Corse\", \"Korsika\", \"Corsica\"]", "[\"Cueing\", \"Cue\", \"Cues\", \"CUE\", \"Cue (disambiguation)\"]" ]
[ "What type of creature is an Antiguan Racer?", "\"\"\"The Count of Monte Cristo\"\" was originally written in which language?\"", "How is the Rowan tree also known in the UK?", "The air we breathe is made up of 78.09% of what gas?", "Dr Benjamin Spock wrote books on what subject?", "In 2012, Charles Taylor was sentenced to 50 years in jail for war crimes, of which country had he been president?", "Who lived at 221B Baker Street?", "Which fruit is traditionally used in the recipe for Liverpool Tart?", "What is the title of the 1944 film in which Lauren Bacall made her movie debut?", "Who plays Mr Brown in the new Paddington Bear movie?", "Which channel of water separates the two parts of Istanbul?", "In the Sermon on the Mount, what was promised to the poor?", "What traditional term from the late 1800s refers to the difference between a price paid for a company or business, and the actual (lower) 'book value' of its assets?", "On which island was Napoleon Bonaparte born in 1769?", "The white ball in snooker is called the what ball?" ]
15
[ 66435, 66436, 66437, 66438, 66439, 66440, 66441, 66442, 66443, 66444, 66445, 66446, 66447, 66448, 66449 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Holly Golightly is the heroine of which novel by Truman Capote?\nQuestion 2: Named after her daughter, Ruth Handler invented which doll in 1959?\nQuestion 3: Gangnam, made famous in the song 'Gangnam Style' by Psy, is a wealthy suburb of which city?\nQuestion 4: Who is the wife of retired footballer Lee Chapman?\nQuestion 5: \"Cybill Shepherd and Bruce Willis starred as Madeline \"\"Maddie\"\" Hayes and David Addison in which TV series (1985 to 1989) that revolved around cases investigated by Blue Moon Detective Agency?\"\nQuestion 6: What is the name of the Roman god of gates, doors, doorways, beginnings, endings and time, which gave us the month of January?\nQuestion 7: The Mangla Dam is in which Asian country?\nQuestion 8: Which famous comedy double-act partner made the first ever UK mobile phone call, New Year's Day, 1985?\nQuestion 9: Who is the lead female protagonist of Benjamin Britten’s opera Gloriana?\nQuestion 10: Films. At which educational establishment, in the 1950s and 1960s was there blue murder , pure hell and a train robbery ?\nQuestion 11: Where do the Flintstones live?\nQuestion 12: Wooley Edge and Markfield are service stations situated on which British motorway?\nQuestion 13: What food is known as an 'alligator pear'?\nQuestion 14: Which remote island in the Outer Hebrides was evacuated in 1930 and is no longer inhabited?\nQuestion 15: What is the title of the first-person shooter science fiction video game, released by id Software in 1993?", "role": "user" } ]
["[\"Breakfast At Tiffanys\", \"Breakfast at Tiffanies\", \"Breakfast at Tiffany\\u2019s\", \"Breakfast at Tiffany\", \"Breakfast At Tiffany'S\", \"Breakfast at tiffany's\", \"Breakfast at Tiffany's (disambiguation)\", \"Breakfast at Tiffany's\", \"Breakfast At Tiffany's\", \"Breakfast at Tiffanys\"]", "[\"Barbie & Ken\", \"Barbie\", \"Barbie Millicent Robert\", \"Teen Talk Barbie\", \"Holiday Barbie\", \"Math is Hard Barbie\", \"Math is hard\", \"Barbie Millicent\", \"Barbie Mini-Kingdom\", \"Barbie girls\", \"Barbie Roberts\", \"Barbie Platinum lable\", \"Barbie Fashion\", \"Barbies\", \"Barbie doll\", \"Barbie Millicent Roberts\", \"Millicent Roberts\", \"Barbie syndrome\", \"BarbieGirls\", \"Barbara Millicent Roberts\", \"BarbieGirls.com\", \"Barbie Doll\", \"Christie (doll)\", \"ToyTalk\", \"Fashion Queen Barbie\", \"Barbara Handler\", \"Barbie Mini Kingdom\", \"Barbara Millicent\", \"Barbie dolls\", \"Math class is tough!\", \"Oreo Barbie\", \"Math is hard Barbie\", \"Willows, WI\", \"Barbie Platinum label\"]", "[\"Soul Special City\", \"Hanseong\", \"Seoul-T'ukpyolshi\", \"Seul\", \"Soul Special City, South Korea\", \"Gyeongseong\", \"Municipality of Seoul\", \"\\uc11c\\uc6b8\\uc2dc\", \"Hansong\", \"Seoulite\", \"Seoul castle\", \"Seulum\", \"Seoul\", \"Seoul-teukbyeolsi\", \"Seeoul\", \"\\u6f22\\u57ce\", \"Soul-t'ukpyolsi\", \"Sangwon Middle School (Seoul)\", \"S\\u014ful Special City, South Korea\", \"Seoul Municipality\", \"Soul Tukpyolsi\", \"Kyungsung\", \"Buildings and structures in Seoul\", \"Seoul Teugbyeolsi\", \"South Seoul\", \"Capital of South Korea\", \"Soul Teukbyeolsi\", \"UN/LOCODE:KRSEL\", \"Seoul Autonomous City\", \"\\uc11c\\uc6b8\\ud2b9\\ubcc4\\uc2dc\", \"S\\u014ful Special City\", \"Soul of Asia\", \"Economy of Seoul\", \"Hanayng\", \"Seoul.\", \"Seoul castle town\", \"Seoul Teukbyeolsi\", \"City of Seoul\", \"Five Grand Palaces\", \"Hwangseong\", \"Seulensis\", \"Seoul Central City\", \"Soul, South Korea\", \"Capitals of South Korea\", \"North Seoul\", \"Seoul City\", \"Shou'er\", \"Hanyang (Korea)\", \"SEOUL\", \"Special City of Seoul\", \"Shouer\", \"Hansung\", \"Autonomous City of Seoul\", \"Soeul\", \"S\\u014ful\", \"\\uc11c\\uc6b8\", \"Five Grand Palaces of Joseon-Dynasty Seoul\", \"Seoul, Republic of Korea\", \"\\u9996\\u723e\", \"Seoul, South Korea\", \"Seoul, the Republic of Korea\", \"Seoul, Korea\"]", "[\"LESLEY ASH\", \"Lesley Ash\", \"Leslie Ash\"]", "[\"Moonlighting\", \"Moonlighted\", \"Moonlighting (disambiguation)\"]", "[\"Janus (mythology)\", \"Janus Bifrons\", \"Janus (Roman religion)\", \"Janus in popular culture\", \"Janus\", \"Janus (god)\", \"Bifrons\", \"Ianus (mythology)\", \"Count bifrons\", \"Janus faced\", \"Janus-faced\", \"Ianus\", \"Janus Quadrifrons\", \"Janus Geminus\", \"Janus head\", \"Dianus\"]", "[\"Union of Pakistan\", \"Pakistani Federation\", \"PAKISTAN\", \"Pakastan\", \"Pakist\\u00e1n\", \"Packistan\", \"\\u067e\\u0627\\u06a9\\u0650\\u0633\\u062a\\u0627\\u0646\", \"\\u067e\\u0627\\u0643\\u0650\\u0633\\u062a\\u0627\\u0646\", \"Pakistana\", \"Name of Pakistan\", \"Etymology of Pakistan\", \"Pakistan\", \"Bakistan\", \"Pakistano\", \"Islamic Republic Of Pakistan\", \"Paquistan\", \"P\\u0101kist\\u0101n\", \"Paakistan\", \"IROP\", \"Paskitan\", \"Isl\\u0101m\\u012b Jumh\\u016briyah-yi P\\u0101kist\\u0101n\", \"Republic of Pakistan\", \"\\u0627\\u0633\\u0644\\u0627\\u0645\\u06cc \\u062c\\u0645\\u06c1\\u0648\\u0631\\u06cc\\u06c2 \\u067e\\u0627\\u0643\\u0650\\u0633\\u062a\\u0627\\u0646\", \"Islamic Republic of Pakistan\", \"\\u067e\\u0627\\u06a9\\u0633\\u062a\\u0627\\u0646\", \"Bakistaan\", \"Mumlikat-e-Khudad-e-Pakistan\", \"Pakist\\u0101na\", \"\\u0627\\u0633\\u0644\\u0627\\u0645\\u06cc \\u062c\\u0645\\u06c1\\u0648\\u0631\\u06cc\\u06c1 \\u067e\\u0627\\u06a9\\u0633\\u062a\\u0627\\u0646\", \"Isl\\u0101m\\u012b Jumh\\u016br\\u012b-ye P\\u0101kist\\u0101n\", \"ISO 3166-1:PK\", \"Pakland\", \"Pakistan, Islamic Republic\", \"Islamic Republic Pakistan\", \"The Islamic Republic Pakistan\", \"Pakisthan\", \"Federation of pakistan\", \"Al-Pakistan\", \"\\u0627\\u0633\\u0644\\u0627\\u0645\\u06cc \\u062c\\u0645\\u06c1\\u0648\\u0631\\u06cc\\u06c2 \\u067e\\u0627\\u06a9\\u0633\\u062a\\u0627\\u0646\", \"Paquistao\", \"Paquist\\u00e1n\", \"P\\u00e1kist\\u00e1n\", \"Pakasthan\", \"The Islamic Republic of Pakistan\", \"Pakistaan\", \"Pak-e-stan\", \"Pakistan.\", \"Islamic Pakistan\", \"Federation of Pakistan\", \"Pakstan\", \"Islamic State of Pakistan\", \"Pakistan, Islamic Republic of\", \"Bakstaan\", \"Pakistani Republic\", \"Pakistan's\", \"State of Pakistan\", \"\\u0628\\u0627\\u0643\\u0633\\u062a\\u0627\\u0646\", \"Pakistani state\", \"The State of Pakistan\", \"The Republic of Pakistan\", \"Al-Bakistan\", \"Paquist\\u00e3o\", \"Pakisatan\", \"Mumlikat e Khudad e Pakistan\", \"I.R. of Pakistan\", \"\\u067e\\u0627\\u06aa\\u0633\\u062a\\u0627\\u0646\", \"Pak-i-stan\"]", "[\"Ernie Wise\", \"Ernest Wiseman\"]", "[\"The Gloriana\", \"Queen Elisabeth of england\", \"Elizabeth the First\", \"Queene Elisabeth of England\", \"Bess of England\", \"Elizabeth I of Ireland\", \"Queen Elizabeth 1\", \"Queen Elisabeth I\", \"Elizabeth I (England)\", \"Elizabeth I of Great Britain\", \"Queen of England Elizabeth\", \"Queen Elizabeth the first\", \"Queen Elizabeth I of England\", \"Elizabeth the first\", \"Elizabeth I of the United Kingdom\", \"Queen of England Elizabeth I\", \"QEI\", \"Elizabeth I\", \"Queen Elizabeth of England\", \"Elisabeth 1st\", \"La Vita della Regina Elizabetta\", \"Elisabeth I of England\", \"Elisabeth of England\", \"Queen Elizabeth the First\", \"Elizabeth I of England\", \"Good Queen Bess\", \"Liz 1\", \"Virgin Queen\", \"Elizabeth 1\", \"Queen Elizabeth l\", \"Elizabeth of England\", \"Elizabeth I Tudor\", \"Elizabeth Tudor\", \"Elizabeth I, Queen of England\", \"Elizabeth the 1st\", \"Queen Elizabeth I\", \"Elizabeth i of england\", \"Elisabeth I\"]", "[\"St. Trinians School\", \"St. Trinian's School\", \"Beth Marie Centre\", \"The Beth Marie centre\", \"West heath girl's school\", \"Beth Marie center\", \"St Trinian's School\", \"St Trinian's School for Girls, Edinburgh\", \"The Beth Marie center\", \"St. Trinians\", \"Beth Marie centre\", \"New School at West Heath\", \"The Beth Marie Centre\", \"West Heath Girl's School\", \"Beth marie center\", \"ST TRINIAN'S\", \"St Trinnean's\", \"St. trinian\", \"New school at west heath\", \"West Heath girls' school\", \"Saint Trinians\", \"West heath School\", \"St Trinians School\", \"The New School At West Heath\", \"St Trinions\", \"St. Trinian's\", \"Beth marie Center\", \"St Trinians\", \"West Heath school\", \"West heath girls' school\", \"St Trinnean's School for Girls, Edinburgh\", \"Beth marie Centre\", \"The Beth Marie Center\", \"St Trinian\", \"The new school at west heath\", \"West Heath girl's school\", \"Beth Marie Center\", \"West Heath girls school\", \"St trinians\", \"West heath school\", \"St Trinian's\", \"St. Trinnean's School\"]", "[\"Bed of rock\", \"Subsurface\", \"Subsurface (geology)\", \"Bed rock\", \"Bedrock\"]", "[\"M1 (disambiguation)\", \"M01 highway\", \"M 1\", \"M.1\", \"M-1\", \"M-1 (highway)\", \"M1\", \"M01\", \"\\u041c-1\"]", "[\"Avocado pear\", \"Alligator pear\", \"Persea gratissima\", \"Avacado\", \"Advocado\", \"Avacada\", \"Avocado criollo\", \"Avocado\", \"Avocado Cultivation in California\", \"Butter fruit\", \"Avokado\", \"Persea americana\", \"Fuerte avocado\", \"Avocardo\", \"Avacado pit\", \"Avocados\", \"Avocodo\", \"Alligator Pear\"]", "[\"Saint Kilda (disambiguation)\", \"St Kilda (disambiguation)\", \"St. Kilda\", \"St. Kilda, Australia\", \"Saint Kilda\", \"Kilda\", \"St. Kilda (disambiguation)\", \"St Kilda\"]", "[\"Doom\", \"Doom (band)\", \"Doom (disambiguation)\", \"DOOOM\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Breakfast At Tiffanys\", \"Breakfast at Tiffanies\", \"Breakfast at Tiffany\\u2019s\", \"Breakfast at Tiffany\", \"Breakfast At Tiffany'S\", \"Breakfast at tiffany's\", \"Breakfast at Tiffany's (disambiguation)\", \"Breakfast at Tiffany's\", \"Breakfast At Tiffany's\", \"Breakfast at Tiffanys\"]", "[\"Barbie & Ken\", \"Barbie\", \"Barbie Millicent Robert\", \"Teen Talk Barbie\", \"Holiday Barbie\", \"Math is Hard Barbie\", \"Math is hard\", \"Barbie Millicent\", \"Barbie Mini-Kingdom\", \"Barbie girls\", \"Barbie Roberts\", \"Barbie Platinum lable\", \"Barbie Fashion\", \"Barbies\", \"Barbie doll\", \"Barbie Millicent Roberts\", \"Millicent Roberts\", \"Barbie syndrome\", \"BarbieGirls\", \"Barbara Millicent Roberts\", \"BarbieGirls.com\", \"Barbie Doll\", \"Christie (doll)\", \"ToyTalk\", \"Fashion Queen Barbie\", \"Barbara Handler\", \"Barbie Mini Kingdom\", \"Barbara Millicent\", \"Barbie dolls\", \"Math class is tough!\", \"Oreo Barbie\", \"Math is hard Barbie\", \"Willows, WI\", \"Barbie Platinum label\"]", "[\"Soul Special City\", \"Hanseong\", \"Seoul-T'ukpyolshi\", \"Seul\", \"Soul Special City, South Korea\", \"Gyeongseong\", \"Municipality of Seoul\", \"\\uc11c\\uc6b8\\uc2dc\", \"Hansong\", \"Seoulite\", \"Seoul castle\", \"Seulum\", \"Seoul\", \"Seoul-teukbyeolsi\", \"Seeoul\", \"\\u6f22\\u57ce\", \"Soul-t'ukpyolsi\", \"Sangwon Middle School (Seoul)\", \"S\\u014ful Special City, South Korea\", \"Seoul Municipality\", \"Soul Tukpyolsi\", \"Kyungsung\", \"Buildings and structures in Seoul\", \"Seoul Teugbyeolsi\", \"South Seoul\", \"Capital of South Korea\", \"Soul Teukbyeolsi\", \"UN/LOCODE:KRSEL\", \"Seoul Autonomous City\", \"\\uc11c\\uc6b8\\ud2b9\\ubcc4\\uc2dc\", \"S\\u014ful Special City\", \"Soul of Asia\", \"Economy of Seoul\", \"Hanayng\", \"Seoul.\", \"Seoul castle town\", \"Seoul Teukbyeolsi\", \"City of Seoul\", \"Five Grand Palaces\", \"Hwangseong\", \"Seulensis\", \"Seoul Central City\", \"Soul, South Korea\", \"Capitals of South Korea\", \"North Seoul\", \"Seoul City\", \"Shou'er\", \"Hanyang (Korea)\", \"SEOUL\", \"Special City of Seoul\", \"Shouer\", \"Hansung\", \"Autonomous City of Seoul\", \"Soeul\", \"S\\u014ful\", \"\\uc11c\\uc6b8\", \"Five Grand Palaces of Joseon-Dynasty Seoul\", \"Seoul, Republic of Korea\", \"\\u9996\\u723e\", \"Seoul, South Korea\", \"Seoul, the Republic of Korea\", \"Seoul, Korea\"]", "[\"LESLEY ASH\", \"Lesley Ash\", \"Leslie Ash\"]", "[\"Moonlighting\", \"Moonlighted\", \"Moonlighting (disambiguation)\"]", "[\"Janus (mythology)\", \"Janus Bifrons\", \"Janus (Roman religion)\", \"Janus in popular culture\", \"Janus\", \"Janus (god)\", \"Bifrons\", \"Ianus (mythology)\", \"Count bifrons\", \"Janus faced\", \"Janus-faced\", \"Ianus\", \"Janus Quadrifrons\", \"Janus Geminus\", \"Janus head\", \"Dianus\"]", "[\"Union of Pakistan\", \"Pakistani Federation\", \"PAKISTAN\", \"Pakastan\", \"Pakist\\u00e1n\", \"Packistan\", \"\\u067e\\u0627\\u06a9\\u0650\\u0633\\u062a\\u0627\\u0646\", \"\\u067e\\u0627\\u0643\\u0650\\u0633\\u062a\\u0627\\u0646\", \"Pakistana\", \"Name of Pakistan\", \"Etymology of Pakistan\", \"Pakistan\", \"Bakistan\", \"Pakistano\", \"Islamic Republic Of Pakistan\", \"Paquistan\", \"P\\u0101kist\\u0101n\", \"Paakistan\", \"IROP\", \"Paskitan\", \"Isl\\u0101m\\u012b Jumh\\u016briyah-yi P\\u0101kist\\u0101n\", \"Republic of Pakistan\", \"\\u0627\\u0633\\u0644\\u0627\\u0645\\u06cc \\u062c\\u0645\\u06c1\\u0648\\u0631\\u06cc\\u06c2 \\u067e\\u0627\\u0643\\u0650\\u0633\\u062a\\u0627\\u0646\", \"Islamic Republic of Pakistan\", \"\\u067e\\u0627\\u06a9\\u0633\\u062a\\u0627\\u0646\", \"Bakistaan\", \"Mumlikat-e-Khudad-e-Pakistan\", \"Pakist\\u0101na\", \"\\u0627\\u0633\\u0644\\u0627\\u0645\\u06cc \\u062c\\u0645\\u06c1\\u0648\\u0631\\u06cc\\u06c1 \\u067e\\u0627\\u06a9\\u0633\\u062a\\u0627\\u0646\", \"Isl\\u0101m\\u012b Jumh\\u016br\\u012b-ye P\\u0101kist\\u0101n\", \"ISO 3166-1:PK\", \"Pakland\", \"Pakistan, Islamic Republic\", \"Islamic Republic Pakistan\", \"The Islamic Republic Pakistan\", \"Pakisthan\", \"Federation of pakistan\", \"Al-Pakistan\", \"\\u0627\\u0633\\u0644\\u0627\\u0645\\u06cc \\u062c\\u0645\\u06c1\\u0648\\u0631\\u06cc\\u06c2 \\u067e\\u0627\\u06a9\\u0633\\u062a\\u0627\\u0646\", \"Paquistao\", \"Paquist\\u00e1n\", \"P\\u00e1kist\\u00e1n\", \"Pakasthan\", \"The Islamic Republic of Pakistan\", \"Pakistaan\", \"Pak-e-stan\", \"Pakistan.\", \"Islamic Pakistan\", \"Federation of Pakistan\", \"Pakstan\", \"Islamic State of Pakistan\", \"Pakistan, Islamic Republic of\", \"Bakstaan\", \"Pakistani Republic\", \"Pakistan's\", \"State of Pakistan\", \"\\u0628\\u0627\\u0643\\u0633\\u062a\\u0627\\u0646\", \"Pakistani state\", \"The State of Pakistan\", \"The Republic of Pakistan\", \"Al-Bakistan\", \"Paquist\\u00e3o\", \"Pakisatan\", \"Mumlikat e Khudad e Pakistan\", \"I.R. of Pakistan\", \"\\u067e\\u0627\\u06aa\\u0633\\u062a\\u0627\\u0646\", \"Pak-i-stan\"]", "[\"Ernie Wise\", \"Ernest Wiseman\"]", "[\"The Gloriana\", \"Queen Elisabeth of england\", \"Elizabeth the First\", \"Queene Elisabeth of England\", \"Bess of England\", \"Elizabeth I of Ireland\", \"Queen Elizabeth 1\", \"Queen Elisabeth I\", \"Elizabeth I (England)\", \"Elizabeth I of Great Britain\", \"Queen of England Elizabeth\", \"Queen Elizabeth the first\", \"Queen Elizabeth I of England\", \"Elizabeth the first\", \"Elizabeth I of the United Kingdom\", \"Queen of England Elizabeth I\", \"QEI\", \"Elizabeth I\", \"Queen Elizabeth of England\", \"Elisabeth 1st\", \"La Vita della Regina Elizabetta\", \"Elisabeth I of England\", \"Elisabeth of England\", \"Queen Elizabeth the First\", \"Elizabeth I of England\", \"Good Queen Bess\", \"Liz 1\", \"Virgin Queen\", \"Elizabeth 1\", \"Queen Elizabeth l\", \"Elizabeth of England\", \"Elizabeth I Tudor\", \"Elizabeth Tudor\", \"Elizabeth I, Queen of England\", \"Elizabeth the 1st\", \"Queen Elizabeth I\", \"Elizabeth i of england\", \"Elisabeth I\"]", "[\"St. Trinians School\", \"St. Trinian's School\", \"Beth Marie Centre\", \"The Beth Marie centre\", \"West heath girl's school\", \"Beth Marie center\", \"St Trinian's School\", \"St Trinian's School for Girls, Edinburgh\", \"The Beth Marie center\", \"St. Trinians\", \"Beth Marie centre\", \"New School at West Heath\", \"The Beth Marie Centre\", \"West Heath Girl's School\", \"Beth marie center\", \"ST TRINIAN'S\", \"St Trinnean's\", \"St. trinian\", \"New school at west heath\", \"West Heath girls' school\", \"Saint Trinians\", \"West heath School\", \"St Trinians School\", \"The New School At West Heath\", \"St Trinions\", \"St. Trinian's\", \"Beth marie Center\", \"St Trinians\", \"West Heath school\", \"West heath girls' school\", \"St Trinnean's School for Girls, Edinburgh\", \"Beth marie Centre\", \"The Beth Marie Center\", \"St Trinian\", \"The new school at west heath\", \"West Heath girl's school\", \"Beth Marie Center\", \"West Heath girls school\", \"St trinians\", \"West heath school\", \"St Trinian's\", \"St. Trinnean's School\"]", "[\"Bed of rock\", \"Subsurface\", \"Subsurface (geology)\", \"Bed rock\", \"Bedrock\"]", "[\"M1 (disambiguation)\", \"M01 highway\", \"M 1\", \"M.1\", \"M-1\", \"M-1 (highway)\", \"M1\", \"M01\", \"\\u041c-1\"]", "[\"Avocado pear\", \"Alligator pear\", \"Persea gratissima\", \"Avacado\", \"Advocado\", \"Avacada\", \"Avocado criollo\", \"Avocado\", \"Avocado Cultivation in California\", \"Butter fruit\", \"Avokado\", \"Persea americana\", \"Fuerte avocado\", \"Avocardo\", \"Avacado pit\", \"Avocados\", \"Avocodo\", \"Alligator Pear\"]", "[\"Saint Kilda (disambiguation)\", \"St Kilda (disambiguation)\", \"St. Kilda\", \"St. Kilda, Australia\", \"Saint Kilda\", \"Kilda\", \"St. Kilda (disambiguation)\", \"St Kilda\"]", "[\"Doom\", \"Doom (band)\", \"Doom (disambiguation)\", \"DOOOM\"]" ]
[ "Holly Golightly is the heroine of which novel by Truman Capote?", "Named after her daughter, Ruth Handler invented which doll in 1959?", "Gangnam, made famous in the song 'Gangnam Style' by Psy, is a wealthy suburb of which city?", "Who is the wife of retired footballer Lee Chapman?", "\"Cybill Shepherd and Bruce Willis starred as Madeline \"\"Maddie\"\" Hayes and David Addison in which TV series (1985 to 1989) that revolved around cases investigated by Blue Moon Detective Agency?\"", "What is the name of the Roman god of gates, doors, doorways, beginnings, endings and time, which gave us the month of January?", "The Mangla Dam is in which Asian country?", "Which famous comedy double-act partner made the first ever UK mobile phone call, New Year's Day, 1985?", "Who is the lead female protagonist of Benjamin Britten’s opera Gloriana?", "Films. At which educational establishment, in the 1950s and 1960s was there blue murder , pure hell and a train robbery ?", "Where do the Flintstones live?", "Wooley Edge and Markfield are service stations situated on which British motorway?", "What food is known as an 'alligator pear'?", "Which remote island in the Outer Hebrides was evacuated in 1930 and is no longer inhabited?", "What is the title of the first-person shooter science fiction video game, released by id Software in 1993?" ]
15
[ 30390, 30391, 30392, 30393, 30394, 30395, 30396, 30397, 30398, 30399, 30400, 30401, 30402, 30403, 30404 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Following the Twelve days of Christmas, on what date is the twelfth night?\nQuestion 2: What is the term for a virtual barrier between two corporate departments, which often for legal reasons, must not share information? - Spanish fence; Chinese wall; Boston Barricade; or Bouquet of barbed wire.\nQuestion 3: Joe Frazier said ‘He’s phoney, using his blackness to get his way’, about which other boxer?\nQuestion 4: What kind of orchard did Chekhov write a play about?\nQuestion 5: What Frankish king was crowned emperor on Christmas day in 800 A.D.?\nQuestion 6: Mary Lennox, Colin and Dickon are all characters in which children’s novel?\nQuestion 7: In which city are the brewers S A Brain & Son based?\nQuestion 8: In Japan the word Mikado originally referred to what?\nQuestion 9: Which river flows through Rochester and Maidstone?\nQuestion 10: What is the occupation of Oliver Smallbridge, played by Windsor Davies, and Simon Peel, played by Donald Sinden in the long running sitcom Never the Twain?\nQuestion 11: The terms curd and whey are associated with making what?\nQuestion 12: Which 2003 Sofia Coppola film is set in the Park Hyatt Hotel, Tokyo?\nQuestion 13: Playing for Blackburn Rovers, who is the only Congolese currently registered as a Premier League footballer?\nQuestion 14: Who composed the incidental music to Ibsen's play 'Peer Gynt'?\nQuestion 15: On which game show of the 1980s was Una Stubbs a regular team captain?", "role": "user" } ]
["[\"January 6\", \"January 6th\", \"6th January\", \"Jan 06\", \"January 06\", \"Jan 6\", \"6 January\"]", "[\"Chinese wall (financial)\", \"Chinese Wall\", \"Business Information Barrier\", \"Chinese walls\", \"Clean-room engineering\", \"Chinese wall\", \"Clean-room reverse engineering\", \"Business Information Barriers\"]", "[\"Float like a butter fly sting like a bee\", \"Louisville lip\", \"Ali shuffle\", \"Float like a butterfly and sting like a bee\", \"Cassius Marcellus Clay Junior\", \"Muhummad Ali\", \"Maryum Ali\", \"Cassius X\", \"Cassius Marcellus Clay, Junior\", \"Louisville Lip\", \"Muhammad Ali\", \"Muhammud Ali\", \"Khalilah 'Belinda' Ali\", \"Cassius Clay Junior\", \"Float like a butterfly sting like a bee\", \"Muhammad Ali (boxer)\", \"Cassius Marcellus Clay, Jr.\", \"Sonji Roi\", \"Ale Muhammad\", \"Cassius Marcellus Clay, Jr\", \"Cassius Marcellus Clay Jr.\", \"Cassius Marcellus Clay (Muhammad Ali)\", \"Cassius Clay, Junior\", \"Mohammed Al\\u00ec\", \"Cassius Marcellus Clay Jr\", \"Muhamad Ali\", \"Yolanda Williams\", \"I am the greatest!\", \"Ali, Muhammad\", \"Cassius Clay\", \"Muhammet ali\", \"Yolanda 'Lonnie' Ali\", \"I am the greatest\", \"Cassius Clay, Jr.\", \"Muhammed Ali\", \"Cassius Clay Jr\", \"Cassius clay\", \"Lonnie Ali\", \"Cassius Clay, Jr\", \"May May\"]", "[\"Cherry tree\", \"Cherries\", \"Cherrytree\", \"Cherry\", \"Razzcherry\", \"\\ud83c\\udf52\", \"Culture of cherry\", \"Razzcherries\", \"Cherry trees\", \"Cherry pit\", \"Cherry juice\", \"Cherise\", \"Cherry (fruit)\"]", "[\"Gisela, daughter of Charlemagne\", \"Regina (concubine)\", \"Charlemagne\", \"Karl der gro\\u00dfe\", \"Emperor Charlemagne\", \"Karl der Grosse\", \"Charlimagne\", \"Charlemagne to the mughals\", \"Charlesmagne\", \"Karl I der Gro\\u00dfe\", \"Carlomagno\", \"Charlegmagne\", \"Descent from Charlemagne\", \"Karl I, Holy Roman Emperor\", \"Carl the Great\", \"Emperor Charles I\", \"Charles the Great\", \"Charlemange, Holy Roman Emperor\", \"Karolus Magnus\", \"Charlmagne\", \"Charlemaine\", \"Carlo the Great\", \"Emperor of the West and Frankish king Charles I\", \"Charles I, Holy Roman Emperor\", \"Charlemain\", \"Pater Europae\", \"Charlamagne\", \"Carolus I\", \"Saint Charles the Great\", \"Gisela, daugher of Charlemagne\", \"Charles I of France\", \"December 25, 800 AD\", \"Carolus Magnus\", \"Charlemagn\", \"Frankish king Charles I\", \"Charlemagne the great\", \"Karl the Great\", \"Karl der Gro\\u00dfe\", \"Charlemange\", \"Karl der grosse\", \"Charlemegne\", \"Charles I of Aquitaine\", \"Charles le Magne\", \"Charlimaine\", \"Charlamaine\"]", "[\"Return to the Secret Garden\", \"Weatherstaff\", \"Susan Sowerby\", \"The Secret Garden (2014 film)\", \"The secret garden list of characters\", \"Misselthwaite Manor\", \"Colin Craven\", \"Ben Weatherstaff\", \"Dickon Sowerby\", \"Lilias Craven\", \"Archie Craven\", \"Mary Lennox\", \"Mistress Mary\", \"The Secret Garden\", \"Martha Sowerby\", \"Archibald Craven\", \"Sarah Ann Medlock\", \"Mistlethwait Manor\", \"Martha Phoebe Sowerby\", \"Mistlethwaite Manor\", \"Back to the secret garden\"]", "[\"City of Cardiff\", \"County Borough of Cardiff\", \"Caerdydd (city)\", \"Caerdydd\", \"Cardiff North (geographical area)\", \"Trowbridge Primary School\", \"The weather in Cardiff\", \"Cardiff East (geographical area)\", \"Cardiff West (geographical area)\", \"East Cardiff\", \"Cardff\", \"Cardiff/Caerdydd\", \"Cardiffians\", \"Trowbridge Junior School\", \"Cardiff South (geographical area)\", \"Cardiff\", \"UN/LOCODE:GBCDF\", \"Trowbridge Infant School\", \"Cardiff, Wales\", \"029\", \"Caerdydd (county borough)\"]", "[\"An, Emperor\", \"Emperor An (disambiguation)\", \"Emperor An\", \"The emperor\"]", "[\"County of the Medway Towns\", \"Medway\", \"Medway Council Act 2001\", \"Medway Towns\", \"Medway Council Act 2004\", \"Borough of Medway\", \"Medway Towns, Kent\", \"Medway UA\"]", "[\"ANTIQUE DEALERS\"]", "[\"Cheeses\", \"Chese\", \"Coagulated milk curd\", \"CHEESE\", \"Mouldy cheese\", \"Cheese wheel\", \"Cheese\", \"\\ud83e\\uddc0\", \"Chees\", \"Cheeze\", \"Cheese powder\"]", "[\"Lost in translation\", \"Lost in Translation\", \"Lost in Translation (disambiguation)\", \"Lost In Translation\"]", "[\"Chris Samba\", \"Chris samba\", \"Christopher Veijeany Samba\", \"Veijeany Christopher Samba\", \"CHRISTOPHER SAMBA\", \"Christopher Samba-Veijeany\", \"Christopher Samba\"]", "[\"Edvard Hagerup Grieg\", \"Edvard Grieg\", \"Edvard Greig\", \"EDWARD GRIEG\", \"Grieg\", \"Edvard grieg\", \"Edward Grig\", \"Edward Grieg\", \"Eduard Grieg\"]", "[\"GIVE US A CLUE\", \"Give Us A Clue\", \"Give Us a Clue\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"January 6\", \"January 6th\", \"6th January\", \"Jan 06\", \"January 06\", \"Jan 6\", \"6 January\"]", "[\"Chinese wall (financial)\", \"Chinese Wall\", \"Business Information Barrier\", \"Chinese walls\", \"Clean-room engineering\", \"Chinese wall\", \"Clean-room reverse engineering\", \"Business Information Barriers\"]", "[\"Float like a butter fly sting like a bee\", \"Louisville lip\", \"Ali shuffle\", \"Float like a butterfly and sting like a bee\", \"Cassius Marcellus Clay Junior\", \"Muhummad Ali\", \"Maryum Ali\", \"Cassius X\", \"Cassius Marcellus Clay, Junior\", \"Louisville Lip\", \"Muhammad Ali\", \"Muhammud Ali\", \"Khalilah 'Belinda' Ali\", \"Cassius Clay Junior\", \"Float like a butterfly sting like a bee\", \"Muhammad Ali (boxer)\", \"Cassius Marcellus Clay, Jr.\", \"Sonji Roi\", \"Ale Muhammad\", \"Cassius Marcellus Clay, Jr\", \"Cassius Marcellus Clay Jr.\", \"Cassius Marcellus Clay (Muhammad Ali)\", \"Cassius Clay, Junior\", \"Mohammed Al\\u00ec\", \"Cassius Marcellus Clay Jr\", \"Muhamad Ali\", \"Yolanda Williams\", \"I am the greatest!\", \"Ali, Muhammad\", \"Cassius Clay\", \"Muhammet ali\", \"Yolanda 'Lonnie' Ali\", \"I am the greatest\", \"Cassius Clay, Jr.\", \"Muhammed Ali\", \"Cassius Clay Jr\", \"Cassius clay\", \"Lonnie Ali\", \"Cassius Clay, Jr\", \"May May\"]", "[\"Cherry tree\", \"Cherries\", \"Cherrytree\", \"Cherry\", \"Razzcherry\", \"\\ud83c\\udf52\", \"Culture of cherry\", \"Razzcherries\", \"Cherry trees\", \"Cherry pit\", \"Cherry juice\", \"Cherise\", \"Cherry (fruit)\"]", "[\"Gisela, daughter of Charlemagne\", \"Regina (concubine)\", \"Charlemagne\", \"Karl der gro\\u00dfe\", \"Emperor Charlemagne\", \"Karl der Grosse\", \"Charlimagne\", \"Charlemagne to the mughals\", \"Charlesmagne\", \"Karl I der Gro\\u00dfe\", \"Carlomagno\", \"Charlegmagne\", \"Descent from Charlemagne\", \"Karl I, Holy Roman Emperor\", \"Carl the Great\", \"Emperor Charles I\", \"Charles the Great\", \"Charlemange, Holy Roman Emperor\", \"Karolus Magnus\", \"Charlmagne\", \"Charlemaine\", \"Carlo the Great\", \"Emperor of the West and Frankish king Charles I\", \"Charles I, Holy Roman Emperor\", \"Charlemain\", \"Pater Europae\", \"Charlamagne\", \"Carolus I\", \"Saint Charles the Great\", \"Gisela, daugher of Charlemagne\", \"Charles I of France\", \"December 25, 800 AD\", \"Carolus Magnus\", \"Charlemagn\", \"Frankish king Charles I\", \"Charlemagne the great\", \"Karl the Great\", \"Karl der Gro\\u00dfe\", \"Charlemange\", \"Karl der grosse\", \"Charlemegne\", \"Charles I of Aquitaine\", \"Charles le Magne\", \"Charlimaine\", \"Charlamaine\"]", "[\"Return to the Secret Garden\", \"Weatherstaff\", \"Susan Sowerby\", \"The Secret Garden (2014 film)\", \"The secret garden list of characters\", \"Misselthwaite Manor\", \"Colin Craven\", \"Ben Weatherstaff\", \"Dickon Sowerby\", \"Lilias Craven\", \"Archie Craven\", \"Mary Lennox\", \"Mistress Mary\", \"The Secret Garden\", \"Martha Sowerby\", \"Archibald Craven\", \"Sarah Ann Medlock\", \"Mistlethwait Manor\", \"Martha Phoebe Sowerby\", \"Mistlethwaite Manor\", \"Back to the secret garden\"]", "[\"City of Cardiff\", \"County Borough of Cardiff\", \"Caerdydd (city)\", \"Caerdydd\", \"Cardiff North (geographical area)\", \"Trowbridge Primary School\", \"The weather in Cardiff\", \"Cardiff East (geographical area)\", \"Cardiff West (geographical area)\", \"East Cardiff\", \"Cardff\", \"Cardiff/Caerdydd\", \"Cardiffians\", \"Trowbridge Junior School\", \"Cardiff South (geographical area)\", \"Cardiff\", \"UN/LOCODE:GBCDF\", \"Trowbridge Infant School\", \"Cardiff, Wales\", \"029\", \"Caerdydd (county borough)\"]", "[\"An, Emperor\", \"Emperor An (disambiguation)\", \"Emperor An\", \"The emperor\"]", "[\"County of the Medway Towns\", \"Medway\", \"Medway Council Act 2001\", \"Medway Towns\", \"Medway Council Act 2004\", \"Borough of Medway\", \"Medway Towns, Kent\", \"Medway UA\"]", "[\"ANTIQUE DEALERS\"]", "[\"Cheeses\", \"Chese\", \"Coagulated milk curd\", \"CHEESE\", \"Mouldy cheese\", \"Cheese wheel\", \"Cheese\", \"\\ud83e\\uddc0\", \"Chees\", \"Cheeze\", \"Cheese powder\"]", "[\"Lost in translation\", \"Lost in Translation\", \"Lost in Translation (disambiguation)\", \"Lost In Translation\"]", "[\"Chris Samba\", \"Chris samba\", \"Christopher Veijeany Samba\", \"Veijeany Christopher Samba\", \"CHRISTOPHER SAMBA\", \"Christopher Samba-Veijeany\", \"Christopher Samba\"]", "[\"Edvard Hagerup Grieg\", \"Edvard Grieg\", \"Edvard Greig\", \"EDWARD GRIEG\", \"Grieg\", \"Edvard grieg\", \"Edward Grig\", \"Edward Grieg\", \"Eduard Grieg\"]", "[\"GIVE US A CLUE\", \"Give Us A Clue\", \"Give Us a Clue\"]" ]
[ "Following the Twelve days of Christmas, on what date is the twelfth night?", "What is the term for a virtual barrier between two corporate departments, which often for legal reasons, must not share information? - Spanish fence; Chinese wall; Boston Barricade; or Bouquet of barbed wire.", "Joe Frazier said ‘He’s phoney, using his blackness to get his way’, about which other boxer?", "What kind of orchard did Chekhov write a play about?", "What Frankish king was crowned emperor on Christmas day in 800 A.D.?", "Mary Lennox, Colin and Dickon are all characters in which children’s novel?", "In which city are the brewers S A Brain & Son based?", "In Japan the word Mikado originally referred to what?", "Which river flows through Rochester and Maidstone?", "What is the occupation of Oliver Smallbridge, played by Windsor Davies, and Simon Peel, played by Donald Sinden in the long running sitcom Never the Twain?", "The terms curd and whey are associated with making what?", "Which 2003 Sofia Coppola film is set in the Park Hyatt Hotel, Tokyo?", "Playing for Blackburn Rovers, who is the only Congolese currently registered as a Premier League footballer?", "Who composed the incidental music to Ibsen's play 'Peer Gynt'?", "On which game show of the 1980s was Una Stubbs a regular team captain?" ]
15
[ 35715, 35716, 35717, 35718, 35719, 35720, 35721, 35722, 35723, 35724, 35725, 35726, 35727, 35728, 35729 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: In what game might you hit, stand, split, or double down?\nQuestion 2: Which religious faith was founded in the 19th century, in what is now Iran and has its headquarters in Haifa(Israel)?\nQuestion 3: What is the capital of Egypt\nQuestion 4: \"\"\"Devil\"\" was the pet wolf of which comic strip character?\"\nQuestion 5: Lady Gaga cancelled her 2012 tour to which country after threats of chaos from protestors?\nQuestion 6: According to the proverb what is too much for one enough for two but not enough for three\nQuestion 7: Who is the current presenter of Desert Island Discs on Radio 4?\nQuestion 8: Delphinus delphis is the scientific name for which creature?\nQuestion 9: The world's first iron bridge was completed in 1781 at Coalbrookdale, which river does it span?\nQuestion 10: What is the capital of Switzerland\nQuestion 11: Who wrote ‘The Secret Diary of Adrian Mole’?\nQuestion 12: The metric prefix femto is shown as ten to the power of minus what?\nQuestion 13: Doris Day plays which 1920’s and 30’s singer and actress in the 1955 film ‘Love Me or Leave Me’?\nQuestion 14: What is the most common name of the British bird Pandon Haliaetus, also known as the sea hawk, fish eagle or fish hawk?\nQuestion 15: Who played the Cornish based detective, Wycliffe", "role": "user" } ]
["[\"Doubling down\", \"Charlies (blackjack)\", \"Pontoon (cards)\", \"Basic strategy\", \"Five Card Charlie\", \"21st Century Blackjack\", \"Vingt-et-un\", \"Blackjack\", \"Five card charlie\", \"Pitch blackjack\", \"Online blackjack\", \"Blackjack rules\", \"BlackJack\"]", "[\"Baha'I\", \"Baha'\", \"Baha'iyyih\", \"Bahaist\", \"Baha'is\", \"Bah\\u00e1'\\u00ed Cause\", \"Bah\\u00e1\\u00ed Faith\", \"Baha'i religion\", \"Bakhai\", \"The Bah\\u00e1'\\u00eds\", \"Bah\\u00e1'\\u00ed Faith\", \"Non-Baha'i\", \"Bah\\u00e1'\\u00eds\", \"The Bahai\", \"Bah\\u00e1'\\u00ed Faith (Haifa)\", \"Bah\\u00e1\\u2019\\u00ed\", \"Bahaism\", \"Baha\\u2019\\u00ed\", \"Baha\\u2019i\", \"The Baha'i\", \"Baha'i\", \"Bahism\", \"Bahai'ism\", \"Bah\\u00e1'\\u00ed\", \"Baa'hai Faith\", \"Baha'ism\", \"Bah\\u00e1\\u2019\\u00eds\", \"Bahaii\", \"Bah\\u00e1'i Faith\", \"The Baha'is\", \"Bah\\u00e1\\u2019\\u00ed Faith\", \"Bah\\u00e1'\\u00ed faith\", \"Baha\\u2019i Faith\", \"Baha\\u00ed Faith\", \"Bahai World Faith\", \"The Bahai Faith\", \"Bah\\u00e1i Faith\", \"Bahaists\", \"Bah\\u00e1 faith\", \"Baha'i faith\", \"Bah\\u00e1'\\u00ed art\", \"Bah\\u00e1\\u00b4i Faith\", \"Bahai art\", \"Baha'iism\", \"Most great infallibility\", \"Bah\\u00e1'iyyat\", \"Infallibility (Baha'i)\", \"Bah\\u00e1\\u00ed\", \"Baha'i Religion\", \"Bahaiist\", \"Bahai\", \"Bah\\u00e1'\\u00ed+Faith\", \"Baha'i Community\", \"Bahais\", \"Baha'\\u00ed Faith\", \"Bahaiists\", \"Baha'iyyah\", \"Non-Bah\\u00e1'\\u00ed\", \"Baha'i art\", \"Baha'i World Faith\", \"Ba'hai\", \"Bahaiism\", \"BAHA'I\", \"Baha'i youth\", \"The Baha'i Faith\", \"The Baha'i Community\", \"Baha'i Faith (Haifa)\", \"Baha\\u2019is\", \"Baha'i+Faith\", \"Infallibility (Bah\\u00e1'\\u00ed)\", \"Bah\\u00e1\\u00edsm\", \"The Bah\\u00e1'\\u00ed Faith\", \"Bahai religion\", \"Baha'i Cause\", \"Bahai Faith\", \"Baha faith\", \"Bah\\u00e1'\\u00ed World Faith\", \"Bahai faith\", \"Bah\\u00e1'iyya\", \"Baha'i Faith\"]", "[\"Al-Q\\u0101hirah\", \"Cairo in the middle ages\", \"Al-Qahira\", \"Abbaseya\", \"The weather in Cairo\", \"Qahirah\", \"Pollution in Cairo\", \"El Zaher\", \"Air pollution in Cairo\", \"Ancient cairo\", \"Qahira\", \"Al-Q\\u0101hira\", \"El-Qahira\", \"\\u0627\\u0644\\u0642\\u0627\\u0647\\u0631\\u0629\", \"The Capital Cairo\", \"History of Cairo\", \"Al-Q\", \"Cairo (Egypt)\", \"Al-Kahir\", \"Cairene\", \"Al Qahira\", \"Cairo, Arab Republic of Egypt\", \"Demographics of Cairo\", \"History of cairo\", \"Cairo, EG\", \"Al-Qahirah\", \"El Q\\u00e2hira\", \"Classical cairo\", \"Cairo\", \"Q\\u0101hirah\", \"UN/LOCODE:EGCAI\", \"Abdeen (Cairo)\", \"Cairo, Egypt\", \"El Qahira\"]", "[\"For those who came in late\", \"Phantom (comic)\", \"List of Phantom publications from Moonstone Books\", \"Fantomen\", \"Singh Brotherhood\", \"Ghost who walks\", \"The Phantom (comics)\", \"Bandar tribe\", \"Team Fantomen\", \"Fantomet\", \"The Phantom\", \"Musta Naamio\"]", "[\"Unitary state of republic of indonesia\", \"Indonesian Republic\", \"INDONESIA\", \"ISO 3166-1:ID\", \"The world's most populous Muslim nation\", \"Unitary State of Republic of Indonesia\", \"Indonezio\", \"Wildlife of Indonesia\", \"Indonnesia\", \"Indoneshia\", \"Etymology of Indonesia\", \"Republic of Indonesia\", \"Indonesia, Republic of\", \"Unitary State of the Republic of Indonesia\", \"Indonesia\", \"Indonesie\", \"Indonesian government\", \"Ecology of Indonesia\", \"Indnonesia\", \"Republic Of Indonesia\", \"Unitary state of the republic of indonesia\", \"Indonesian Empire\", \"Indon\\u00e9sie\", \"Indonisia\", \"Republik Indonesia\"]", "[\"The Secret (film)\", \"Secret (album)\", \"Secret (disambiguation)\", \"A secret\", \"The secret\", \"The Secret\", \"Secret (song)\", \"SECRET\", \"The Secret (EP)\", \"Secret (band)\", \"Secret (film)\"]", "[\"Kirsty Young\"]", "[\"Dolphin habitat\", \"Dolphins in mythology\", \"Genital slit\", \"Dolphin lore\", \"Mating dolphins\", \"Sexuality of dolphins\", \"Dophin\", \"List of dolphin species\", \"DOLPHIN\", \"\\ud83d\\udc2c\", \"Dorphin\", \"Dolphins\", \"List of dolphins\", \"Reproductive behavior of dolphins\", \"Social behavior of dolphins\", \"Reproductive organs of dolphins\", \"Dolphin diet\", \"Sexual behavior of dolphins\", \"Dolphin\", \"Dolphin (mythology)\", \"Aquatic mammal dolphin\", \"Dophins\"]", "[\"Seven Boar\", \"Severn river (great britain)\", \"Afon Hafren\", \"Severn Vale\", \"Severn River (Great Britain)\", \"River Severn\", \"Severn\", \"The Severn River\"]", "[\"Berne BE\", \"Berne (Bern)\", \"Bern, Switzerland\", \"Bern, CH\", \"Bern (city)\", \"Berne, Switzerland\", \"UN/LOCODE:CHBRN\", \"Bern\", \"Berne (Berne)\", \"Berne\", \"Capital of Switzerland\", \"City of Berne\"]", "[\"Susan Lilian Townsend\", \"Sue Townsend\"]", "[\"fifteen\", \"15\"]", "[\"Ruth Edding\", \"Ruth Etting\"]", "[\"Visvalk\", \"Western Osprey\", \"Pandion cristatus\", \"Western osprey\", \"Pandion haliaetus\", \"Pandion (bird)\", \"Ospey\", \"Eastern osprey\", \"Pandion (genus)\", \"Eastern Osprey\", \"Fish hawk\", \"Pandionidae\", \"Ospreys\", \"Osprey\", \"Fish-hawk\"]", "[\"Jack Shepard\", \"Jack Shepherd (disambiguation)\", \"Jack Shepherd\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Doubling down\", \"Charlies (blackjack)\", \"Pontoon (cards)\", \"Basic strategy\", \"Five Card Charlie\", \"21st Century Blackjack\", \"Vingt-et-un\", \"Blackjack\", \"Five card charlie\", \"Pitch blackjack\", \"Online blackjack\", \"Blackjack rules\", \"BlackJack\"]", "[\"Baha'I\", \"Baha'\", \"Baha'iyyih\", \"Bahaist\", \"Baha'is\", \"Bah\\u00e1'\\u00ed Cause\", \"Bah\\u00e1\\u00ed Faith\", \"Baha'i religion\", \"Bakhai\", \"The Bah\\u00e1'\\u00eds\", \"Bah\\u00e1'\\u00ed Faith\", \"Non-Baha'i\", \"Bah\\u00e1'\\u00eds\", \"The Bahai\", \"Bah\\u00e1'\\u00ed Faith (Haifa)\", \"Bah\\u00e1\\u2019\\u00ed\", \"Bahaism\", \"Baha\\u2019\\u00ed\", \"Baha\\u2019i\", \"The Baha'i\", \"Baha'i\", \"Bahism\", \"Bahai'ism\", \"Bah\\u00e1'\\u00ed\", \"Baa'hai Faith\", \"Baha'ism\", \"Bah\\u00e1\\u2019\\u00eds\", \"Bahaii\", \"Bah\\u00e1'i Faith\", \"The Baha'is\", \"Bah\\u00e1\\u2019\\u00ed Faith\", \"Bah\\u00e1'\\u00ed faith\", \"Baha\\u2019i Faith\", \"Baha\\u00ed Faith\", \"Bahai World Faith\", \"The Bahai Faith\", \"Bah\\u00e1i Faith\", \"Bahaists\", \"Bah\\u00e1 faith\", \"Baha'i faith\", \"Bah\\u00e1'\\u00ed art\", \"Bah\\u00e1\\u00b4i Faith\", \"Bahai art\", \"Baha'iism\", \"Most great infallibility\", \"Bah\\u00e1'iyyat\", \"Infallibility (Baha'i)\", \"Bah\\u00e1\\u00ed\", \"Baha'i Religion\", \"Bahaiist\", \"Bahai\", \"Bah\\u00e1'\\u00ed+Faith\", \"Baha'i Community\", \"Bahais\", \"Baha'\\u00ed Faith\", \"Bahaiists\", \"Baha'iyyah\", \"Non-Bah\\u00e1'\\u00ed\", \"Baha'i art\", \"Baha'i World Faith\", \"Ba'hai\", \"Bahaiism\", \"BAHA'I\", \"Baha'i youth\", \"The Baha'i Faith\", \"The Baha'i Community\", \"Baha'i Faith (Haifa)\", \"Baha\\u2019is\", \"Baha'i+Faith\", \"Infallibility (Bah\\u00e1'\\u00ed)\", \"Bah\\u00e1\\u00edsm\", \"The Bah\\u00e1'\\u00ed Faith\", \"Bahai religion\", \"Baha'i Cause\", \"Bahai Faith\", \"Baha faith\", \"Bah\\u00e1'\\u00ed World Faith\", \"Bahai faith\", \"Bah\\u00e1'iyya\", \"Baha'i Faith\"]", "[\"Al-Q\\u0101hirah\", \"Cairo in the middle ages\", \"Al-Qahira\", \"Abbaseya\", \"The weather in Cairo\", \"Qahirah\", \"Pollution in Cairo\", \"El Zaher\", \"Air pollution in Cairo\", \"Ancient cairo\", \"Qahira\", \"Al-Q\\u0101hira\", \"El-Qahira\", \"\\u0627\\u0644\\u0642\\u0627\\u0647\\u0631\\u0629\", \"The Capital Cairo\", \"History of Cairo\", \"Al-Q\", \"Cairo (Egypt)\", \"Al-Kahir\", \"Cairene\", \"Al Qahira\", \"Cairo, Arab Republic of Egypt\", \"Demographics of Cairo\", \"History of cairo\", \"Cairo, EG\", \"Al-Qahirah\", \"El Q\\u00e2hira\", \"Classical cairo\", \"Cairo\", \"Q\\u0101hirah\", \"UN/LOCODE:EGCAI\", \"Abdeen (Cairo)\", \"Cairo, Egypt\", \"El Qahira\"]", "[\"For those who came in late\", \"Phantom (comic)\", \"List of Phantom publications from Moonstone Books\", \"Fantomen\", \"Singh Brotherhood\", \"Ghost who walks\", \"The Phantom (comics)\", \"Bandar tribe\", \"Team Fantomen\", \"Fantomet\", \"The Phantom\", \"Musta Naamio\"]", "[\"Unitary state of republic of indonesia\", \"Indonesian Republic\", \"INDONESIA\", \"ISO 3166-1:ID\", \"The world's most populous Muslim nation\", \"Unitary State of Republic of Indonesia\", \"Indonezio\", \"Wildlife of Indonesia\", \"Indonnesia\", \"Indoneshia\", \"Etymology of Indonesia\", \"Republic of Indonesia\", \"Indonesia, Republic of\", \"Unitary State of the Republic of Indonesia\", \"Indonesia\", \"Indonesie\", \"Indonesian government\", \"Ecology of Indonesia\", \"Indnonesia\", \"Republic Of Indonesia\", \"Unitary state of the republic of indonesia\", \"Indonesian Empire\", \"Indon\\u00e9sie\", \"Indonisia\", \"Republik Indonesia\"]", "[\"The Secret (film)\", \"Secret (album)\", \"Secret (disambiguation)\", \"A secret\", \"The secret\", \"The Secret\", \"Secret (song)\", \"SECRET\", \"The Secret (EP)\", \"Secret (band)\", \"Secret (film)\"]", "[\"Kirsty Young\"]", "[\"Dolphin habitat\", \"Dolphins in mythology\", \"Genital slit\", \"Dolphin lore\", \"Mating dolphins\", \"Sexuality of dolphins\", \"Dophin\", \"List of dolphin species\", \"DOLPHIN\", \"\\ud83d\\udc2c\", \"Dorphin\", \"Dolphins\", \"List of dolphins\", \"Reproductive behavior of dolphins\", \"Social behavior of dolphins\", \"Reproductive organs of dolphins\", \"Dolphin diet\", \"Sexual behavior of dolphins\", \"Dolphin\", \"Dolphin (mythology)\", \"Aquatic mammal dolphin\", \"Dophins\"]", "[\"Seven Boar\", \"Severn river (great britain)\", \"Afon Hafren\", \"Severn Vale\", \"Severn River (Great Britain)\", \"River Severn\", \"Severn\", \"The Severn River\"]", "[\"Berne BE\", \"Berne (Bern)\", \"Bern, Switzerland\", \"Bern, CH\", \"Bern (city)\", \"Berne, Switzerland\", \"UN/LOCODE:CHBRN\", \"Bern\", \"Berne (Berne)\", \"Berne\", \"Capital of Switzerland\", \"City of Berne\"]", "[\"Susan Lilian Townsend\", \"Sue Townsend\"]", "[\"fifteen\", \"15\"]", "[\"Ruth Edding\", \"Ruth Etting\"]", "[\"Visvalk\", \"Western Osprey\", \"Pandion cristatus\", \"Western osprey\", \"Pandion haliaetus\", \"Pandion (bird)\", \"Ospey\", \"Eastern osprey\", \"Pandion (genus)\", \"Eastern Osprey\", \"Fish hawk\", \"Pandionidae\", \"Ospreys\", \"Osprey\", \"Fish-hawk\"]", "[\"Jack Shepard\", \"Jack Shepherd (disambiguation)\", \"Jack Shepherd\"]" ]
[ "In what game might you hit, stand, split, or double down?", "Which religious faith was founded in the 19th century, in what is now Iran and has its headquarters in Haifa(Israel)?", "What is the capital of Egypt", "\"\"\"Devil\"\" was the pet wolf of which comic strip character?\"", "Lady Gaga cancelled her 2012 tour to which country after threats of chaos from protestors?", "According to the proverb what is too much for one enough for two but not enough for three", "Who is the current presenter of Desert Island Discs on Radio 4?", "Delphinus delphis is the scientific name for which creature?", "The world's first iron bridge was completed in 1781 at Coalbrookdale, which river does it span?", "What is the capital of Switzerland", "Who wrote ‘The Secret Diary of Adrian Mole’?", "The metric prefix femto is shown as ten to the power of minus what?", "Doris Day plays which 1920’s and 30’s singer and actress in the 1955 film ‘Love Me or Leave Me’?", "What is the most common name of the British bird Pandon Haliaetus, also known as the sea hawk, fish eagle or fish hawk?", "Who played the Cornish based detective, Wycliffe" ]
15
[ 28125, 28126, 28127, 28128, 28129, 28130, 28131, 28132, 28133, 28134, 28135, 28136, 28137, 28138, 28139 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: The Drachma was which nation's main currency unit before the Euro in 2002?\nQuestion 2: What is the real first name of the character Jack Frost, played by David Jason\nQuestion 3: Who did the Americans recognize as ruler of Vietnam in 1950 when the Soviets acknowledged Ho Chi Min?\nQuestion 4: 'The Four Humours' ancient concept of personality asserted what 'mood' is produced by phlegm in the body?\nQuestion 5: What is the French word for ‘cunning, trickery, craftiness’?\nQuestion 6: Who is the patron saint of politicians?\nQuestion 7: What type of creature is a 'Khaki Campbell'?\nQuestion 8: Who was the Roman god of wine and fertility?\nQuestion 9: Melbourne, Australia stands on which river?\nQuestion 10: Which Native American leader's real name was Goyathlay?\nQuestion 11: In which US state is the 'Shenandoah National Park'>\nQuestion 12: What tube connects the kidney to the bladder?\nQuestion 13: Which painter was married to Mexican artist Diego Rivera?\nQuestion 14: In which country was the battle of Rorke's Drift in 1879\nQuestion 15: What is the capital of Idaho?", "role": "user" } ]
["[\"Yunanistan\", \"Griekenland\", \"Hellenic republic\", \"Ell\\u00e1da\", \"Graecia\", \"The Hellenic Republic\", \"\\u0395\\u03bb\\u03bb\\u03ac\\u03c2\", \"El\\u00e1dha\", \"Yananistan\", \"Republic of Greece\", \"Elliniki Dimokrat\\u00eda\", \"Picki u dusa\", \"R\\u00e9publique hell\\u00e9nique\", \"Social issues in Greece\", \"Hellas\", \"Hellenic Republic\", \"Republique hellenique\", \"Eladha\", \"\\u0395\\u03bb\\u03bb\\u03ac\\u03b4\\u03b1\", \"Gr\\u00e8ce\", \"Elliniki Dimokratia\", \"Greece\", \"Temporary Government of National Defence\", \"Griechenland\", \"Grcija\", \"Ellada\", \"Hellada\", \"Greek Republic\", \"Grece\", \"\\u0395\\u03bb\\u03bb\\u03b7\\u03bd\\u03b9\\u03ba\\u03ae \\u0394\\u03b7\\u03bc\\u03bf\\u03ba\\u03c1\\u03b1\\u03c4\\u03af\\u03b1\", \"Grcka\", \"Political history of Greece\", \"Ell\\u012bnik\\u012b\\u0301 D\\u012bmokrat\\u00eda\", \"Macedonian Greece\", \"History of North Greece\", \"ISO 3166-1:GR\", \"Grecce\", \"El\\u00e1s\", \"Hell\\u00e1s\", \"\\u0395\\u03bb\\u03bb\\u03b1\\u03c2\", \"Greek law (Hellenic Republic)\"]", "[\"Wilhelmus van Nassauwe\", \"Wilhelmus\", \"Netherlands national anthem\", \"National anthem of the Netherlands\", \"Dutch national anthem\", \"Wilhelmus van Nassouwe\", \"Dutch anthem\", \"Anthem of the Netherlands\", \"The William\", \"WILLIAM\", \"National anthem of Holland\", \"Het Wilhelmus\", \"Oldest anthem\", \"Anthem of Netherlands\", \"Wilhelmus van nassouwe\"]", "[\"V\\u0129nh Th\\u1ee5y Nguy\\u1ec5n Ph\\u00fac\", \"Bao Dai, Emperor of Vietnam\", \"Bao Dai of Vietnam\", \"B\\u1ea3o \\u0110\\u1ea1i\", \"Th\\u1ee5y V\\u0129nh Nguy\\u1ec5n Ph\\u00fac\", \"Vinh Thuy Nguyen\", \"V\\u0129nh Th\\u1ee5y Nguy\\u1ec5n\", \"Bao dai\", \"Bao Dai\", \"V\\u0129nh Th\\u1ee5y Ph\\u00fac Nguy\\u1ec5n\", \"B\\u1ea3o \\u0110\\u1ea1i of Vietnam\", \"Bo Dai\", \"Vinh Thuy Phuc Nguyen\", \"Th\\u1ee5y Nguy\\u1ec5n Ph\\u00fac\", \"Vinh Thuy\", \"Emperor Bao Dai\", \"B\\u1ea3o \\u00d0\\u1ea1i\", \"Th\\u1ee5y Ph\\u00fac V\\u0129nh Nguy\\u1ec5n\"]", "[\"Calmness\"]", "[\"Fast Infrared Exoplanet Spectroscopy Survey Explorer\", \"FINESSE\", \"Fast INfrared Exoplanet Spectroscopy Survey Explorer\"]", "[\"St. Thomas Moore\", \"Thomas More\", \"Tomas Moore\", \"Saint Thomas More\", \"St Thomas Moore\", \"St. More\", \"St Thomas More\", \"Sir Thomas More\", \"T More\", \"Sir Saint Thomas More\", \"Tomas More\", \"More, Thomas, Saint\", \"Jane Colt\", \"Thomas, Sir More\", \"St. Thomas More\", \"Sir St. Thomas More\", \"Thomas Morus\", \"Thomas more\", \"Saint Thomas Moore\", \"More, Thomas\", \"St More\", \"Sir St Thomas More\"]", "[\"Quack (sound)\", \"Duckies\", \"Duckling\", \"Ducks\", \"Eend\", \"Ducklings\", \"DUCK\", \"Duck\", \"Mallard Drake\", \"Quacking\", \"Quacked\"]", "[\"God of wine\", \"Di-wo-ni-so-jo\", \"Lyaeus\", \"Di\\u00f3nysos\", \"Layios\", \"Dyonysus\", \"Dionysiac cult\", \"Dionysos\", \"Acratophorus\", \"Father Bacchus\", \"Liknites\", \"Aegobolus\", \"Dionysis\", \"\\u0394\\u03b9\\u03cc\\u03bd\\u03c5\\u03c3\\u03bf\\u03c2\", \"\\u0394\\u03b9\\u03ce\\u03bd\\u03c5\\u03c3\\u03bf\\u03c2\", \"Bacchus (god)\", \"Lyoeus\", \"Bacchus\", \"Bacchino\", \"Dionysus,\", \"Bachus\", \"Dionysus\", \"God of Wine\", \"Dyonisos\", \"Dionysos Dendrites\", \"Bacchus (mythology)\", \"Dionysus Dendrites\", \"Bacchic\"]", "[\"Yarra (disambiguation)\", \"Yarra\"]", "[\"Goyaa\\u0142\\u00e9\", \"Goyahkla\", \"Goyaale\", \"Geronimo\", \"One who yawns\", \"Goyaal\\u00e9\", \"Gokhlayeh\", \"Geronimo's skull\", \"Goyathlay\", \"Geromino\", \"Jeranimo\"]", "[\"The Virginia\", \"VIRGINIA\"]", "[\"Ureteral\", \"Ureteral diseases\", \"Pelvouteric junction\", \"Ureter\", \"Ureterovesical valve\", \"Ureters\", \"Ureteral disease\"]", "[\"Kahlo, Frida\", \"Frida Rivera\", \"Frida kahlo\", \"Frida Kalo\", \"Frida Kalho\", \"Frida Cahlo\", \"Firda Kahlo\", \"Magdalena Carmen Frida Kahlo y Calder\\u00f3n\", \"Frida Khalo\", \"Kahlo\", \"Freda Kahlo\", \"Frida Kahlo\", \"Frieda Kahlo\", \"Frida Carlo\", \"Magdalena Carmen Frida Kahlo y Calderon\"]", "[\"South africa\", \"South Africa's\", \"Southafrica\", \"Third Republic (South Africa)\", \"Republiek van Suid-Afrika\", \"Sou'frica\", \"Zuid Afrika\", \"Zuid-Afrika\", \"ISO 3166-1:ZA\", \"South-African\", \"S Africa\", \"Zuid Africa\", \"Mzansi\", \"Afrique du sud\", \"Zuidafrika\", \"Ningizimu Afrika\", \"Capital of South Africa\", \"Suid-Afrika\", \"South-Africa\", \"Rep. of SOUTH AFRICA\", \"The Republic of South Africa\", \"Suid Africa\", \"Azania/South Africa\", \"S Afr\", \"Saffa\", \"South African\", \"Seth efrika\", \"South Africa\", \"Soufrica\", \"Republic of south africa\", \"South Africa\\u00e0\", \"The Beloved Country\", \"S. Africa\", \"Rep. of South Africa\", \"South Africans\", \"Republic of South Africa\"]", "[\"Capital of Idaho\", \"Boise, ID\", \"Boise Nicknames\", \"Boise, Idaho\", \"Boise, Idaho, USA\", \"Boise (ID)\", \"Boise, id\", \"Boise City, ID\", \"Boise City, ID MSA\", \"Boise, Id\", \"Boise Police Department\", \"Boise\", \"Boise police department\", \"BoDo (district)\", \"History of Boise, Idaho\", \"Boise Capital News\", \"Boise, Idaho, United States\", \"Boise idaho\", \"Boise City, Idaho\", \"Boise City Center, Idaho\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Yunanistan\", \"Griekenland\", \"Hellenic republic\", \"Ell\\u00e1da\", \"Graecia\", \"The Hellenic Republic\", \"\\u0395\\u03bb\\u03bb\\u03ac\\u03c2\", \"El\\u00e1dha\", \"Yananistan\", \"Republic of Greece\", \"Elliniki Dimokrat\\u00eda\", \"Picki u dusa\", \"R\\u00e9publique hell\\u00e9nique\", \"Social issues in Greece\", \"Hellas\", \"Hellenic Republic\", \"Republique hellenique\", \"Eladha\", \"\\u0395\\u03bb\\u03bb\\u03ac\\u03b4\\u03b1\", \"Gr\\u00e8ce\", \"Elliniki Dimokratia\", \"Greece\", \"Temporary Government of National Defence\", \"Griechenland\", \"Grcija\", \"Ellada\", \"Hellada\", \"Greek Republic\", \"Grece\", \"\\u0395\\u03bb\\u03bb\\u03b7\\u03bd\\u03b9\\u03ba\\u03ae \\u0394\\u03b7\\u03bc\\u03bf\\u03ba\\u03c1\\u03b1\\u03c4\\u03af\\u03b1\", \"Grcka\", \"Political history of Greece\", \"Ell\\u012bnik\\u012b\\u0301 D\\u012bmokrat\\u00eda\", \"Macedonian Greece\", \"History of North Greece\", \"ISO 3166-1:GR\", \"Grecce\", \"El\\u00e1s\", \"Hell\\u00e1s\", \"\\u0395\\u03bb\\u03bb\\u03b1\\u03c2\", \"Greek law (Hellenic Republic)\"]", "[\"Wilhelmus van Nassauwe\", \"Wilhelmus\", \"Netherlands national anthem\", \"National anthem of the Netherlands\", \"Dutch national anthem\", \"Wilhelmus van Nassouwe\", \"Dutch anthem\", \"Anthem of the Netherlands\", \"The William\", \"WILLIAM\", \"National anthem of Holland\", \"Het Wilhelmus\", \"Oldest anthem\", \"Anthem of Netherlands\", \"Wilhelmus van nassouwe\"]", "[\"V\\u0129nh Th\\u1ee5y Nguy\\u1ec5n Ph\\u00fac\", \"Bao Dai, Emperor of Vietnam\", \"Bao Dai of Vietnam\", \"B\\u1ea3o \\u0110\\u1ea1i\", \"Th\\u1ee5y V\\u0129nh Nguy\\u1ec5n Ph\\u00fac\", \"Vinh Thuy Nguyen\", \"V\\u0129nh Th\\u1ee5y Nguy\\u1ec5n\", \"Bao dai\", \"Bao Dai\", \"V\\u0129nh Th\\u1ee5y Ph\\u00fac Nguy\\u1ec5n\", \"B\\u1ea3o \\u0110\\u1ea1i of Vietnam\", \"Bo Dai\", \"Vinh Thuy Phuc Nguyen\", \"Th\\u1ee5y Nguy\\u1ec5n Ph\\u00fac\", \"Vinh Thuy\", \"Emperor Bao Dai\", \"B\\u1ea3o \\u00d0\\u1ea1i\", \"Th\\u1ee5y Ph\\u00fac V\\u0129nh Nguy\\u1ec5n\"]", "[\"Calmness\"]", "[\"Fast Infrared Exoplanet Spectroscopy Survey Explorer\", \"FINESSE\", \"Fast INfrared Exoplanet Spectroscopy Survey Explorer\"]", "[\"St. Thomas Moore\", \"Thomas More\", \"Tomas Moore\", \"Saint Thomas More\", \"St Thomas Moore\", \"St. More\", \"St Thomas More\", \"Sir Thomas More\", \"T More\", \"Sir Saint Thomas More\", \"Tomas More\", \"More, Thomas, Saint\", \"Jane Colt\", \"Thomas, Sir More\", \"St. Thomas More\", \"Sir St. Thomas More\", \"Thomas Morus\", \"Thomas more\", \"Saint Thomas Moore\", \"More, Thomas\", \"St More\", \"Sir St Thomas More\"]", "[\"Quack (sound)\", \"Duckies\", \"Duckling\", \"Ducks\", \"Eend\", \"Ducklings\", \"DUCK\", \"Duck\", \"Mallard Drake\", \"Quacking\", \"Quacked\"]", "[\"God of wine\", \"Di-wo-ni-so-jo\", \"Lyaeus\", \"Di\\u00f3nysos\", \"Layios\", \"Dyonysus\", \"Dionysiac cult\", \"Dionysos\", \"Acratophorus\", \"Father Bacchus\", \"Liknites\", \"Aegobolus\", \"Dionysis\", \"\\u0394\\u03b9\\u03cc\\u03bd\\u03c5\\u03c3\\u03bf\\u03c2\", \"\\u0394\\u03b9\\u03ce\\u03bd\\u03c5\\u03c3\\u03bf\\u03c2\", \"Bacchus (god)\", \"Lyoeus\", \"Bacchus\", \"Bacchino\", \"Dionysus,\", \"Bachus\", \"Dionysus\", \"God of Wine\", \"Dyonisos\", \"Dionysos Dendrites\", \"Bacchus (mythology)\", \"Dionysus Dendrites\", \"Bacchic\"]", "[\"Yarra (disambiguation)\", \"Yarra\"]", "[\"Goyaa\\u0142\\u00e9\", \"Goyahkla\", \"Goyaale\", \"Geronimo\", \"One who yawns\", \"Goyaal\\u00e9\", \"Gokhlayeh\", \"Geronimo's skull\", \"Goyathlay\", \"Geromino\", \"Jeranimo\"]", "[\"The Virginia\", \"VIRGINIA\"]", "[\"Ureteral\", \"Ureteral diseases\", \"Pelvouteric junction\", \"Ureter\", \"Ureterovesical valve\", \"Ureters\", \"Ureteral disease\"]", "[\"Kahlo, Frida\", \"Frida Rivera\", \"Frida kahlo\", \"Frida Kalo\", \"Frida Kalho\", \"Frida Cahlo\", \"Firda Kahlo\", \"Magdalena Carmen Frida Kahlo y Calder\\u00f3n\", \"Frida Khalo\", \"Kahlo\", \"Freda Kahlo\", \"Frida Kahlo\", \"Frieda Kahlo\", \"Frida Carlo\", \"Magdalena Carmen Frida Kahlo y Calderon\"]", "[\"South africa\", \"South Africa's\", \"Southafrica\", \"Third Republic (South Africa)\", \"Republiek van Suid-Afrika\", \"Sou'frica\", \"Zuid Afrika\", \"Zuid-Afrika\", \"ISO 3166-1:ZA\", \"South-African\", \"S Africa\", \"Zuid Africa\", \"Mzansi\", \"Afrique du sud\", \"Zuidafrika\", \"Ningizimu Afrika\", \"Capital of South Africa\", \"Suid-Afrika\", \"South-Africa\", \"Rep. of SOUTH AFRICA\", \"The Republic of South Africa\", \"Suid Africa\", \"Azania/South Africa\", \"S Afr\", \"Saffa\", \"South African\", \"Seth efrika\", \"South Africa\", \"Soufrica\", \"Republic of south africa\", \"South Africa\\u00e0\", \"The Beloved Country\", \"S. Africa\", \"Rep. of South Africa\", \"South Africans\", \"Republic of South Africa\"]", "[\"Capital of Idaho\", \"Boise, ID\", \"Boise Nicknames\", \"Boise, Idaho\", \"Boise, Idaho, USA\", \"Boise (ID)\", \"Boise, id\", \"Boise City, ID\", \"Boise City, ID MSA\", \"Boise, Id\", \"Boise Police Department\", \"Boise\", \"Boise police department\", \"BoDo (district)\", \"History of Boise, Idaho\", \"Boise Capital News\", \"Boise, Idaho, United States\", \"Boise idaho\", \"Boise City, Idaho\", \"Boise City Center, Idaho\"]" ]
[ "The Drachma was which nation's main currency unit before the Euro in 2002?", "What is the real first name of the character Jack Frost, played by David Jason", "Who did the Americans recognize as ruler of Vietnam in 1950 when the Soviets acknowledged Ho Chi Min?", "'The Four Humours' ancient concept of personality asserted what 'mood' is produced by phlegm in the body?", "What is the French word for ‘cunning, trickery, craftiness’?", "Who is the patron saint of politicians?", "What type of creature is a 'Khaki Campbell'?", "Who was the Roman god of wine and fertility?", "Melbourne, Australia stands on which river?", "Which Native American leader's real name was Goyathlay?", "In which US state is the 'Shenandoah National Park'>", "What tube connects the kidney to the bladder?", "Which painter was married to Mexican artist Diego Rivera?", "In which country was the battle of Rorke's Drift in 1879", "What is the capital of Idaho?" ]
15
[ 135240, 135241, 135242, 135243, 135244, 135245, 135246, 135247, 135248, 135249, 135250, 135251, 135252, 135253, 135254 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Grey Street, named after Prime Minister Earl Grey, is a major street in which British city?\nQuestion 2: The strait of Magellan separates which island from South America?\nQuestion 3: In what country, the world's seventh largest by geographical area, is Christmas known as Bada Din (the big day)?\nQuestion 4: Which perfume company make the fragrance Nu?\nQuestion 5: A misanthrope is characterized by the hatred of what?\nQuestion 6: Pangaea, Laurasia and Gondwana are?\nQuestion 7: Sir Hudson Lowe was whose gaoler?\nQuestion 8: In which London road is Harrod’s department store?\nQuestion 9: Bohea is a type of what?\nQuestion 10: At auction in 2015, $1.2m was paid for Don McLean's original handrwitten lyrics for which 1971 big hit song?\nQuestion 11: Who was the first American President not of British descent?\nQuestion 12: \"Which author said \"\"A classic is something everyone wants to have read but nobody wants to read\"\"?\"\nQuestion 13: \"The painting \"\"the Girl with the Pearl Earring\"\" is by which artist?\"\nQuestion 14: Which book is often referred to as the O.E.D.\nQuestion 15: When was the first Super Bowl for American football held?", "role": "user" } ]
["[\"Newcastle-Upon-Tyne\", \"Newscastle\", \"Newcastle upon Tyne\", \"Newcastle upon Tyne, United Kingdom\", \"Collingwood Street\", \"Newcastle-on-Tyne\", \"Newcastle Metropolitan Borough Council\", \"Metropolitan Borough of Newcastle-upon-Tyne\", \"City of Newcastle upon Tyne\", \"Newcastle, Tyne and Wear\", \"Newcastle Upon Tyne, England\", \"Newcastle Upon-Tyne\", \"UN/LOCODE:GBNCL\", \"Newcastle on Tyne\", \"Monkchester\", \"County Borough of Newcastle upon Tyne\", \"Newcastle-upon-tyne\", \"Newcastle upon Tyne, England\", \"Metropolitan Borough of Newcastle upon Tyne\", \"City of Newcastle-upon-Tyne\", \"NuT\", \"Newcastle Upon Tyne\", \"Newcastle On Tyne\", \"Newcastle UK\", \"Newcastle upon Tyne (borough)\", \"Newcastle, UK\", \"Newcastle-upon-Tyne\", \"Newcastle-upon-Tyne, Electoral wards.\", \"Newcastle upon tyne\", \"Newscastle Upon Tyne, England\"]", "[\"Fireland\", \"Tierra del fuego\", \"Terra del fuogo\", \"Tierra Del Fuego\", \"Tiera del fuego\", \"Land of Flame\", \"TIERRA DEL FUEGO\", \"Beagle(beer)\", \"Tierra del Fuego\"]", "[\"\\u0d2d\\u0d3e\\u0d30\\u0d24 \\u0d2e\\u0d39\\u0d3e\\u0d30\\u0d3e\\u0d1c\\u0d4d\\u0d2f\\u0d02\", \"\\u0647\\u0646\\u062f\\u0633\\u062a\\u0627\\u0646\\u0680\\u0627\\u0631\\u062a\\u060c\", \"\\u092d\\u093e\\u0930\\u0924\\u0940\\u092f \\u0917\\u0923\\u0930\\u093e\\u091c\\u094d\\u092f\\u093e\\u091a\\u094d\\u092f\\u093e\", \"Bh\\u0101rtiya Praj\\u0101satt\\u0101k\", \"Indian Republic\", \"\\u09ad\\u09be\\u09b0\\u09a4\\u09b0\\u09be\\u09b7\\u09cd\\u099f\\u09c3\", \"Indian republic\", \"\\u0cad\\u0cbe\\u0cb0\\u0ca4 \\u0c97\\u0ca3\\u0cb0\\u0cbe\\u0c9c\\u0ccd\\u0caf\", \"Union of India\", \"\\u0b87\\u0ba8\\u0bcd\\u0ba4\\u0bbf\\u0baf\\u0b95\\u0bcd \\u0b95\\u0bc1\\u0b9f\\u0bbf\\u0baf\\u0bb0\\u0b9a\\u0bc1\", \"\\u092d\\u093e\\u0930\\u0924\\u0940\\u092f \\u092a\\u094d\\u0930\\u091c\\u093e\\u0938\\u0924\\u094d\\u0924\\u093e\\u0915\", \"India (country)\", \"ISO 3166-1:IN\", \"Indea\", \"Etymology of India\", \"\\u09ad\\u09be\\u09b0\\u09a4 \\u0997\\u09a3\\u09b0\\u09be\\u099c\\u09cd\\u09af\", \"Republic Of India\", \"INDIA\", \"\\u0aad\\u0abe\\u0ab0\\u0aa4\\u0ac0\\u0aaf \\u0a97\\u0aa3\\u0aa4\\u0a82\\u0aa4\\u0acd\\u0ab0\", \"\\u09ad\\u09be\\u09b0\\u09a4\", \"Republic of India\", \"Les Indes\", \"Bh\\u0101rat Ga\\u1e47ar\\u0101jya\", \"\\u062c\\u0645\\u06c1\\u0648\\u0657\\u0631\\u0650\\u06cc\\u062a \\u0628\\u064b\\u0627\\u0631\\u062a\", \"\\u092d\\u093e\\u0930\\u0924\\u092e\\u0939\\u093e\\u0930\\u093e\\u091c\\u094d\\u092f\\u092e\\u094d\", \"Indya\", \"Bharat Ganrajya\", \"\\u062c\\u0645\\u06c1\\u0648\\u0631\\u06cc\\u06c1 \\u0628\\u06be\\u0627\\u0631\\u062a\", \"\\u0b87\\u0ba8\\u0bcd\\u0ba4\\u0bbf\\u0baf\", \"\\u0b2d\\u0b3e\\u0b30\\u0b24 \\u0b17\\u0b23\\u0b30\\u0b3e\\u0b1c\\u0b4d\\u0b2f\", \"\\u092d\\u093e\\u0930\\u0924 \\u0917\\u0923\\u0930\\u093e\\u091c\\u094d\\u092f\", \"Republic of india\", \"\\u091c\\u0941\\u092e\\u094d\\u0939\\u0942\\u0930\\u093f\\u092f\\u0924 \\u092d\\u093e\\u0930\\u0924\", \"Hindio\", \"The Republic of India\", \"\\u0c2d\\u0c3e\\u0c30\\u0c24 \\u0c17\\u0c23\\u0c24\\u0c02\\u0c24\\u0c4d\\u0c30 \\u0c30\\u0c3e\\u0c1c\\u0c4d\\u0c2f\\u0c2e\\u0c41\", \"India's\", \"Hindistan\", \"\\u0a2d\\u0a3e\\u0a30\\u0a24 \\u0a17\\u0a23\\u0a24\\u0a70\\u0a24\\u0a30\", \"Bhart\", \"India\", \"\\u0c2d\\u0c3e\\u0c30\\u0c24 \\u0c30\\u0c3f\\u0c2a\\u0c2c\\u0c4d\\u0c32\\u0c3f\\u0c15\\u0c4d\", \"India.\", \"\\u09ad\\u09be\\u09f0\\u09a4 \\u0997\\u09a3\\u09f0\\u09be\\u099c\\u09cd\\u09af\", \"Indian State\", \"ISO 3166-1 alpha-3/IND\", \"\\u09ad\\u09be\\u09b0\\u09a4\\u09c0\\u09af\\u09bc \\u09aa\\u09cd\\u09b0\\u099c\\u09be\\u09a4\\u09a8\\u09cd\\u09a4\\u09cd\\u09b0\"]", "[\"Yves Saint-Laurent\", \"Yves Saint Laurent (disambiguation)\", \"Yves Saint Laurent\", \"Yves St Laurent\", \"Yves St. Laurent\"]", "[\"Human species\", \"Humans as primates\", \"Human\", \"Human Being\", \"the human species\", \"Man (anthropology and biology)\", \"Human being\", \"Terran (Homo Sapien)\", \"Humans\", \"All Humankind\", \"Human habitat and population\", \"Humano\", \"Human kind\", \"People of this planet\", \"Humankind\", \"Huamn\", \"Human Beings\", \"Human race\", \"Human beings\", \"Human habitat\"]", "[\"Prehistoric supercontinents\", \"Super continent\", \"Megacontinent\", \"Supercontinent\", \"Supercontinents\"]", "[\"Napoleon Buonaparte\", \"Napolean bonapart\", \"Bonaparte\", \"Napoleonist\", \"Napoleon Boneparte\", \"Le petit caporal\", \"Napoleaon\", \"Napolen's coup\", \"Napoleone Bonaparte\", \"Age of Napoleon\", \"Napol\\u00e9on Buonaparte\", \"Napole\\u00f3n\", \"Emperor Napoleon\", \"Napoleon the Great\", \"Napoleon I of France\", \"Napoleon I of France bibliography\", \"Napol\\u00e9on\", \"Napolean Bonapart\", \"Napol\\u00e9on I, Emperor of the French\", \"Napolean Bonaparte\", \"Napoleon Bonapart\", \"Napeoleon\", \"Napolean bonarparte\", \"Emperor Napoleon I\", \"Napolean\", \"Napoleon Bonaparte\", \"Napoloen\", \"Emperor of France Napoleon I\", \"Napoleon I Bonaparte\", \"Napoleone Buonaparte\", \"Napoleon bonaparte\", \"Napolian\", \"Napol\\u00e9on Bonaparte\", \"Napoleon's\", \"Napoleonic\", \"Napoleon I, Emperor of the French\", \"Jupiter Scapin\", \"Nepolian\", \"Napoleon I of the French\", \"Little Corporal\", \"Napoleon I of Italy\", \"Napoleon bonepart\", \"Napol\\u00e9on I\", \"Armed Soldier of Democracy\", \"Napoleon I the Great of the French bibliography\", \"Napoleon i of france\", \"Napoleon i of france bibliography\", \"Napol\\u00e9on I of France\", \"Napoleon's height\", \"Napoleon Ier\", \"Napoleon I\", \"General Bonaparte\", \"Napoleone di Buonaparte\", \"Napole\\u00f3n Bonaparte\", \"G\\u00e9n\\u00e9ral Bonaparte\", \"Jean d'Epee\", \"Napoleon\", \"Napoleon I of the French bibliography\", \"Napoleon Emperor of France\", \"Boneparte\", \"Napoleon of France\", \"Napol\\u00e9on Ier\", \"Napol\\u00e9on I Bonaparte\"]", "[\"Brompton Road\"]", "[\"TEA\", \"Tea (disambiguation)\", \"T.E.A.\", \"TEA (disambiguation)\"]", "[\"American Pie (disambiguation)\", \"American pie\", \"American Pie by Don Mclean\", \"American Pie\"]", "[\"Martin Van Buren\", \"Martin van Buren\", \"Martin VanBuren\", \"Martin van bueren\", \"President Van Buren\", \"The Little Magician\", \"Little Magician\", \"Martin Van Ruin\", \"8th President of the United States\", \"MARTIN VAN BUREN\", \"Presidency of Martin Van Buren\", \"Maarten van Buren\", \"Van Buren Administration\", \"Eighth President of the United States\", \"Martin van bueran\", \"Martin Van Buran\", \"Old Kinderhook\"]", "[\"Mark Twain\", \"Thomas Jefferson Snodgrass\", \"Sam Clemens\", \"Samuel Clements\", \"Twainesque\", \"Samuel Langhorn Clemens\", \"Mark twain\", \"Twain, Mark\", \"Sergeant Fathom\", \"Samuel Longhorn Clemens\", \"Samuel L. Clemens\", \"Samuel Langhorne Clemens\", \"Sam Langhorne Clemens\", \"Samuel Clemens\", \"SL Clemens\", \"Twainian\", \"Reports of my death are greatly exaggerated\", \"Soleather\", \"W. Epaminondas Adrastus Blab\", \"Samuel Longhorne Clemens\", \"Marc Twain\", \"Samual Clemens\"]", "[\"Johannes Vermeer van Delft\", \"Catherina Bolnes\", \"Johannes (Jan) Vermeer\", \"Johannes %22Jan%22 Vermeer\", \"Jan van Der Meer\", \"Jan van der meer\", \"Jan van der Meer\", \"Johan Vermeer\", \"Johannes Vermeer\", \"Jan van der Meer van Delft\", \"Vermeer\", \"Jan Vermeer van Delft\", \"Jan Vermeer\", \"VERMEER\"]", "[\"Oxford, england\", \"Oxeford\", \"Lion Brewery (U.K.)\", \"Oxford, UK\", \"Oxford astrophysics\", \"City of Dreaming Spires\", \"Oxford, England\", \"Oxford (England)\", \"Oxford\", \"Oxford, Oxfordshire\", \"The Dreaming Spires\", \"City of Oxford\", \"UN/LOCODE:GBOXF\", \"OXFORD\", \"City of dreaming spires\", \"Ford of the Oxen\", \"County Borough of Oxford\", \"The weather in Oxford\", \"Oxford, United Kingdom\", \"Morrells brewery\", \"The city of dreaming spires\", \"Oxenaforda\"]", "[\"1967\", \"one thousand, nine hundred and sixty-seven\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Newcastle-Upon-Tyne\", \"Newscastle\", \"Newcastle upon Tyne\", \"Newcastle upon Tyne, United Kingdom\", \"Collingwood Street\", \"Newcastle-on-Tyne\", \"Newcastle Metropolitan Borough Council\", \"Metropolitan Borough of Newcastle-upon-Tyne\", \"City of Newcastle upon Tyne\", \"Newcastle, Tyne and Wear\", \"Newcastle Upon Tyne, England\", \"Newcastle Upon-Tyne\", \"UN/LOCODE:GBNCL\", \"Newcastle on Tyne\", \"Monkchester\", \"County Borough of Newcastle upon Tyne\", \"Newcastle-upon-tyne\", \"Newcastle upon Tyne, England\", \"Metropolitan Borough of Newcastle upon Tyne\", \"City of Newcastle-upon-Tyne\", \"NuT\", \"Newcastle Upon Tyne\", \"Newcastle On Tyne\", \"Newcastle UK\", \"Newcastle upon Tyne (borough)\", \"Newcastle, UK\", \"Newcastle-upon-Tyne\", \"Newcastle-upon-Tyne, Electoral wards.\", \"Newcastle upon tyne\", \"Newscastle Upon Tyne, England\"]", "[\"Fireland\", \"Tierra del fuego\", \"Terra del fuogo\", \"Tierra Del Fuego\", \"Tiera del fuego\", \"Land of Flame\", \"TIERRA DEL FUEGO\", \"Beagle(beer)\", \"Tierra del Fuego\"]", "[\"\\u0d2d\\u0d3e\\u0d30\\u0d24 \\u0d2e\\u0d39\\u0d3e\\u0d30\\u0d3e\\u0d1c\\u0d4d\\u0d2f\\u0d02\", \"\\u0647\\u0646\\u062f\\u0633\\u062a\\u0627\\u0646\\u0680\\u0627\\u0631\\u062a\\u060c\", \"\\u092d\\u093e\\u0930\\u0924\\u0940\\u092f \\u0917\\u0923\\u0930\\u093e\\u091c\\u094d\\u092f\\u093e\\u091a\\u094d\\u092f\\u093e\", \"Bh\\u0101rtiya Praj\\u0101satt\\u0101k\", \"Indian Republic\", \"\\u09ad\\u09be\\u09b0\\u09a4\\u09b0\\u09be\\u09b7\\u09cd\\u099f\\u09c3\", \"Indian republic\", \"\\u0cad\\u0cbe\\u0cb0\\u0ca4 \\u0c97\\u0ca3\\u0cb0\\u0cbe\\u0c9c\\u0ccd\\u0caf\", \"Union of India\", \"\\u0b87\\u0ba8\\u0bcd\\u0ba4\\u0bbf\\u0baf\\u0b95\\u0bcd \\u0b95\\u0bc1\\u0b9f\\u0bbf\\u0baf\\u0bb0\\u0b9a\\u0bc1\", \"\\u092d\\u093e\\u0930\\u0924\\u0940\\u092f \\u092a\\u094d\\u0930\\u091c\\u093e\\u0938\\u0924\\u094d\\u0924\\u093e\\u0915\", \"India (country)\", \"ISO 3166-1:IN\", \"Indea\", \"Etymology of India\", \"\\u09ad\\u09be\\u09b0\\u09a4 \\u0997\\u09a3\\u09b0\\u09be\\u099c\\u09cd\\u09af\", \"Republic Of India\", \"INDIA\", \"\\u0aad\\u0abe\\u0ab0\\u0aa4\\u0ac0\\u0aaf \\u0a97\\u0aa3\\u0aa4\\u0a82\\u0aa4\\u0acd\\u0ab0\", \"\\u09ad\\u09be\\u09b0\\u09a4\", \"Republic of India\", \"Les Indes\", \"Bh\\u0101rat Ga\\u1e47ar\\u0101jya\", \"\\u062c\\u0645\\u06c1\\u0648\\u0657\\u0631\\u0650\\u06cc\\u062a \\u0628\\u064b\\u0627\\u0631\\u062a\", \"\\u092d\\u093e\\u0930\\u0924\\u092e\\u0939\\u093e\\u0930\\u093e\\u091c\\u094d\\u092f\\u092e\\u094d\", \"Indya\", \"Bharat Ganrajya\", \"\\u062c\\u0645\\u06c1\\u0648\\u0631\\u06cc\\u06c1 \\u0628\\u06be\\u0627\\u0631\\u062a\", \"\\u0b87\\u0ba8\\u0bcd\\u0ba4\\u0bbf\\u0baf\", \"\\u0b2d\\u0b3e\\u0b30\\u0b24 \\u0b17\\u0b23\\u0b30\\u0b3e\\u0b1c\\u0b4d\\u0b2f\", \"\\u092d\\u093e\\u0930\\u0924 \\u0917\\u0923\\u0930\\u093e\\u091c\\u094d\\u092f\", \"Republic of india\", \"\\u091c\\u0941\\u092e\\u094d\\u0939\\u0942\\u0930\\u093f\\u092f\\u0924 \\u092d\\u093e\\u0930\\u0924\", \"Hindio\", \"The Republic of India\", \"\\u0c2d\\u0c3e\\u0c30\\u0c24 \\u0c17\\u0c23\\u0c24\\u0c02\\u0c24\\u0c4d\\u0c30 \\u0c30\\u0c3e\\u0c1c\\u0c4d\\u0c2f\\u0c2e\\u0c41\", \"India's\", \"Hindistan\", \"\\u0a2d\\u0a3e\\u0a30\\u0a24 \\u0a17\\u0a23\\u0a24\\u0a70\\u0a24\\u0a30\", \"Bhart\", \"India\", \"\\u0c2d\\u0c3e\\u0c30\\u0c24 \\u0c30\\u0c3f\\u0c2a\\u0c2c\\u0c4d\\u0c32\\u0c3f\\u0c15\\u0c4d\", \"India.\", \"\\u09ad\\u09be\\u09f0\\u09a4 \\u0997\\u09a3\\u09f0\\u09be\\u099c\\u09cd\\u09af\", \"Indian State\", \"ISO 3166-1 alpha-3/IND\", \"\\u09ad\\u09be\\u09b0\\u09a4\\u09c0\\u09af\\u09bc \\u09aa\\u09cd\\u09b0\\u099c\\u09be\\u09a4\\u09a8\\u09cd\\u09a4\\u09cd\\u09b0\"]", "[\"Yves Saint-Laurent\", \"Yves Saint Laurent (disambiguation)\", \"Yves Saint Laurent\", \"Yves St Laurent\", \"Yves St. Laurent\"]", "[\"Human species\", \"Humans as primates\", \"Human\", \"Human Being\", \"the human species\", \"Man (anthropology and biology)\", \"Human being\", \"Terran (Homo Sapien)\", \"Humans\", \"All Humankind\", \"Human habitat and population\", \"Humano\", \"Human kind\", \"People of this planet\", \"Humankind\", \"Huamn\", \"Human Beings\", \"Human race\", \"Human beings\", \"Human habitat\"]", "[\"Prehistoric supercontinents\", \"Super continent\", \"Megacontinent\", \"Supercontinent\", \"Supercontinents\"]", "[\"Napoleon Buonaparte\", \"Napolean bonapart\", \"Bonaparte\", \"Napoleonist\", \"Napoleon Boneparte\", \"Le petit caporal\", \"Napoleaon\", \"Napolen's coup\", \"Napoleone Bonaparte\", \"Age of Napoleon\", \"Napol\\u00e9on Buonaparte\", \"Napole\\u00f3n\", \"Emperor Napoleon\", \"Napoleon the Great\", \"Napoleon I of France\", \"Napoleon I of France bibliography\", \"Napol\\u00e9on\", \"Napolean Bonapart\", \"Napol\\u00e9on I, Emperor of the French\", \"Napolean Bonaparte\", \"Napoleon Bonapart\", \"Napeoleon\", \"Napolean bonarparte\", \"Emperor Napoleon I\", \"Napolean\", \"Napoleon Bonaparte\", \"Napoloen\", \"Emperor of France Napoleon I\", \"Napoleon I Bonaparte\", \"Napoleone Buonaparte\", \"Napoleon bonaparte\", \"Napolian\", \"Napol\\u00e9on Bonaparte\", \"Napoleon's\", \"Napoleonic\", \"Napoleon I, Emperor of the French\", \"Jupiter Scapin\", \"Nepolian\", \"Napoleon I of the French\", \"Little Corporal\", \"Napoleon I of Italy\", \"Napoleon bonepart\", \"Napol\\u00e9on I\", \"Armed Soldier of Democracy\", \"Napoleon I the Great of the French bibliography\", \"Napoleon i of france\", \"Napoleon i of france bibliography\", \"Napol\\u00e9on I of France\", \"Napoleon's height\", \"Napoleon Ier\", \"Napoleon I\", \"General Bonaparte\", \"Napoleone di Buonaparte\", \"Napole\\u00f3n Bonaparte\", \"G\\u00e9n\\u00e9ral Bonaparte\", \"Jean d'Epee\", \"Napoleon\", \"Napoleon I of the French bibliography\", \"Napoleon Emperor of France\", \"Boneparte\", \"Napoleon of France\", \"Napol\\u00e9on Ier\", \"Napol\\u00e9on I Bonaparte\"]", "[\"Brompton Road\"]", "[\"TEA\", \"Tea (disambiguation)\", \"T.E.A.\", \"TEA (disambiguation)\"]", "[\"American Pie (disambiguation)\", \"American pie\", \"American Pie by Don Mclean\", \"American Pie\"]", "[\"Martin Van Buren\", \"Martin van Buren\", \"Martin VanBuren\", \"Martin van bueren\", \"President Van Buren\", \"The Little Magician\", \"Little Magician\", \"Martin Van Ruin\", \"8th President of the United States\", \"MARTIN VAN BUREN\", \"Presidency of Martin Van Buren\", \"Maarten van Buren\", \"Van Buren Administration\", \"Eighth President of the United States\", \"Martin van bueran\", \"Martin Van Buran\", \"Old Kinderhook\"]", "[\"Mark Twain\", \"Thomas Jefferson Snodgrass\", \"Sam Clemens\", \"Samuel Clements\", \"Twainesque\", \"Samuel Langhorn Clemens\", \"Mark twain\", \"Twain, Mark\", \"Sergeant Fathom\", \"Samuel Longhorn Clemens\", \"Samuel L. Clemens\", \"Samuel Langhorne Clemens\", \"Sam Langhorne Clemens\", \"Samuel Clemens\", \"SL Clemens\", \"Twainian\", \"Reports of my death are greatly exaggerated\", \"Soleather\", \"W. Epaminondas Adrastus Blab\", \"Samuel Longhorne Clemens\", \"Marc Twain\", \"Samual Clemens\"]", "[\"Johannes Vermeer van Delft\", \"Catherina Bolnes\", \"Johannes (Jan) Vermeer\", \"Johannes %22Jan%22 Vermeer\", \"Jan van Der Meer\", \"Jan van der meer\", \"Jan van der Meer\", \"Johan Vermeer\", \"Johannes Vermeer\", \"Jan van der Meer van Delft\", \"Vermeer\", \"Jan Vermeer van Delft\", \"Jan Vermeer\", \"VERMEER\"]", "[\"Oxford, england\", \"Oxeford\", \"Lion Brewery (U.K.)\", \"Oxford, UK\", \"Oxford astrophysics\", \"City of Dreaming Spires\", \"Oxford, England\", \"Oxford (England)\", \"Oxford\", \"Oxford, Oxfordshire\", \"The Dreaming Spires\", \"City of Oxford\", \"UN/LOCODE:GBOXF\", \"OXFORD\", \"City of dreaming spires\", \"Ford of the Oxen\", \"County Borough of Oxford\", \"The weather in Oxford\", \"Oxford, United Kingdom\", \"Morrells brewery\", \"The city of dreaming spires\", \"Oxenaforda\"]", "[\"1967\", \"one thousand, nine hundred and sixty-seven\"]" ]
[ "Grey Street, named after Prime Minister Earl Grey, is a major street in which British city?", "The strait of Magellan separates which island from South America?", "In what country, the world's seventh largest by geographical area, is Christmas known as Bada Din (the big day)?", "Which perfume company make the fragrance Nu?", "A misanthrope is characterized by the hatred of what?", "Pangaea, Laurasia and Gondwana are?", "Sir Hudson Lowe was whose gaoler?", "In which London road is Harrod’s department store?", "Bohea is a type of what?", "At auction in 2015, $1.2m was paid for Don McLean's original handrwitten lyrics for which 1971 big hit song?", "Who was the first American President not of British descent?", "\"Which author said \"\"A classic is something everyone wants to have read but nobody wants to read\"\"?\"", "\"The painting \"\"the Girl with the Pearl Earring\"\" is by which artist?\"", "Which book is often referred to as the O.E.D.", "When was the first Super Bowl for American football held?" ]
15
[ 87570, 87571, 87572, 87573, 87574, 87575, 87576, 87577, 87578, 87579, 87580, 87581, 87582, 87583, 87584 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: For which newspaper did Superman work?\nQuestion 2: What is Edward Hopper's famous night-time painting of customers in an American diner?\nQuestion 3: Which Benjamin Britten opera was composed to commemorate the coronation of Queen Elizabeth the Second?\nQuestion 4: Which club won UEFA's inaugural European Champion Clubs' Cup in 1956?\nQuestion 5: Which pop group took it’s name from an unemployment benefit card\nQuestion 6: ‘Gooners’ are supporters of which London football club?\nQuestion 7: Who was the first US President to appear on colour television?\nQuestion 8: Anthony van Dyke was court painter of which English monarch?\nQuestion 9: What name is given to atoms with the same atomic number but different numbers of neutrons in their nuclei?\nQuestion 10: The city of Leningrad, Russia, is now known as what?\nQuestion 11: What term is used to describe the furthest point of the moon from the Earth?\nQuestion 12: Which major figure (1893-1976) is tattooed on Mike Tyson's right shoulder?\nQuestion 13: How many bones, altogether, does a horse have in its neck?\nQuestion 14: In which French cathedral were the kings of France crowned until 1825?\nQuestion 15: Which English dramatistwrote 'Hobson's Choice'?", "role": "user" } ]
["[\"Daily Planet\", \"The Daily Planet\"]", "[\"The Diner Painting\", \"Nighthawks\", \"Nighthawks in popular culture\", \"Nighthawks in Popular Culture\"]", "[\"Gloriana (opera)\", \"Gloriana\"]", "[\"Real madrid cf\", \"Sociedad Madrid Foot-ball Club\", \"Real Madrid\", \"Madrid FC\", \"Real madrid\", \"Supporters of Real Madrid C.F.\", \"Real Madrid F.C.\", \"Real Madrid Club de F\\u00fatbol\", \"Real Madrid FC\", \"Real Madrid C.F.\", \"Madrid CF\", \"Real Madrid C. F.\", \"Real Madrid C F\", \"RMCF\", \"Los Blancos\", \"Real Madrid C.F\", \"Realmadrid.com\", \"Real Madrid CF\", \"Real Madrid Captains\", \"Royal Madrid\", \"Real Madrid Club de Futbol\", \"The Real Madrid\", \"Real Madrid Statistics 2005/06\"]", "[\"James Brown (drummer)\", \"Michael Virtue\", \"UB 40\", \"UB40\", \"Astro (musician)\", \"UB40 Reunited\", \"Robin Campbell (guitarist)\", \"Robin Campbell (musician)\", \"UB-40\", \"Ub40\"]", "[\"Arsenal (weaponry)\", \"Arsenals\", \"Arsenal\", \"Arsenal (ammunition)\", \"Armory (military)\", \"Armoury\", \"Armoury (military)\"]", "[\"Eisenhower Dwight\", \"Health issues of Dwight D. Eisenhower\", \"D. D. Eisenhower\", \"Dynamic Conservatism\", \"General Dwight Eisenhower\", \"David Jacob Eisenhower\", \"Dweight Eisenhower\", \"34th President of the United States\", \"Dwight E Eisenhower\", \"Eisehower\", \"President Dwight D. Eisenhower\", \"David Dwight Eisenhower\", \"Ike (nickname)\", \"Eisenhower\", \"Eishenhower\", \"General Dwight David Eisenhower\", \"Dwight D. Eisenhower\", \"President Eisenhower\", \"Ike Eisenhower\", \"Dwight Eisenhower\", \"D. Eisenhower\", \"General Eisenhower\", \"David D. Eisenhower\", \"President Dwight Eisenhower\", \"Dwight eisenhower\", \"Dwight Eisenhour\", \"Dwight Eisienhower\", \"Dwight Eisenhauer\", \"Dwight David Eisenhower\", \"Dwight D Eisenhower\", \"General of the Army Dwight Eisenhower\"]", "[\"Charles the First\", \"King Charles I\", \"Charles I\", \"Charles 1st\", \"Charles 1\", \"Charles First\", \"Charles I (disambiguation)\"]", "[\"Isotopes\", \"Chemical isotope\", \"Nuclide notation\", \"AZE notation\", \"Isotope notation\", \"Isotope\", \"Nuclear notation\", \"Isotopic notation\", \"Index to isotope pages\", \"Ice otope\"]", "[\"St Petersb.\", \"Saint Petersberg\", \"Peterpolis\", \"Sankt Petrburg\", \"UN/LOCODE:RULED\", \"St-Petersburg\", \"St petersburg\", \"St. Petersburg\", \"St. Petersburg, Russa\", \"Saint Petersburg\", \"Saint-Peterburg\", \"Pietarissa\", \"Art Pictures St. Petersburg\", \"Russia St. Petersburg\", \"Sankt Petersburg\", \"Monuments of Saint Petersburg\", \"Peterburg\", \"RU-SPE\", \"St. petersbourg\", \"Piter, Russia\", \"Leningrad, Soviet Union\", \"Petersburg, Russia\", \"St Petersburg, Russia\", \"Peterburi\", \"Saint petersburg\", \"Saint Petersburg (Russia)\", \"St. Petersberg\", \"Saint Petersburg, Russia (Federation)\", \"Lenningrad\", \"Sankt Pieterburg\", \"St. Petursburg\", \"Leningrad, USSR\", \"St. Petersburg, Russia\", \"Saint Petersburg, Russia\", \"Petrograd\", \"Peterpole\", \"St Petersburg\", \"Peter, Russia\", \"St. petersburg\", \"Landscrona\", \"Saint Peterburg\", \"Saint-Petersburg\", \"St. Peterburg\", \"Saint Petersburg City\", \"St petersbourg\", \"Leningrad\", \"St. Petersburgh\", \"\\u041b\\u0435\\u043d\\u0438\\u043d\\u0433\\u0440\\u0430\\u0434\", \"Sankt-Petersburg\", \"Leningrad, Russia\", \"\\u0421\\u0430\\u043d\\u043a\\u0442-\\u041f\\u0435\\u0442\\u0435\\u0440\\u0431\\u0443\\u0440\\u0433\", \"Sankt Peterburg\", \"Saint Peterburg, Russia\", \"Sankt-Peterburg Federal City, Russia\", \"Sankt-Peterburg\", \"St Petersberg\", \"St.Petersburg\", \"Saint Petersburgh\"]", "[\"Apihelion\", \"Aposelene\", \"Perihadion\", \"Apomelasma\", \"Pericytherion\", \"Apogeum\", \"Apastron\", \"Pericenter\", \"Aphadion\", \"Apoapsis\", \"Apuranion\", \"Apoareion\", \"Periapsis distance\", \"Periuranion\", \"Perijove\", \"Apogee\", \"Perizene\", \"Perikrone\", \"Apojove\", \"Perigee\", \"Apsides\", \"Apses\", \"Apogalactic\", \"Apoapse\", \"Periapse\", \"Periselene\", \"Perigalacticon\", \"Perimelasma\", \"Apsis\", \"Apocenter\", \"Perinigricon\", \"Apo-apsis\", \"Perihelion distance\", \"Apolune\", \"Perigeum\", \"Periastron\", \"Periapsis\", \"Perigalactic\", \"Apocytherion\", \"Closest Approach\", \"Perihermion\", \"Apoposeidion\", \"Apapsis\", \"Aphermion\", \"Apozene\", \"Perihelia\", \"Apokrone\", \"Perigree\", \"Galacticon\", \"Apoapsis distance\", \"Perilune\", \"Periareion\", \"Periphelion\", \"Periposeidion\", \"Apocynthion\", \"Apoastron\", \"Aponigricon\", \"APOGEE\"]", "[\"Mao Ze-dong\", \"Maozedong\", \"Mao Tse-Tung\", \"Genealogy of Mao Zedong\", \"Mao Tse'tung\", \"Mao Tse Tong\", \"Mao Zedang\", \"\\u6bdb\\u6fa4\\u6771\", \"\\u6bdb\\u4e3b\\u5e2d\", \"Chairman Mao Zedong\", \"Mao Tse-Dong\", \"More Ze-dong\", \"Mao tse Tung\", \"Mao Tsedung\", \"\\u6bdb\\u6cfd\\u4e1c\", \"Mao zedung\", \"Mao Yongzhi\", \"Mao Tsedong\", \"Mao Runzhi\", \"Mao Tse Toung\", \"Mao Ze Dong\", \"Mao Zedong (Mao Tse-tung)\", \"Mao Tsetung\", \"Zedong\", \"M\\u00e1o Z\\u00e9d\\u014dng\", \"Mall Zedong\", \"Zedong Mao\", \"\\u6f64\\u829d\", \"Mao Tse-dong\", \"Jun-Chih\", \"Mao Tse-toung\", \"Mao Dsu Tung\", \"Mao Zadong\", \"Mao Se Tung\", \"R\\u00f9nzhi\", \"Mao Tse-tung\", \"Zdong\", \"Mao Zedong\", \"Mao zedong\", \"Junchih\", \"Mao-Tse-tung\", \"Jun-chih\", \"Chairman Mao Tse-tung\", \"Mao-Tse Tung\", \"Mao Tse Tung\", \"Mao Tse-Dung\", \"Mao Tsetong\", \"Poems by Mao Zedong\", \"Mousie Dung\", \"Mau: tsu.tUNG\", \"MAO TSE TUNG\", \"Mall Ze-dong\", \"Early life of Mao\", \"Mao Ze-Dung\", \"Mao Zhedong\", \"M\\u00e1o Z\\u00e9dong\", \"Mao Tse-Tounge\", \"Mao tse-tung\", \"Mao Tze-Tung\", \"Mao ZeDong\", \"Mao Ts\\u00e9-toung\", \"Political ideas of Mao Zedong\", \"Mao Tse-tong\", \"Runzhi\", \"Chairman Mao\", \"\\u6f64\\u829d\\u00b9\", \"\\u6da6\\u829d\", \"Mao Tse-dung\", \"Mao tsetong\", \"Tse Tung Mao\", \"First Red Emperor\", \"Tse-tung Mao\", \"Mao\", \"Mao Tze Tung\", \"Poetry by Mao Zedong\", \"Chairman of the Politburo and Secretariat\", \"Mao Tze-tung\", \"R\\u00f9nzh\\u012b\", \"More Zedong\"]", "[\"Seven\", \"seven\", \"7\"]", "[\"Notre Dame de Reims\"]", "[\"Harold Brighouse\", \"HAROLD BRIGHOUSE\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Daily Planet\", \"The Daily Planet\"]", "[\"The Diner Painting\", \"Nighthawks\", \"Nighthawks in popular culture\", \"Nighthawks in Popular Culture\"]", "[\"Gloriana (opera)\", \"Gloriana\"]", "[\"Real madrid cf\", \"Sociedad Madrid Foot-ball Club\", \"Real Madrid\", \"Madrid FC\", \"Real madrid\", \"Supporters of Real Madrid C.F.\", \"Real Madrid F.C.\", \"Real Madrid Club de F\\u00fatbol\", \"Real Madrid FC\", \"Real Madrid C.F.\", \"Madrid CF\", \"Real Madrid C. F.\", \"Real Madrid C F\", \"RMCF\", \"Los Blancos\", \"Real Madrid C.F\", \"Realmadrid.com\", \"Real Madrid CF\", \"Real Madrid Captains\", \"Royal Madrid\", \"Real Madrid Club de Futbol\", \"The Real Madrid\", \"Real Madrid Statistics 2005/06\"]", "[\"James Brown (drummer)\", \"Michael Virtue\", \"UB 40\", \"UB40\", \"Astro (musician)\", \"UB40 Reunited\", \"Robin Campbell (guitarist)\", \"Robin Campbell (musician)\", \"UB-40\", \"Ub40\"]", "[\"Arsenal (weaponry)\", \"Arsenals\", \"Arsenal\", \"Arsenal (ammunition)\", \"Armory (military)\", \"Armoury\", \"Armoury (military)\"]", "[\"Eisenhower Dwight\", \"Health issues of Dwight D. Eisenhower\", \"D. D. Eisenhower\", \"Dynamic Conservatism\", \"General Dwight Eisenhower\", \"David Jacob Eisenhower\", \"Dweight Eisenhower\", \"34th President of the United States\", \"Dwight E Eisenhower\", \"Eisehower\", \"President Dwight D. Eisenhower\", \"David Dwight Eisenhower\", \"Ike (nickname)\", \"Eisenhower\", \"Eishenhower\", \"General Dwight David Eisenhower\", \"Dwight D. Eisenhower\", \"President Eisenhower\", \"Ike Eisenhower\", \"Dwight Eisenhower\", \"D. Eisenhower\", \"General Eisenhower\", \"David D. Eisenhower\", \"President Dwight Eisenhower\", \"Dwight eisenhower\", \"Dwight Eisenhour\", \"Dwight Eisienhower\", \"Dwight Eisenhauer\", \"Dwight David Eisenhower\", \"Dwight D Eisenhower\", \"General of the Army Dwight Eisenhower\"]", "[\"Charles the First\", \"King Charles I\", \"Charles I\", \"Charles 1st\", \"Charles 1\", \"Charles First\", \"Charles I (disambiguation)\"]", "[\"Isotopes\", \"Chemical isotope\", \"Nuclide notation\", \"AZE notation\", \"Isotope notation\", \"Isotope\", \"Nuclear notation\", \"Isotopic notation\", \"Index to isotope pages\", \"Ice otope\"]", "[\"St Petersb.\", \"Saint Petersberg\", \"Peterpolis\", \"Sankt Petrburg\", \"UN/LOCODE:RULED\", \"St-Petersburg\", \"St petersburg\", \"St. Petersburg\", \"St. Petersburg, Russa\", \"Saint Petersburg\", \"Saint-Peterburg\", \"Pietarissa\", \"Art Pictures St. Petersburg\", \"Russia St. Petersburg\", \"Sankt Petersburg\", \"Monuments of Saint Petersburg\", \"Peterburg\", \"RU-SPE\", \"St. petersbourg\", \"Piter, Russia\", \"Leningrad, Soviet Union\", \"Petersburg, Russia\", \"St Petersburg, Russia\", \"Peterburi\", \"Saint petersburg\", \"Saint Petersburg (Russia)\", \"St. Petersberg\", \"Saint Petersburg, Russia (Federation)\", \"Lenningrad\", \"Sankt Pieterburg\", \"St. Petursburg\", \"Leningrad, USSR\", \"St. Petersburg, Russia\", \"Saint Petersburg, Russia\", \"Petrograd\", \"Peterpole\", \"St Petersburg\", \"Peter, Russia\", \"St. petersburg\", \"Landscrona\", \"Saint Peterburg\", \"Saint-Petersburg\", \"St. Peterburg\", \"Saint Petersburg City\", \"St petersbourg\", \"Leningrad\", \"St. Petersburgh\", \"\\u041b\\u0435\\u043d\\u0438\\u043d\\u0433\\u0440\\u0430\\u0434\", \"Sankt-Petersburg\", \"Leningrad, Russia\", \"\\u0421\\u0430\\u043d\\u043a\\u0442-\\u041f\\u0435\\u0442\\u0435\\u0440\\u0431\\u0443\\u0440\\u0433\", \"Sankt Peterburg\", \"Saint Peterburg, Russia\", \"Sankt-Peterburg Federal City, Russia\", \"Sankt-Peterburg\", \"St Petersberg\", \"St.Petersburg\", \"Saint Petersburgh\"]", "[\"Apihelion\", \"Aposelene\", \"Perihadion\", \"Apomelasma\", \"Pericytherion\", \"Apogeum\", \"Apastron\", \"Pericenter\", \"Aphadion\", \"Apoapsis\", \"Apuranion\", \"Apoareion\", \"Periapsis distance\", \"Periuranion\", \"Perijove\", \"Apogee\", \"Perizene\", \"Perikrone\", \"Apojove\", \"Perigee\", \"Apsides\", \"Apses\", \"Apogalactic\", \"Apoapse\", \"Periapse\", \"Periselene\", \"Perigalacticon\", \"Perimelasma\", \"Apsis\", \"Apocenter\", \"Perinigricon\", \"Apo-apsis\", \"Perihelion distance\", \"Apolune\", \"Perigeum\", \"Periastron\", \"Periapsis\", \"Perigalactic\", \"Apocytherion\", \"Closest Approach\", \"Perihermion\", \"Apoposeidion\", \"Apapsis\", \"Aphermion\", \"Apozene\", \"Perihelia\", \"Apokrone\", \"Perigree\", \"Galacticon\", \"Apoapsis distance\", \"Perilune\", \"Periareion\", \"Periphelion\", \"Periposeidion\", \"Apocynthion\", \"Apoastron\", \"Aponigricon\", \"APOGEE\"]", "[\"Mao Ze-dong\", \"Maozedong\", \"Mao Tse-Tung\", \"Genealogy of Mao Zedong\", \"Mao Tse'tung\", \"Mao Tse Tong\", \"Mao Zedang\", \"\\u6bdb\\u6fa4\\u6771\", \"\\u6bdb\\u4e3b\\u5e2d\", \"Chairman Mao Zedong\", \"Mao Tse-Dong\", \"More Ze-dong\", \"Mao tse Tung\", \"Mao Tsedung\", \"\\u6bdb\\u6cfd\\u4e1c\", \"Mao zedung\", \"Mao Yongzhi\", \"Mao Tsedong\", \"Mao Runzhi\", \"Mao Tse Toung\", \"Mao Ze Dong\", \"Mao Zedong (Mao Tse-tung)\", \"Mao Tsetung\", \"Zedong\", \"M\\u00e1o Z\\u00e9d\\u014dng\", \"Mall Zedong\", \"Zedong Mao\", \"\\u6f64\\u829d\", \"Mao Tse-dong\", \"Jun-Chih\", \"Mao Tse-toung\", \"Mao Dsu Tung\", \"Mao Zadong\", \"Mao Se Tung\", \"R\\u00f9nzhi\", \"Mao Tse-tung\", \"Zdong\", \"Mao Zedong\", \"Mao zedong\", \"Junchih\", \"Mao-Tse-tung\", \"Jun-chih\", \"Chairman Mao Tse-tung\", \"Mao-Tse Tung\", \"Mao Tse Tung\", \"Mao Tse-Dung\", \"Mao Tsetong\", \"Poems by Mao Zedong\", \"Mousie Dung\", \"Mau: tsu.tUNG\", \"MAO TSE TUNG\", \"Mall Ze-dong\", \"Early life of Mao\", \"Mao Ze-Dung\", \"Mao Zhedong\", \"M\\u00e1o Z\\u00e9dong\", \"Mao Tse-Tounge\", \"Mao tse-tung\", \"Mao Tze-Tung\", \"Mao ZeDong\", \"Mao Ts\\u00e9-toung\", \"Political ideas of Mao Zedong\", \"Mao Tse-tong\", \"Runzhi\", \"Chairman Mao\", \"\\u6f64\\u829d\\u00b9\", \"\\u6da6\\u829d\", \"Mao Tse-dung\", \"Mao tsetong\", \"Tse Tung Mao\", \"First Red Emperor\", \"Tse-tung Mao\", \"Mao\", \"Mao Tze Tung\", \"Poetry by Mao Zedong\", \"Chairman of the Politburo and Secretariat\", \"Mao Tze-tung\", \"R\\u00f9nzh\\u012b\", \"More Zedong\"]", "[\"Seven\", \"seven\", \"7\"]", "[\"Notre Dame de Reims\"]", "[\"Harold Brighouse\", \"HAROLD BRIGHOUSE\"]" ]
[ "For which newspaper did Superman work?", "What is Edward Hopper's famous night-time painting of customers in an American diner?", "Which Benjamin Britten opera was composed to commemorate the coronation of Queen Elizabeth the Second?", "Which club won UEFA's inaugural European Champion Clubs' Cup in 1956?", "Which pop group took it’s name from an unemployment benefit card", "‘Gooners’ are supporters of which London football club?", "Who was the first US President to appear on colour television?", "Anthony van Dyke was court painter of which English monarch?", "What name is given to atoms with the same atomic number but different numbers of neutrons in their nuclei?", "The city of Leningrad, Russia, is now known as what?", "What term is used to describe the furthest point of the moon from the Earth?", "Which major figure (1893-1976) is tattooed on Mike Tyson's right shoulder?", "How many bones, altogether, does a horse have in its neck?", "In which French cathedral were the kings of France crowned until 1825?", "Which English dramatistwrote 'Hobson's Choice'?" ]
15
[ 13650, 13651, 13652, 13653, 13654, 13655, 13656, 13657, 13658, 13659, 13660, 13661, 13662, 13663, 13664 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which cartoon character, who cooks at the Krusty Krab, lives in a pineapple under the sea?\nQuestion 2: What was the name of the Royal Navy Frigate featured in the Radio Comedy Series The Navy Lark?\nQuestion 3: Who wrote the novel Evening Class?\nQuestion 4: Who in the Old Testament is the sister of Moses?\nQuestion 5: How is the chemical compound Polyvinyl Chloride better known?\nQuestion 6: In the Sue Townsend novels, what is the first name of the love of 'Adrian Mole's' life?\nQuestion 7: In Greek mythology, one of the labours of Hercules was to procure the ‘what’ belonging to Zeus, which were guarded by the Hesperides?\nQuestion 8: On which island could you find an active volcano called 'Hekla'?\nQuestion 9: \"These are the first lines from what song: \"\"I was a humdrum person, leading a life apart, when love flew in through my window wide, and quickened my humdrum heart\"\"?\"\nQuestion 10: What two word phrase is Sweeney Todd Cockney rhyming slang for?\nQuestion 11: In the USA, the Colorado Beetle is a major pest that attacks which crop?\nQuestion 12: Which company's original brief to Brian Eno was to compose a piece of inspirational music to last 3.25 seconds?\nQuestion 13: How many fluid ounces are in one quarter of an imperial pint?\nQuestion 14: The effective discovery of what particle was announced by CERN at the Large Hadron Collider in 2012?\nQuestion 15: American poet Dixon Lanier Merritt's well-known limerick is about what bird?", "role": "user" } ]
["[\"Money And Music\", \"Sand Mountain (Bikini Bottom)\", \"Boat mobile\", \"Mrs. Puff's Boating School\", \"Patrick Starfish (character)\", \"Spongebob squarepants controversy\", \"Krusty Towers (location)\", \"SpongeBob squarepants\", \"Bikini Bottom Jail\", \"National No SpongeBob Day\", \"The ugly barnacle\", \"SpongeBob Universe\", \"Bikini Bottom Boat\", \"Boys Who Cry\", \"Sea Needle\", \"Spongebob (video game)\", \"Krusty Krab 2\", \"SpongeBob theme song\", \"Frozen Face Off\", \"Spongebobs\", \"Krabby patty Secret Sauce\", \"Music of SpongeBob SquarePants\", \"TV Networks airing SpongeBob SquarePants\", \"SpongeBob SquarePants (TV show)\", \"The SpongeBob SquarePants Movie (film franchise)\", \"Bikini Bottom News\", \"The Rusty Krab\", \"Shady Shoals Rest Homes\", \"Chumbucket\", \"SpongeBob Nation\", \"Changed Names (SpongeBob TV Series)\", \"Patrick Bio\", \"SpongeBob SquareShorts\", \"Stingray 5000\", \"SpongeBob SquarePants\", \"Shell Shack\", \"Sponge-bob-square-pants\", \"SpongeBob SquarePants theme song\", \"Krabby Patty formula\", \"Name changes on SpongeBob SquarePants\", \"Spongebob joystick game\", \"SpongeBoy SquarePants\", \"SpongeBob SquarePants: Collapse!\", \"Ultimate SpongeBob SpongeBash\", \"Criticism of Spongebob Squarepants\", \"Spongebob Sqaurepants\", \"Goo Lagoon\", \"Port-O-Head\", \"The SpongeBob SquarePants Movie (series)\", \"Spongebob (the show)\", \"Spongeboob\", \"The Wisenheimers\", \"Bikini Bottom\", \"Astrology with Squidward\", \"SpongeBob SquarePants TV Game\", \"Sponge Bob Squarepants\", \"SpongeBob SquarePants (TV series)\", \"Deuueaugh\", \"Spongebob Squarepants theme song\", \"Shady Shoals Rest Home\", \"Krusty krab pizza\", \"Jellyfish Fields\", \"Bob Esponja\", \"Barg'n Mart\", \"Rusty Krab\", \"Criticism of SpongeBob SquarePants\", \"Kuddly Krab\", \"Sponge Bob SquarePants\", \"Recurring jokes in SpongeBob SquarePants\", \"Patrick Star Adventures\", \"Boatmobile\", \"Spongbob\", \"Krabby patty\", \"Palace of Pranks\", \"Jellyfishing(Hobby)\", \"S\\u00fcngerBob KarePantolon\", \"Jellyfishing (hobby)\", \"Frycook of The Chum Bucket\", \"King Amoeba\", \"List of places in Bikini Bottom\", \"Monster Krabby Patty\", \"List of SpongeBob SquarePants crew\", \"SpongeBob SquarePants controversy\", \"Evil Spongebob\", \"Bikini Bottomshire\", \"Spongebobsquarepants\", \"Spongebob SquarePants\", \"Mr. Seaweed\", \"SpongeBob.com\", \"What Zit Tooya\", \"Who lives in a pineapple under the sea%3F\", \"Spongebob\", \"Doodle Bob\", \"Spongebob Squarepants\", \"SpongePedia\", \"The KK\", \"SquarePants\", \"International Following of SpongeBob SquarePants\", \"Spongebob squarepants series\", \"First Nautical Bank\", \"SpongeBob Squarepants Controversy\", \"Sponge Bob\", \"Queen Mildew\", \"SpongeBob\", \"Crabby Patty\", \"Mr. Sea Chicken\", \"Spongebob squarepants\", \"The SpongeBob SquarePants Movie (film series)\", \"What zit tooya\", \"Every Villian is Lemons\", \"Jellyfish (SpongeBob SquarePants)\", \"History of SpongeBob SquarePants\", \"Oops ouchskies\", \"SPONGEBOB SQUAREPANTS\", \"Bob l'\\u00e9ponge\", \"Shady Shoals\", \"Who lives in a pineapple under the sea\", \"SpongeBob SquarePants cast\", \"SpongeBoy Ahoy!\", \"Spongebob's Jobs\", \"Sponge Bob Square Pants\", \"SpongeBob Square Pants\", \"Spongebob theme song\", \"Mindy the Mermaid\", \"Sponge-bob square-pants\", \"King Jellyfish\", \"Krusty Krab Inc.\", \"SpongeBob (video game)\", \"International following of SpongeBob SquarePants\", \"SpongeBob Squarepants\", \"Bulac\", \"Spongebob's Pineapple House\", \"SpongeBob Bio\", \"Spongebob and the Mystery with a Twistery\", \"Duhfish\", \"S. S. Cheapskate\", \"Sponge bob square pants\", \"SpongeBob SquarePants (series)\", \"SpongeBob & The Hi-Seas\"]", "[\"Navy Lark\", \"HMS Troutbridge\", \"HMS TROUTBRIDGE\", \"H.m.s. troutbridge\", \"The Navy Lark\", \"Able Seaman Johnson\"]", "[\"Maeve Binchy\"]", "[\"Minimum information requested in the annotation of biochemical models\", \"Minimum information required in the annotation of biochemical models\", \"Minimal Information Requested In the Annotation of biochemical Models\", \"MIRIAM\", \"Minimum Information Requested in the Annotation of biochemical Models\", \"Minimum Information Required in the Annotation of Models\", \"Minimum information required in the annotation of models\"]", "[\"Polyvinyl chloride workers\", \"3 (plastic)\", \"PolyVinyl Chloride\", \"Polyvinyl resin\", \"UPVC\", \"Poly-vinyl chloride\", \"Vinylite\", \"Polyvinyl Chloride\", \"PVC\", \"Upvc\", \"Vinyl lettering\", \"3 (resin identification code)\", \"P.V.C.\", \"Poly (vinyl chloride)\", \"Polyvinylchloride\", \"Polyvinyl chloride\", \"PVC piping\", \"Vinyl plastic\", \"Vinyl floor\", \"Poly(vinyl chloride)\", \"Vinyl flooring\", \"Poly(chloroethanediyl)\", \"Pvc\", \"Unplasticized polyvinyl chloride\", \"Polychloroethene\"]", "[\"'PANDORA'\", \"Pandora Archive\", \"Australia's Web Archive\", \"Pandora Web Archive\", \"PANDORA\", \"Preserving and Accessing Networked Documentary Resources of Australia\"]", "[\"Pomum aurantium\", \"Golden apples\", \"Golden apple\", \"Golden Apples of the Hesperides\", \"Golden Apples\"]", "[\"IJsland\", \"Icedland\", \"The land of ice and snow\", \"Icelandic isles\", \"L\\u00fd\\u00f0veldi\\u00f0 \\u00edsland\", \"Iceland\", \"ISO 3166-1:IS\", \"The Republic of Iceland\", \"Ice-land\", \"Hyui\", \"Republic of Iceland\", \"\\u00cdsland\", \"ICELAND\", \"Lydveldid island\", \"Icealnd\", \"Ice land\", \"Mainland Iceland\", \"Island of Iceland\"]", "[\"What Is This Thing Called Love\", \"What is This Thing Called Love%3F\", \"What Is This Thing Called Love%3F\"]", "[\"Flying squad\", \"Flying Squad\"]", "[\"Idaho potato\", \"Potato farmer\", \"Potatos\", \"Cooking potatoes\", \"Boiled Potatoes\", \"Potato, Irish\", \"Pottato\", \"Tattie\", \"New potatoes\", \"Pomme Terre\", \"Pratie\", \"Patatoes\", \"Potato farm\", \"German Butterball\", \"Poetato\", \"Spud\", \"History of Potatoes\", \"Solanum tuberosum\", \"Roast potato\", \"Potato (northern)\", \"Red potato\", \"White potatoes\", \"Potato\", \"White potato\", \"Potatoes\", \"Super tuber\", \"Boiled potatos\", \"New potato\", \"Potato industry\", \"Kerris Pink\", \"Irish potato\", \"Boiled potato\", \"Potater\", \"Purple potato\", \"Tatey\", \"Alu (tuber)\", \"History of potatoes\", \"Red Potato\", \"Maris Peer\", \"Potatoe\", \"Potato farmers\", \"Idaho Potato\", \"Solanum tuberosum tuberosum\", \"Culture of potato\", \"Pateeto\", \"Red potatoes\", \"Poetatoe\", \"Boiled potatoes\", \"Tatties\", \"Blue potato\", \"Potato skin\", \"Spuds\", \"POTATO\"]", "[\"'Microsoft Corp\", \"Microsoft Canada\", \"Mircosoft\", \"Microsoft Inc\", \"Micro soft\", \"Microsoat\", \"Microsoft corporation\", \"MSoft\", \"Office Corporation\", \"Microsoft Connect\", \"Microosft\", \"Mickeysoft\", \"Microsft\", \"Microsoft connect\", \"Windows Corporation\", \"Microsoft, Inc.\", \"Microsoft's\", \"Microsoft\", \"MS Corp\", \"AS8075\", \"Micrasoft\", \"Microsoft Inc.\", \"MSN Corporation\", \"Microcomputer software\", \"Microsoft, Incorporated\", \"Micro-soft\", \"Microsfot\", \"Microscam\", \"MicroSoft Corporation\", \"Microsoft Way\", \"Microsoft arc Mouse\", \"Microsoft.com\", \"Blibbet\", \"MICROSOFT\", \"Microsoft logos\", \".azure\", \"Microsoft Corp\", \"NASDAQ:MSFT\", \"Microsoft Corp.\", \"Aorato\", \"Micro-Soft\", \"Microsoft Incorporated\", \"Mikrosoft\", \"Micro Soft\", \"Microsoft Corporation\", \"Microsoft Ltd\", \"Microsoft Visitor Center\", \"Microsoft Corpration\", \"WebsiteSpark\", \".bing\", \"Www.microsoft.com\", \"MSLI\", \"MicroSoft\"]", "[\"five\", \"5\", \"Five\"]", "[\"God particle\", \"The Higgs particle\", \"Boson scalaire\", \"Hugs bison\", \"Higgs field\", \"God particle (physics)\", \"BEH boson\", \"Higgs boson particle\", \"Higgs bosun\", \"Higgs-Boson Particle\", \"God Particle\", \"The Higgs Boson\", \"Higgs Field\", \"H\\u2070\", \"Higgs excitation\", \"Brout-Englert-Higgs boson\", \"Higgs particle\", \"Higgs Non-Zero Value Field\", \"Higgs-boson\", \"Higgs boson\", \"Higgs Bozon\", \"Higgs Excitation\", \"Higgson\", \"Higgs-boson particle\", \"Higgs Particle\", \"Higg's boson\", \"Sms boson\", \"Introduction to the Higgs field\", \"Higgs Boson\", \"Godparticle\", \"Higgs' boson\", \"Higgs event\", \"God's particle\", \"Higgs bosons\"]", "[\"Pelecanidae\", \"Pelican\", \"Pelecanus\", \"Pelican in her piety\", \"Pelicans\", \"Pellican\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Money And Music\", \"Sand Mountain (Bikini Bottom)\", \"Boat mobile\", \"Mrs. Puff's Boating School\", \"Patrick Starfish (character)\", \"Spongebob squarepants controversy\", \"Krusty Towers (location)\", \"SpongeBob squarepants\", \"Bikini Bottom Jail\", \"National No SpongeBob Day\", \"The ugly barnacle\", \"SpongeBob Universe\", \"Bikini Bottom Boat\", \"Boys Who Cry\", \"Sea Needle\", \"Spongebob (video game)\", \"Krusty Krab 2\", \"SpongeBob theme song\", \"Frozen Face Off\", \"Spongebobs\", \"Krabby patty Secret Sauce\", \"Music of SpongeBob SquarePants\", \"TV Networks airing SpongeBob SquarePants\", \"SpongeBob SquarePants (TV show)\", \"The SpongeBob SquarePants Movie (film franchise)\", \"Bikini Bottom News\", \"The Rusty Krab\", \"Shady Shoals Rest Homes\", \"Chumbucket\", \"SpongeBob Nation\", \"Changed Names (SpongeBob TV Series)\", \"Patrick Bio\", \"SpongeBob SquareShorts\", \"Stingray 5000\", \"SpongeBob SquarePants\", \"Shell Shack\", \"Sponge-bob-square-pants\", \"SpongeBob SquarePants theme song\", \"Krabby Patty formula\", \"Name changes on SpongeBob SquarePants\", \"Spongebob joystick game\", \"SpongeBoy SquarePants\", \"SpongeBob SquarePants: Collapse!\", \"Ultimate SpongeBob SpongeBash\", \"Criticism of Spongebob Squarepants\", \"Spongebob Sqaurepants\", \"Goo Lagoon\", \"Port-O-Head\", \"The SpongeBob SquarePants Movie (series)\", \"Spongebob (the show)\", \"Spongeboob\", \"The Wisenheimers\", \"Bikini Bottom\", \"Astrology with Squidward\", \"SpongeBob SquarePants TV Game\", \"Sponge Bob Squarepants\", \"SpongeBob SquarePants (TV series)\", \"Deuueaugh\", \"Spongebob Squarepants theme song\", \"Shady Shoals Rest Home\", \"Krusty krab pizza\", \"Jellyfish Fields\", \"Bob Esponja\", \"Barg'n Mart\", \"Rusty Krab\", \"Criticism of SpongeBob SquarePants\", \"Kuddly Krab\", \"Sponge Bob SquarePants\", \"Recurring jokes in SpongeBob SquarePants\", \"Patrick Star Adventures\", \"Boatmobile\", \"Spongbob\", \"Krabby patty\", \"Palace of Pranks\", \"Jellyfishing(Hobby)\", \"S\\u00fcngerBob KarePantolon\", \"Jellyfishing (hobby)\", \"Frycook of The Chum Bucket\", \"King Amoeba\", \"List of places in Bikini Bottom\", \"Monster Krabby Patty\", \"List of SpongeBob SquarePants crew\", \"SpongeBob SquarePants controversy\", \"Evil Spongebob\", \"Bikini Bottomshire\", \"Spongebobsquarepants\", \"Spongebob SquarePants\", \"Mr. Seaweed\", \"SpongeBob.com\", \"What Zit Tooya\", \"Who lives in a pineapple under the sea%3F\", \"Spongebob\", \"Doodle Bob\", \"Spongebob Squarepants\", \"SpongePedia\", \"The KK\", \"SquarePants\", \"International Following of SpongeBob SquarePants\", \"Spongebob squarepants series\", \"First Nautical Bank\", \"SpongeBob Squarepants Controversy\", \"Sponge Bob\", \"Queen Mildew\", \"SpongeBob\", \"Crabby Patty\", \"Mr. Sea Chicken\", \"Spongebob squarepants\", \"The SpongeBob SquarePants Movie (film series)\", \"What zit tooya\", \"Every Villian is Lemons\", \"Jellyfish (SpongeBob SquarePants)\", \"History of SpongeBob SquarePants\", \"Oops ouchskies\", \"SPONGEBOB SQUAREPANTS\", \"Bob l'\\u00e9ponge\", \"Shady Shoals\", \"Who lives in a pineapple under the sea\", \"SpongeBob SquarePants cast\", \"SpongeBoy Ahoy!\", \"Spongebob's Jobs\", \"Sponge Bob Square Pants\", \"SpongeBob Square Pants\", \"Spongebob theme song\", \"Mindy the Mermaid\", \"Sponge-bob square-pants\", \"King Jellyfish\", \"Krusty Krab Inc.\", \"SpongeBob (video game)\", \"International following of SpongeBob SquarePants\", \"SpongeBob Squarepants\", \"Bulac\", \"Spongebob's Pineapple House\", \"SpongeBob Bio\", \"Spongebob and the Mystery with a Twistery\", \"Duhfish\", \"S. S. Cheapskate\", \"Sponge bob square pants\", \"SpongeBob SquarePants (series)\", \"SpongeBob & The Hi-Seas\"]", "[\"Navy Lark\", \"HMS Troutbridge\", \"HMS TROUTBRIDGE\", \"H.m.s. troutbridge\", \"The Navy Lark\", \"Able Seaman Johnson\"]", "[\"Maeve Binchy\"]", "[\"Minimum information requested in the annotation of biochemical models\", \"Minimum information required in the annotation of biochemical models\", \"Minimal Information Requested In the Annotation of biochemical Models\", \"MIRIAM\", \"Minimum Information Requested in the Annotation of biochemical Models\", \"Minimum Information Required in the Annotation of Models\", \"Minimum information required in the annotation of models\"]", "[\"Polyvinyl chloride workers\", \"3 (plastic)\", \"PolyVinyl Chloride\", \"Polyvinyl resin\", \"UPVC\", \"Poly-vinyl chloride\", \"Vinylite\", \"Polyvinyl Chloride\", \"PVC\", \"Upvc\", \"Vinyl lettering\", \"3 (resin identification code)\", \"P.V.C.\", \"Poly (vinyl chloride)\", \"Polyvinylchloride\", \"Polyvinyl chloride\", \"PVC piping\", \"Vinyl plastic\", \"Vinyl floor\", \"Poly(vinyl chloride)\", \"Vinyl flooring\", \"Poly(chloroethanediyl)\", \"Pvc\", \"Unplasticized polyvinyl chloride\", \"Polychloroethene\"]", "[\"'PANDORA'\", \"Pandora Archive\", \"Australia's Web Archive\", \"Pandora Web Archive\", \"PANDORA\", \"Preserving and Accessing Networked Documentary Resources of Australia\"]", "[\"Pomum aurantium\", \"Golden apples\", \"Golden apple\", \"Golden Apples of the Hesperides\", \"Golden Apples\"]", "[\"IJsland\", \"Icedland\", \"The land of ice and snow\", \"Icelandic isles\", \"L\\u00fd\\u00f0veldi\\u00f0 \\u00edsland\", \"Iceland\", \"ISO 3166-1:IS\", \"The Republic of Iceland\", \"Ice-land\", \"Hyui\", \"Republic of Iceland\", \"\\u00cdsland\", \"ICELAND\", \"Lydveldid island\", \"Icealnd\", \"Ice land\", \"Mainland Iceland\", \"Island of Iceland\"]", "[\"What Is This Thing Called Love\", \"What is This Thing Called Love%3F\", \"What Is This Thing Called Love%3F\"]", "[\"Flying squad\", \"Flying Squad\"]", "[\"Idaho potato\", \"Potato farmer\", \"Potatos\", \"Cooking potatoes\", \"Boiled Potatoes\", \"Potato, Irish\", \"Pottato\", \"Tattie\", \"New potatoes\", \"Pomme Terre\", \"Pratie\", \"Patatoes\", \"Potato farm\", \"German Butterball\", \"Poetato\", \"Spud\", \"History of Potatoes\", \"Solanum tuberosum\", \"Roast potato\", \"Potato (northern)\", \"Red potato\", \"White potatoes\", \"Potato\", \"White potato\", \"Potatoes\", \"Super tuber\", \"Boiled potatos\", \"New potato\", \"Potato industry\", \"Kerris Pink\", \"Irish potato\", \"Boiled potato\", \"Potater\", \"Purple potato\", \"Tatey\", \"Alu (tuber)\", \"History of potatoes\", \"Red Potato\", \"Maris Peer\", \"Potatoe\", \"Potato farmers\", \"Idaho Potato\", \"Solanum tuberosum tuberosum\", \"Culture of potato\", \"Pateeto\", \"Red potatoes\", \"Poetatoe\", \"Boiled potatoes\", \"Tatties\", \"Blue potato\", \"Potato skin\", \"Spuds\", \"POTATO\"]", "[\"'Microsoft Corp\", \"Microsoft Canada\", \"Mircosoft\", \"Microsoft Inc\", \"Micro soft\", \"Microsoat\", \"Microsoft corporation\", \"MSoft\", \"Office Corporation\", \"Microsoft Connect\", \"Microosft\", \"Mickeysoft\", \"Microsft\", \"Microsoft connect\", \"Windows Corporation\", \"Microsoft, Inc.\", \"Microsoft's\", \"Microsoft\", \"MS Corp\", \"AS8075\", \"Micrasoft\", \"Microsoft Inc.\", \"MSN Corporation\", \"Microcomputer software\", \"Microsoft, Incorporated\", \"Micro-soft\", \"Microsfot\", \"Microscam\", \"MicroSoft Corporation\", \"Microsoft Way\", \"Microsoft arc Mouse\", \"Microsoft.com\", \"Blibbet\", \"MICROSOFT\", \"Microsoft logos\", \".azure\", \"Microsoft Corp\", \"NASDAQ:MSFT\", \"Microsoft Corp.\", \"Aorato\", \"Micro-Soft\", \"Microsoft Incorporated\", \"Mikrosoft\", \"Micro Soft\", \"Microsoft Corporation\", \"Microsoft Ltd\", \"Microsoft Visitor Center\", \"Microsoft Corpration\", \"WebsiteSpark\", \".bing\", \"Www.microsoft.com\", \"MSLI\", \"MicroSoft\"]", "[\"five\", \"5\", \"Five\"]", "[\"God particle\", \"The Higgs particle\", \"Boson scalaire\", \"Hugs bison\", \"Higgs field\", \"God particle (physics)\", \"BEH boson\", \"Higgs boson particle\", \"Higgs bosun\", \"Higgs-Boson Particle\", \"God Particle\", \"The Higgs Boson\", \"Higgs Field\", \"H\\u2070\", \"Higgs excitation\", \"Brout-Englert-Higgs boson\", \"Higgs particle\", \"Higgs Non-Zero Value Field\", \"Higgs-boson\", \"Higgs boson\", \"Higgs Bozon\", \"Higgs Excitation\", \"Higgson\", \"Higgs-boson particle\", \"Higgs Particle\", \"Higg's boson\", \"Sms boson\", \"Introduction to the Higgs field\", \"Higgs Boson\", \"Godparticle\", \"Higgs' boson\", \"Higgs event\", \"God's particle\", \"Higgs bosons\"]", "[\"Pelecanidae\", \"Pelican\", \"Pelecanus\", \"Pelican in her piety\", \"Pelicans\", \"Pellican\"]" ]
[ "Which cartoon character, who cooks at the Krusty Krab, lives in a pineapple under the sea?", "What was the name of the Royal Navy Frigate featured in the Radio Comedy Series The Navy Lark?", "Who wrote the novel Evening Class?", "Who in the Old Testament is the sister of Moses?", "How is the chemical compound Polyvinyl Chloride better known?", "In the Sue Townsend novels, what is the first name of the love of 'Adrian Mole's' life?", "In Greek mythology, one of the labours of Hercules was to procure the ‘what’ belonging to Zeus, which were guarded by the Hesperides?", "On which island could you find an active volcano called 'Hekla'?", "\"These are the first lines from what song: \"\"I was a humdrum person, leading a life apart, when love flew in through my window wide, and quickened my humdrum heart\"\"?\"", "What two word phrase is Sweeney Todd Cockney rhyming slang for?", "In the USA, the Colorado Beetle is a major pest that attacks which crop?", "Which company's original brief to Brian Eno was to compose a piece of inspirational music to last 3.25 seconds?", "How many fluid ounces are in one quarter of an imperial pint?", "The effective discovery of what particle was announced by CERN at the Large Hadron Collider in 2012?", "American poet Dixon Lanier Merritt's well-known limerick is about what bird?" ]
15
[ 26325, 26326, 26327, 26328, 26329, 26330, 26331, 26332, 26333, 26334, 26335, 26336, 26337, 26338, 26339 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: According to Virgil, who was the reputed founder of the city of Carthage?\nQuestion 2: Which Shakespearean play features a merchant named 'Balthazar' and a Goldsmith named 'Angelo'?\nQuestion 3: What is the name of the substance obtained from the dried swim bladders of fish, used in brewing and winemaking?\nQuestion 4: What was the middle name of the architect Edwin L. Lutyens?\nQuestion 5: In a Beatles’ track, who is mean Mr. Mustard’s sister?\nQuestion 6: 'Dr. Robotnik' and 'Knuckles the Echidna' are characters in which video game series?\nQuestion 7: Who was the female lead in the various 'Road to ' films?\nQuestion 8: Which instrument features a whammy bar?\nQuestion 9: Which artist is famous for painting at the Moulin Rouge?\nQuestion 10: Approximately what percentage of Valentine's cards are bought by women? 50%, 70% or 85%?\nQuestion 11: Who was the first English Christian martyr - his feast day is June 22nd.?\nQuestion 12: \"What fictional character sings \"\"It's not easy being green\"\"?\"\nQuestion 13: Gee Jon. a member of the Hip Sing Tong criminal society from San Francisco, California, sentenced to death for the murder of an elderly member from another gang in Nevada, was the first person in the US to do what?\nQuestion 14: What type of animal is a skink?\nQuestion 15: Daniel Arap Moi was President of which country?", "role": "user" } ]
["[\"Elissar\", \"Dido\", \"Dido of Carthage\", \"Queen of Carthage\", \"Dido (Queen)\", \"Dido (Queen of Carthage)\", \"DIDO\"]", "[\"The Comedie of Errors\", \"The Comedy of Errors\", \"The Comedy Of Errors\", \"Angelo (The Comedy of Errors)\", \"Aegeon\", \"A Comedy of Errors\", \"Comedy of Errors\", \"Comedy Of Errors\", \"Dromio\", \"'THE COMEDY OF ERRORS'\", \"Comedy of Errors (play)\", \"The Comedie of Errors.\"]", "[\"Eisenglas\", \"Fish gelatin\", \"Fish Gelatin\", \"Fish finings\", \"Japanese gelatine\", \"Isinglass\"]", "[\"Landseer\", \"LANDSEER\", \"Landseer (disambiguation)\"]", "[\"Polythene Pam\", \"POLYTHENE PAM\", \"Polyethene Pam\"]", "[\"Sonic the Hedgehog 2 (disambiguation)\", \"Sonic the Hedgehog (disambiguation)\", \"Sonic the Hedgehog\", \"Sonic the hedgehog\", \"Sonic the hedg hog\", \"SONIC THE HEDGEHOG\", \"Sonic the hedghog\", \"'SONIC THE HEDGEHOG'\", \"Somic the Hedgehog\", \"Sonic The Hedgehog\", \"Sonic the hedgehog (brawl)\", \"Sonic the Hedgehog (video game)\", \"Sonic the hedge hog\", \"Soinc The Hedgehog\", \"Sonic the hedgehogs story\"]", "[\"The Sarong Girl\", \"Dorthy Lamour\", \"Dorothy Lamour\", \"DOROTHY LAMOUR\", \"Mary Leta Dorothy Kaumeyer\"]", "[\"E-guitar\", \"Electrical guitar\", \"Eguitar\", \"Solid body electric guitars\", \"Electric Guitar\", \"Electric guitars\", \"Chambered body\", \"Electromagnetic guitar\", \"Swedish guitar\", \"Solid body guitar\", \"The electric guitar\", \"Treble guitar\", \"String-through body\", \"Guitar killswitch\", \"(Electric) Guitar\", \"Chambered body guitar\", \"Electric guitar\"]", "[\"Latrec\", \"Henri Toulouse-Lautrec\", \"Henri de Toulouse Lautrec\", \"Tolose Latrek\", \"Tolouse Lautrec\", \"Henri de Toulouse- Lautrec\", \"Latrek\", \"Toulouse-Lautrec\", \"Toulouse Lautrec\", \"Toloose Latrek\", \"Henri Marie Raymonde Toulouse-Lautrec\", \"Henri Marie Raymond de Toulouse-Lautrec-Monfa\", \"Tolouse-Lautrec\", \"Lautrek\", \"Tooloose Latrek\", \"Henri de Toulouse-Lautrec\", \"Henri De toulouse-Lautrec\"]", "[\"85%\", \"eighty-five %\", \"85 %\"]", "[\"Alban, Saint\", \"St Alban\", \"St Alban's Day\", \"St Alban's church\", \"St. Alban\", \"Saint Alban\", \"ST. ALBAN\", \"Saint Alban of Britain\", \"Alban Protomartyr\", \"St Alban (Church)\"]", "[\"Kermit The Frog\", \"Kermie\", \"But that's none of my business\", \"Doctor of Amphibious Letters\", \"Kermit the frog\", \"Kermit the Frog\"]", "[\"Be executed by lethal gas\"]", "[\"Lacertilian\", \"Lizards in captivity\", \"Lizards\", \"Lacertians\", \"Spotted lizard\", \"Lacertia\", \"Lacertilia\", \"Lizard\", \"Lacertian\", \"List of Lizards\", \"Lacertids\", \"Chipkali\"]", "[\"Kenyan\", \"Prehistory of Kenya\", \"Kenya-Africa\", \"ISO 3166-1:KE\", \"Jamhuri ya Kenya\", \"Kenya\", \"Republic of Kenya\", \"Kenya (disambiguation)\", \"Etymology of Kenya\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Elissar\", \"Dido\", \"Dido of Carthage\", \"Queen of Carthage\", \"Dido (Queen)\", \"Dido (Queen of Carthage)\", \"DIDO\"]", "[\"The Comedie of Errors\", \"The Comedy of Errors\", \"The Comedy Of Errors\", \"Angelo (The Comedy of Errors)\", \"Aegeon\", \"A Comedy of Errors\", \"Comedy of Errors\", \"Comedy Of Errors\", \"Dromio\", \"'THE COMEDY OF ERRORS'\", \"Comedy of Errors (play)\", \"The Comedie of Errors.\"]", "[\"Eisenglas\", \"Fish gelatin\", \"Fish Gelatin\", \"Fish finings\", \"Japanese gelatine\", \"Isinglass\"]", "[\"Landseer\", \"LANDSEER\", \"Landseer (disambiguation)\"]", "[\"Polythene Pam\", \"POLYTHENE PAM\", \"Polyethene Pam\"]", "[\"Sonic the Hedgehog 2 (disambiguation)\", \"Sonic the Hedgehog (disambiguation)\", \"Sonic the Hedgehog\", \"Sonic the hedgehog\", \"Sonic the hedg hog\", \"SONIC THE HEDGEHOG\", \"Sonic the hedghog\", \"'SONIC THE HEDGEHOG'\", \"Somic the Hedgehog\", \"Sonic The Hedgehog\", \"Sonic the hedgehog (brawl)\", \"Sonic the Hedgehog (video game)\", \"Sonic the hedge hog\", \"Soinc The Hedgehog\", \"Sonic the hedgehogs story\"]", "[\"The Sarong Girl\", \"Dorthy Lamour\", \"Dorothy Lamour\", \"DOROTHY LAMOUR\", \"Mary Leta Dorothy Kaumeyer\"]", "[\"E-guitar\", \"Electrical guitar\", \"Eguitar\", \"Solid body electric guitars\", \"Electric Guitar\", \"Electric guitars\", \"Chambered body\", \"Electromagnetic guitar\", \"Swedish guitar\", \"Solid body guitar\", \"The electric guitar\", \"Treble guitar\", \"String-through body\", \"Guitar killswitch\", \"(Electric) Guitar\", \"Chambered body guitar\", \"Electric guitar\"]", "[\"Latrec\", \"Henri Toulouse-Lautrec\", \"Henri de Toulouse Lautrec\", \"Tolose Latrek\", \"Tolouse Lautrec\", \"Henri de Toulouse- Lautrec\", \"Latrek\", \"Toulouse-Lautrec\", \"Toulouse Lautrec\", \"Toloose Latrek\", \"Henri Marie Raymonde Toulouse-Lautrec\", \"Henri Marie Raymond de Toulouse-Lautrec-Monfa\", \"Tolouse-Lautrec\", \"Lautrek\", \"Tooloose Latrek\", \"Henri de Toulouse-Lautrec\", \"Henri De toulouse-Lautrec\"]", "[\"85%\", \"eighty-five %\", \"85 %\"]", "[\"Alban, Saint\", \"St Alban\", \"St Alban's Day\", \"St Alban's church\", \"St. Alban\", \"Saint Alban\", \"ST. ALBAN\", \"Saint Alban of Britain\", \"Alban Protomartyr\", \"St Alban (Church)\"]", "[\"Kermit The Frog\", \"Kermie\", \"But that's none of my business\", \"Doctor of Amphibious Letters\", \"Kermit the frog\", \"Kermit the Frog\"]", "[\"Be executed by lethal gas\"]", "[\"Lacertilian\", \"Lizards in captivity\", \"Lizards\", \"Lacertians\", \"Spotted lizard\", \"Lacertia\", \"Lacertilia\", \"Lizard\", \"Lacertian\", \"List of Lizards\", \"Lacertids\", \"Chipkali\"]", "[\"Kenyan\", \"Prehistory of Kenya\", \"Kenya-Africa\", \"ISO 3166-1:KE\", \"Jamhuri ya Kenya\", \"Kenya\", \"Republic of Kenya\", \"Kenya (disambiguation)\", \"Etymology of Kenya\"]" ]
[ "According to Virgil, who was the reputed founder of the city of Carthage?", "Which Shakespearean play features a merchant named 'Balthazar' and a Goldsmith named 'Angelo'?", "What is the name of the substance obtained from the dried swim bladders of fish, used in brewing and winemaking?", "What was the middle name of the architect Edwin L. Lutyens?", "In a Beatles’ track, who is mean Mr. Mustard’s sister?", "'Dr. Robotnik' and 'Knuckles the Echidna' are characters in which video game series?", "Who was the female lead in the various 'Road to ' films?", "Which instrument features a whammy bar?", "Which artist is famous for painting at the Moulin Rouge?", "Approximately what percentage of Valentine's cards are bought by women? 50%, 70% or 85%?", "Who was the first English Christian martyr - his feast day is June 22nd.?", "\"What fictional character sings \"\"It's not easy being green\"\"?\"", "Gee Jon. a member of the Hip Sing Tong criminal society from San Francisco, California, sentenced to death for the murder of an elderly member from another gang in Nevada, was the first person in the US to do what?", "What type of animal is a skink?", "Daniel Arap Moi was President of which country?" ]
15
[ 10080, 10081, 10082, 10083, 10084, 10085, 10086, 10087, 10088, 10089, 10090, 10091, 10092, 10093, 10094 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which failed venture was led by the Duke of Medina Sidonia?\nQuestion 2: Who is the player who has come closest to meeting the modern definition of golf's Grand Slam by holding all four modern major championships simultaneously?\nQuestion 3: Who did Roosevelt defeat when he won the 1932 election?\nQuestion 4: Who directed the 1973 film American Graffiti?\nQuestion 5: What is the capital of Cambodia?\nQuestion 6: \"Which author created the fictional character \"\"Horrid Henry\"\"?\"\nQuestion 7: How many spikes are on the crown of The Statue of Liberty in New York USA?\nQuestion 8: In the Japanese fun-game of suikawari, which is similar to a piñata, what objects are typically smashed? (hint: fans of comedian Gallagher should know)\nQuestion 9: 'Red Lion' was for may years accepted as the most popular pubname in Great Britain. What pub name has now succeeded this?\nQuestion 10: Who is the regular presenter of 'The Official Chart' on Radio One?\nQuestion 11: What was the official residence of the monarch between 1698 and 1837?\nQuestion 12: Who was the first music hall star to be knighted?\nQuestion 13: Quasimodo is what book character?\nQuestion 14: The Mosul Dam is in which country?\nQuestion 15: With examples such as tulip, South Sea company, and .com, what is the name for the economic condition characterized by \"trade in high volumes at prices that are considerably at variance with intrinsic values\"?", "role": "user" } ]
["[\"Spanish armada\", \"Naval battle of Gravelines\", \"Catholic Armada\", \"Armada of 1588\", \"Spanish Armada, The\", \"Spanish Armada\", \"Invincible Armada, The\", \"English defeat of Spanish Armada\", \"Armada Invencible\", \"Battle of Gravelines (1588)\", \"Great Armada\", \"The Spanish Armada\", \"Grand armada\", \"Invincible Armada\"]", "[\"Eldrick Tont Woods\", \"TigerWoods.com\", \"Tiger woods\", \"Al Ruwaya\", \"Cablinasian\", \"Tiger Woods Mistress\", \"Cheetah Woods\", \"Eldrick T. %22Tiger%22 Woods\", \"Jamie Jungers\", \"Tigerwoods.com\", \"Tiger Woods\", \"Mindy Lawton\", \"Eldrick Woods\", \"How I Play Golf\", \"Tigre Woods\", \"T woods\", \"Eldrick\", \"Woods, Tiger\", \"Eldrick Tont %22Tiger%22 Woods\", \"Jaimee Grubbs\", \"Eldrick %22Tiger%22 Woods\", \"Cablin Asian\", \"Tont\", \"Tiger Wood\"]", "[\"Presidency of Herbert Hoover\", \"Jessie Hoover\", \"Herbert Hoover\", \"Herbert C. Hoover\", \"31st President of the United States\", \"Herbert Clark Hoover\", \"Hoover, Herbert Clark\", \"President Hoover\", \"Hoover Administration\", \"President Herbert Hoover\"]", "[\"Tyger (actress)\", \"George Walton Lucas Jr.\", \"Indiana (dog)\", \"George Jr. Lucas\", \"G lucas\", \"Jett Lucas\", \"Lucas, George\", \"George Lucas's\", \"George Walton Lucas\", \"George lucas\", \"Katie lucas\", \"George Lucus\", \"George Walton Lucas, Jr.\", \"George Lucas Jnr\", \"Gorge Lucas\", \"George W Lucas Jr\", \"The Flanneled One\", \"George Lucas\", \"George Lucas Jr.\"]", "[\"Pnumh Pen\", \"Phnom Phen\", \"Pnom Penn\", \"Pnom Penh\", \"Chatumuk\", \"Phnum Penh Autonomous Municipality, Cambodia\", \"Phnomh Penh\", \"Phnum Pen\", \"Panomping\", \"Phnum P\\u00e9nh\", \"Phnompenh\", \"PHNOM PENH\", \"Pnom pen\", \"Pnompenh\", \"Phnom Penh, Cambodia\", \"Chaktomuk\", \"Capital city of cambodia\", \"Phnom penh\", \"Pnumh Penh\", \"\\u91d1\\u908a\", \"Capital of Cambodia\", \"Pnom Pen\", \"Phnom Pen\", \"Phnom Penn\", \"Phom Penh\", \"Phnom-Penh\", \"Phnom Penh\", \"Phnom Penh Municipality\", \"Pnum Penh\", \"Pnum Penn\", \"Pnom-Penh\", \"Pnum Pen\", \"Pnomh Pen\", \"Pnomh Penh\", \"Pnomh Penn\", \"Chaktomok\", \"Phnum Penh\", \"Pearl of Asia\", \"Asia/Phnom Penh\", \"Phnum Penn\", \"Provinces of Phnom Penh\", \"Provinces of phnom penh\", \"Pnumh Penn\", \"Phnom Pehn\"]", "[\"Francesca Simon\", \"FRANCESCA SIMON\"]", "[\"Seven\", \"seven\", \"7\"]", "[\"Watermelons\", \"Red watermelon\", \"Watermellon\", \"\\ud83c\\udf49\", \"Water Melon\", \"Citrullus vulgaris\", \"Xigua\", \"Water-melon\", \"Kalingad\", \"Watermelon\", \"Water melon\", \"Densuke watermelons\", \"Melonwater\", \"Moon and Stars\", \"Waterelon\", \"Wotamelons\"]", "[\"Crown forces\", \"Crown body\", \"'THE CROWN'\", \"The Crown\", \"The Crown (Rex)\", \"Crown in right of the United Kingdom\", \"The Crown (British Commonwealth)\", \"The crown\", \"Crown Forces\", \"The Crown (Regina)\", \"The British Crown\", \"The Crown (Commonwealth realms)\", \"British crown\", \"British Crown\", \"Crown property\", \"Crown in right of Canada\"]", "[\"Reggie Yates\", \"Fearne and Reggie\", \"Regginald Macay Decorsie Yates\", \"No Bizzi\"]", "[\"St James palace\", \"St James Palace\", \"Verge of the Palace of St James\", \"St. James's Palace\", \"St. James palace\", \"St James's Palace, London\", \"Chapel Royal (St. James's Palace)\", \"St James's Palace\", \"St. James' Palace\", \"Saint James's Palace\", \"St James' palace\", \"St James\\u2019s Palace\", \"St. James Palace\", \"St James' Palace\", \"Saint James' Palace\", \"St. James' palace\", \"St. James's palace\", \"St James's palace\"]", "[\"HARRY LAUDER\", \"Henry Lauder\", \"Harry Lauder\", \"Harry Maclennan Lauder\", \"Sir Harry Lauder\"]", "[\"Notre-Dame of Paris (novel)\", \"Grangoire\", \"THOND\", \"Hunchback of Notre-Dame\", \"Hunchback of Notre-Dame (ballet)\", \"The Hunchback of Notre Dame (ballet)\", \"The Hunchback of Notre-Dame (ballet)\", \"The Hunchback of Notre Dame (novel)\", \"Notre-Dame de Paris (novel)\", \"The Hunchback of Notre Dame\", \"The Hunchback of Notre-Dame\", \"Notre Dame de Paris (novel)\", \"The Hunchback Of Notre Dame\", \"Hunchback of Notre Dame\", \"The Hunchback of Notra Dam\", \"Hunchback of notre dame\", \"Le bossu de notre dame\", \"The hunchback of Notre Dame\", \"The Hunchback of Notre Dam\"]", "[\"Eragh\", \"South Iraq\", \"A'raq\", \"ISO 3166-1:IQ\", \"\\u0639\\u064a\\u064e\\u0631\\u0627\\u0642\", \"Iraqi Republic\", \"\\u0643\\u06c6\\u0645\\u0627\\u0631\\u06cc \\u0639\\u06ce\\u0631\\u0627\\u0642\", \"Iraq\\u00ea\", \"Komara Iraqe\", \"Central Iraq\", \"Ir\\u0101q\", \"Komara Iraq\\u00ea\", \"Iraqe\", \"Irak\", \"Itaq\", \"\\u0627\\u0644\\u062c\\u0645\\u0647\\u0648\\u0631\\u064a\\u0629 \\u0627\\u0644\\u0639\\u0631\\u0627\\u0642\\u064a\\u0629\", \"Name of Iraq\", \"Iraq\", \"Iraq (name)\", \"Iraw\", \"Al-'Iraq\", \"Iraqui\", \"Jumh\\u016briyyat ul-\\u02bfIr\\u0101q\", \"State of Iraq\", \"Jumh\\u016briyyat al-\\u2018Ir\\u0101q\", \"\\u0627\\u0644\\u0639\\u0631\\u0627\\u0642\", \"IRAQ\", \"The Iraq\", \"Etymology of Iraq\", \"Aj-Jumhuriyah Al-'Iraqiyah\", \"Republic of Iraq\", \"Islamic Republic of Iraq\", \"Al-\\u2018Ir\\u0101q\", \"Irak-Arabi\", \"Eraq\", \"Jumhuriyyat ul-\\u02bfIraq\"]", "[\"Bubbling\", \"Bubble (disambiguation)\", \"Bubble (song)\", \"Bubbling (disambiguation)\", \"Bubbles (disambiguation)\", \"Bubbles\", \"Bubble\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Spanish armada\", \"Naval battle of Gravelines\", \"Catholic Armada\", \"Armada of 1588\", \"Spanish Armada, The\", \"Spanish Armada\", \"Invincible Armada, The\", \"English defeat of Spanish Armada\", \"Armada Invencible\", \"Battle of Gravelines (1588)\", \"Great Armada\", \"The Spanish Armada\", \"Grand armada\", \"Invincible Armada\"]", "[\"Eldrick Tont Woods\", \"TigerWoods.com\", \"Tiger woods\", \"Al Ruwaya\", \"Cablinasian\", \"Tiger Woods Mistress\", \"Cheetah Woods\", \"Eldrick T. %22Tiger%22 Woods\", \"Jamie Jungers\", \"Tigerwoods.com\", \"Tiger Woods\", \"Mindy Lawton\", \"Eldrick Woods\", \"How I Play Golf\", \"Tigre Woods\", \"T woods\", \"Eldrick\", \"Woods, Tiger\", \"Eldrick Tont %22Tiger%22 Woods\", \"Jaimee Grubbs\", \"Eldrick %22Tiger%22 Woods\", \"Cablin Asian\", \"Tont\", \"Tiger Wood\"]", "[\"Presidency of Herbert Hoover\", \"Jessie Hoover\", \"Herbert Hoover\", \"Herbert C. Hoover\", \"31st President of the United States\", \"Herbert Clark Hoover\", \"Hoover, Herbert Clark\", \"President Hoover\", \"Hoover Administration\", \"President Herbert Hoover\"]", "[\"Tyger (actress)\", \"George Walton Lucas Jr.\", \"Indiana (dog)\", \"George Jr. Lucas\", \"G lucas\", \"Jett Lucas\", \"Lucas, George\", \"George Lucas's\", \"George Walton Lucas\", \"George lucas\", \"Katie lucas\", \"George Lucus\", \"George Walton Lucas, Jr.\", \"George Lucas Jnr\", \"Gorge Lucas\", \"George W Lucas Jr\", \"The Flanneled One\", \"George Lucas\", \"George Lucas Jr.\"]", "[\"Pnumh Pen\", \"Phnom Phen\", \"Pnom Penn\", \"Pnom Penh\", \"Chatumuk\", \"Phnum Penh Autonomous Municipality, Cambodia\", \"Phnomh Penh\", \"Phnum Pen\", \"Panomping\", \"Phnum P\\u00e9nh\", \"Phnompenh\", \"PHNOM PENH\", \"Pnom pen\", \"Pnompenh\", \"Phnom Penh, Cambodia\", \"Chaktomuk\", \"Capital city of cambodia\", \"Phnom penh\", \"Pnumh Penh\", \"\\u91d1\\u908a\", \"Capital of Cambodia\", \"Pnom Pen\", \"Phnom Pen\", \"Phnom Penn\", \"Phom Penh\", \"Phnom-Penh\", \"Phnom Penh\", \"Phnom Penh Municipality\", \"Pnum Penh\", \"Pnum Penn\", \"Pnom-Penh\", \"Pnum Pen\", \"Pnomh Pen\", \"Pnomh Penh\", \"Pnomh Penn\", \"Chaktomok\", \"Phnum Penh\", \"Pearl of Asia\", \"Asia/Phnom Penh\", \"Phnum Penn\", \"Provinces of Phnom Penh\", \"Provinces of phnom penh\", \"Pnumh Penn\", \"Phnom Pehn\"]", "[\"Francesca Simon\", \"FRANCESCA SIMON\"]", "[\"Seven\", \"seven\", \"7\"]", "[\"Watermelons\", \"Red watermelon\", \"Watermellon\", \"\\ud83c\\udf49\", \"Water Melon\", \"Citrullus vulgaris\", \"Xigua\", \"Water-melon\", \"Kalingad\", \"Watermelon\", \"Water melon\", \"Densuke watermelons\", \"Melonwater\", \"Moon and Stars\", \"Waterelon\", \"Wotamelons\"]", "[\"Crown forces\", \"Crown body\", \"'THE CROWN'\", \"The Crown\", \"The Crown (Rex)\", \"Crown in right of the United Kingdom\", \"The Crown (British Commonwealth)\", \"The crown\", \"Crown Forces\", \"The Crown (Regina)\", \"The British Crown\", \"The Crown (Commonwealth realms)\", \"British crown\", \"British Crown\", \"Crown property\", \"Crown in right of Canada\"]", "[\"Reggie Yates\", \"Fearne and Reggie\", \"Regginald Macay Decorsie Yates\", \"No Bizzi\"]", "[\"St James palace\", \"St James Palace\", \"Verge of the Palace of St James\", \"St. James's Palace\", \"St. James palace\", \"St James's Palace, London\", \"Chapel Royal (St. James's Palace)\", \"St James's Palace\", \"St. James' Palace\", \"Saint James's Palace\", \"St James' palace\", \"St James\\u2019s Palace\", \"St. James Palace\", \"St James' Palace\", \"Saint James' Palace\", \"St. James' palace\", \"St. James's palace\", \"St James's palace\"]", "[\"HARRY LAUDER\", \"Henry Lauder\", \"Harry Lauder\", \"Harry Maclennan Lauder\", \"Sir Harry Lauder\"]", "[\"Notre-Dame of Paris (novel)\", \"Grangoire\", \"THOND\", \"Hunchback of Notre-Dame\", \"Hunchback of Notre-Dame (ballet)\", \"The Hunchback of Notre Dame (ballet)\", \"The Hunchback of Notre-Dame (ballet)\", \"The Hunchback of Notre Dame (novel)\", \"Notre-Dame de Paris (novel)\", \"The Hunchback of Notre Dame\", \"The Hunchback of Notre-Dame\", \"Notre Dame de Paris (novel)\", \"The Hunchback Of Notre Dame\", \"Hunchback of Notre Dame\", \"The Hunchback of Notra Dam\", \"Hunchback of notre dame\", \"Le bossu de notre dame\", \"The hunchback of Notre Dame\", \"The Hunchback of Notre Dam\"]", "[\"Eragh\", \"South Iraq\", \"A'raq\", \"ISO 3166-1:IQ\", \"\\u0639\\u064a\\u064e\\u0631\\u0627\\u0642\", \"Iraqi Republic\", \"\\u0643\\u06c6\\u0645\\u0627\\u0631\\u06cc \\u0639\\u06ce\\u0631\\u0627\\u0642\", \"Iraq\\u00ea\", \"Komara Iraqe\", \"Central Iraq\", \"Ir\\u0101q\", \"Komara Iraq\\u00ea\", \"Iraqe\", \"Irak\", \"Itaq\", \"\\u0627\\u0644\\u062c\\u0645\\u0647\\u0648\\u0631\\u064a\\u0629 \\u0627\\u0644\\u0639\\u0631\\u0627\\u0642\\u064a\\u0629\", \"Name of Iraq\", \"Iraq\", \"Iraq (name)\", \"Iraw\", \"Al-'Iraq\", \"Iraqui\", \"Jumh\\u016briyyat ul-\\u02bfIr\\u0101q\", \"State of Iraq\", \"Jumh\\u016briyyat al-\\u2018Ir\\u0101q\", \"\\u0627\\u0644\\u0639\\u0631\\u0627\\u0642\", \"IRAQ\", \"The Iraq\", \"Etymology of Iraq\", \"Aj-Jumhuriyah Al-'Iraqiyah\", \"Republic of Iraq\", \"Islamic Republic of Iraq\", \"Al-\\u2018Ir\\u0101q\", \"Irak-Arabi\", \"Eraq\", \"Jumhuriyyat ul-\\u02bfIraq\"]", "[\"Bubbling\", \"Bubble (disambiguation)\", \"Bubble (song)\", \"Bubbling (disambiguation)\", \"Bubbles (disambiguation)\", \"Bubbles\", \"Bubble\"]" ]
[ "Which failed venture was led by the Duke of Medina Sidonia?", "Who is the player who has come closest to meeting the modern definition of golf's Grand Slam by holding all four modern major championships simultaneously?", "Who did Roosevelt defeat when he won the 1932 election?", "Who directed the 1973 film American Graffiti?", "What is the capital of Cambodia?", "\"Which author created the fictional character \"\"Horrid Henry\"\"?\"", "How many spikes are on the crown of The Statue of Liberty in New York USA?", "In the Japanese fun-game of suikawari, which is similar to a piñata, what objects are typically smashed? (hint: fans of comedian Gallagher should know)", "'Red Lion' was for may years accepted as the most popular pubname in Great Britain. What pub name has now succeeded this?", "Who is the regular presenter of 'The Official Chart' on Radio One?", "What was the official residence of the monarch between 1698 and 1837?", "Who was the first music hall star to be knighted?", "Quasimodo is what book character?", "The Mosul Dam is in which country?", "With examples such as tulip, South Sea company, and .com, what is the name for the economic condition characterized by \"trade in high volumes at prices that are considerably at variance with intrinsic values\"?" ]
15
[ 131460, 131461, 131462, 131463, 131464, 131465, 131466, 131467, 131468, 131469, 131470, 131471, 131472, 131473, 131474 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What is the largest number on a standard backgammon doubling dice?\nQuestion 2: Who plays Brutus, a bar owner, in the recent BBC comedy Sun Trap?\nQuestion 3: \"In \"\"The Lord Of The Rings\"\", what was the name of Gandalf's horse?\"\nQuestion 4: Sage Moonblood is the child of which action film actor and director?\nQuestion 5: What type of animal is a Lhasa Apso?\nQuestion 6: Which famous statue by Michelangelo is held in the Galleria dell' Academia in Florence?\nQuestion 7: In World War I, the British soldiers were nicknamed 'Tommies', what name was given to Frenchsoldiers?\nQuestion 8: \"Which, chronologically, is the first of the \"\"Chronicles of Narnia\"\", although it was the sixth of the series of books written by author C. S. Lewis?\"\nQuestion 9: What is the biggest city in Ohio that doesn't start with the letter C?\nQuestion 10: How many strings does a ukelele have?\nQuestion 11: 'Zorro' is the Spanish word for which animal?\nQuestion 12: Whose resignation prompted the Eastleigh by-election in February 2013?\nQuestion 13: \"What is the name of the \"\"Plum Pudding\"\" shaped island in the outer Firth of Clyde where granite is quarried to make curling stones?\"\nQuestion 14: \"From which Shakespeare play does the line \"\"The course of true love never did run smooth\"\" come?\"\nQuestion 15: What 1943 WWII battle between Germany and the Soviet Union remains to this day the largest series of armored clashes ever?", "role": "user" } ]
["[\"sixty-four\", \"64\"]", "[\"Bradley Walsh\"]", "[\"Shadowfax (disambiguation)\", \"Shadowfax\"]", "[\"Sylvester Stalone\", \"Sylvester Gardenzio Stallone\", \"Sylvester Enzio Stallone\", \"Salvestor Stallone\", \"Slyvester Stallone\", \"Silvester Stallone\", \"Sly Stallone\", \"Sly Stalone\", \"Sly stallone\", \"Sylvester E. Stallone\", \"Sylvester Stallone\", \"Slyvester stallone\"]", "[\"Domestic dogs\", \"Female dogs\", \"Canis familiaris\", \"Canis Familaris\", \"Canis familiaris domesticus\", \"Dogs (Animals)\", \"\\ud83d\\udc15\", \"She dog\", \"She-dog\", \"Dogs\", \"Doggy\", \"Canis familiarus domesticus\", \"Domestic dog\", \"Dogs as pets\", \"Dog (pet)\", \"Dog (Domestic)\", \"Pet dog\", \"She dogs\", \"Canis lupus familiaris\", \"Canine lupus\", \"Dog hood\", \"Shedog\", \"\\ud83d\\udc36\", \"The domestic dog clade\", \"A dog\", \"Canis domesticus\", \"Dogs as our pets\", \"Canis Canis\", \"Domestic Dog\", \"Canis Lupus Familiaris\", \"Doggie\", \"Dog\", \"C.l. familiaris\", \"Doggies\", \"A man's best friend\", \"Doghood\", \"Shedogs\", \"Bitch (female dog)\", \"She-dogs\", \"Dogness\", \"Bitch (dog)\", \"Female dog\", \"C. l. familiaris\", \"Shelter dog\"]", "[\"D\\u00e1vid (name)\", \"Dawidh\", \"David (name)\", \"Yeshay\", \"David's throne\", \"Daevid\", \"Da'oud\", \"Yeshai\", \"DAVID\", \"Davidh\", \"David (given name)\", \"Davut\", \"David (surname)\", \"Dawood (name)\", \"Musical Instruments of King David\", \"Dafydd\", \"Dovid\", \"Da'ud\", \"Dawud (name)\"]", "[\"Poilu\", \"POILU\", \"Poilus\"]", "[\"Magician's Nephew\", \"The Magicians Nephew\", \"THE MAGICIAN'S NEPHEW\", \"The Magician's Nephew\"]", "[\"Toledo City\", \"Toledo (disambiguation)\", \"Toledo\"]", "[\"Four\", \"four\", \"4\"]", "[\"Vulpine\", \"Vixen\", \"Todde\", \"Vulpini\", \"Fox\", \"Foxes\", \"Fox penis\", \"River fox\", \"Fox habitat\", \"Focks\", \"Foxp\", \"Fox (zoology)\", \"Foxs\", \"Sexual characteristics of foxes\"]", "[\"Huhne\", \"Chris Huhne\", \"Christopher Huhne\", \"Chris Hune\"]", "[\"AILSA CRAIG\", \"Ailsa Craig Castle\", \"Ailsa Craig\", \"Creag Ealasaid\", \"Paddy's Milestone\"]", "[\"A midsummer night's dream\", \"A Midsummer Night's dream\", \"Demetrius (A Midsummer Night's Dream)\", \"A Midsummer Nights' Dream\", \"Lysander (Midsummer Night Dream)\", \"A midsummer's dream\", \"A mid summer night's dream\", \"Pease-blossom\", \"A Midsummer Night's Dream\", \"A Midsummernight's Dream\", \"Incidental Music to A Midsummer Night's Dream\", \"Peaseblossom\", \"AMND\", \"A Midsummer Night'S Dream\", \"Hermia and Helena\", \"Midsummer Night\\u2019s Dream\", \"A Midsummer Night\\u2019s Dream\", \"Midsummer Nights Dream\", \"Hippolyta (Shakespeare)\", \"Midsummer Night's Dream\", \"A Midsommer Nights Dreame\", \"A Midsummer Nights Dream\", \"Midsummer nights dream\", \"Lysander (Shakespeare)\", \"The Rude Mechanicals\", \"A Midsummer Night's Dream, Act IV\", \"Rude Mechanic\", \"A Midsummer's Night Dream\", \"Lysander (A Midsummer Night's Dream)\", \"A midsummernight's dream\", \"A Midsummer-Night's Dream\", \"Midsummer-Night's Dream\", \"A Mid\\u017fommer Nights Dreame\", \"Demetrius (Midsummer Night Dream)\", \"Midsummer night dream\", \"A Middsummer Night's Dream\", \"MSND\"]", "[\"World War II/Kursk\", \"Battle of kursk\", \"Operation Zitadel\", \"Operation Zitadelle\", \"Kursk Offensive\", \"The Battle Of Kursk\", \"Kursk Strategic Defensive Operation\", \"Battle for Kursk\", \"Battle of Kursk\", \"Battle Of Kursk\", \"Battle of the Kursk Bulge\", \"Operation Citadel\", \"The Kursk Bulge\", \"Unternehmen Zitadelle\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"sixty-four\", \"64\"]", "[\"Bradley Walsh\"]", "[\"Shadowfax (disambiguation)\", \"Shadowfax\"]", "[\"Sylvester Stalone\", \"Sylvester Gardenzio Stallone\", \"Sylvester Enzio Stallone\", \"Salvestor Stallone\", \"Slyvester Stallone\", \"Silvester Stallone\", \"Sly Stallone\", \"Sly Stalone\", \"Sly stallone\", \"Sylvester E. Stallone\", \"Sylvester Stallone\", \"Slyvester stallone\"]", "[\"Domestic dogs\", \"Female dogs\", \"Canis familiaris\", \"Canis Familaris\", \"Canis familiaris domesticus\", \"Dogs (Animals)\", \"\\ud83d\\udc15\", \"She dog\", \"She-dog\", \"Dogs\", \"Doggy\", \"Canis familiarus domesticus\", \"Domestic dog\", \"Dogs as pets\", \"Dog (pet)\", \"Dog (Domestic)\", \"Pet dog\", \"She dogs\", \"Canis lupus familiaris\", \"Canine lupus\", \"Dog hood\", \"Shedog\", \"\\ud83d\\udc36\", \"The domestic dog clade\", \"A dog\", \"Canis domesticus\", \"Dogs as our pets\", \"Canis Canis\", \"Domestic Dog\", \"Canis Lupus Familiaris\", \"Doggie\", \"Dog\", \"C.l. familiaris\", \"Doggies\", \"A man's best friend\", \"Doghood\", \"Shedogs\", \"Bitch (female dog)\", \"She-dogs\", \"Dogness\", \"Bitch (dog)\", \"Female dog\", \"C. l. familiaris\", \"Shelter dog\"]", "[\"D\\u00e1vid (name)\", \"Dawidh\", \"David (name)\", \"Yeshay\", \"David's throne\", \"Daevid\", \"Da'oud\", \"Yeshai\", \"DAVID\", \"Davidh\", \"David (given name)\", \"Davut\", \"David (surname)\", \"Dawood (name)\", \"Musical Instruments of King David\", \"Dafydd\", \"Dovid\", \"Da'ud\", \"Dawud (name)\"]", "[\"Poilu\", \"POILU\", \"Poilus\"]", "[\"Magician's Nephew\", \"The Magicians Nephew\", \"THE MAGICIAN'S NEPHEW\", \"The Magician's Nephew\"]", "[\"Toledo City\", \"Toledo (disambiguation)\", \"Toledo\"]", "[\"Four\", \"four\", \"4\"]", "[\"Vulpine\", \"Vixen\", \"Todde\", \"Vulpini\", \"Fox\", \"Foxes\", \"Fox penis\", \"River fox\", \"Fox habitat\", \"Focks\", \"Foxp\", \"Fox (zoology)\", \"Foxs\", \"Sexual characteristics of foxes\"]", "[\"Huhne\", \"Chris Huhne\", \"Christopher Huhne\", \"Chris Hune\"]", "[\"AILSA CRAIG\", \"Ailsa Craig Castle\", \"Ailsa Craig\", \"Creag Ealasaid\", \"Paddy's Milestone\"]", "[\"A midsummer night's dream\", \"A Midsummer Night's dream\", \"Demetrius (A Midsummer Night's Dream)\", \"A Midsummer Nights' Dream\", \"Lysander (Midsummer Night Dream)\", \"A midsummer's dream\", \"A mid summer night's dream\", \"Pease-blossom\", \"A Midsummer Night's Dream\", \"A Midsummernight's Dream\", \"Incidental Music to A Midsummer Night's Dream\", \"Peaseblossom\", \"AMND\", \"A Midsummer Night'S Dream\", \"Hermia and Helena\", \"Midsummer Night\\u2019s Dream\", \"A Midsummer Night\\u2019s Dream\", \"Midsummer Nights Dream\", \"Hippolyta (Shakespeare)\", \"Midsummer Night's Dream\", \"A Midsommer Nights Dreame\", \"A Midsummer Nights Dream\", \"Midsummer nights dream\", \"Lysander (Shakespeare)\", \"The Rude Mechanicals\", \"A Midsummer Night's Dream, Act IV\", \"Rude Mechanic\", \"A Midsummer's Night Dream\", \"Lysander (A Midsummer Night's Dream)\", \"A midsummernight's dream\", \"A Midsummer-Night's Dream\", \"Midsummer-Night's Dream\", \"A Mid\\u017fommer Nights Dreame\", \"Demetrius (Midsummer Night Dream)\", \"Midsummer night dream\", \"A Middsummer Night's Dream\", \"MSND\"]", "[\"World War II/Kursk\", \"Battle of kursk\", \"Operation Zitadel\", \"Operation Zitadelle\", \"Kursk Offensive\", \"The Battle Of Kursk\", \"Kursk Strategic Defensive Operation\", \"Battle for Kursk\", \"Battle of Kursk\", \"Battle Of Kursk\", \"Battle of the Kursk Bulge\", \"Operation Citadel\", \"The Kursk Bulge\", \"Unternehmen Zitadelle\"]" ]
[ "What is the largest number on a standard backgammon doubling dice?", "Who plays Brutus, a bar owner, in the recent BBC comedy Sun Trap?", "\"In \"\"The Lord Of The Rings\"\", what was the name of Gandalf's horse?\"", "Sage Moonblood is the child of which action film actor and director?", "What type of animal is a Lhasa Apso?", "Which famous statue by Michelangelo is held in the Galleria dell' Academia in Florence?", "In World War I, the British soldiers were nicknamed 'Tommies', what name was given to Frenchsoldiers?", "\"Which, chronologically, is the first of the \"\"Chronicles of Narnia\"\", although it was the sixth of the series of books written by author C. S. Lewis?\"", "What is the biggest city in Ohio that doesn't start with the letter C?", "How many strings does a ukelele have?", "'Zorro' is the Spanish word for which animal?", "Whose resignation prompted the Eastleigh by-election in February 2013?", "\"What is the name of the \"\"Plum Pudding\"\" shaped island in the outer Firth of Clyde where granite is quarried to make curling stones?\"", "\"From which Shakespeare play does the line \"\"The course of true love never did run smooth\"\" come?\"", "What 1943 WWII battle between Germany and the Soviet Union remains to this day the largest series of armored clashes ever?" ]
15
[ 56400, 56401, 56402, 56403, 56404, 56405, 56406, 56407, 56408, 56409, 56410, 56411, 56412, 56413, 56414 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Braeburn, Jazz, Gala, and Fuji are varieties of what?\nQuestion 2: Treskilling Yellow from Sweden, Bull's Eye from Brazil, Inverted Jenny from the United States, Basel Dove from Switzerland and Benjamin Franklin Z Grill from the United States are some of the famous specimens of what?\nQuestion 3: How many members are there in the US lower house, the House of Representatives?\nQuestion 4: What sport was part of the Olympic Games programme between 1896 and 1924, and returned as a full medal sport at the 1988 Olympics?\nQuestion 5: In business accounts and financial reporting, expenses which change according to scale of performance or usage or demand are known as what?\nQuestion 6: \"What word is used in mathematics to mean \"\"if and only if\"\"?\"\nQuestion 7: Until the Simpsons came along, what was the most successful TV cartoon series?\nQuestion 8: Which female singer finished second in the 2009 'Britain’s Got Talent Show'?\nQuestion 9: In 2015, to reduce road traffic accidents, Dartmoor Cornwall UK authorities tested reflective paint on?\nQuestion 10: What was the name of the Belfast shipyard in which RMS Titanic was built?\nQuestion 11: Batavia was the former name, up until 1942, of which Asian city?\nQuestion 12: What is the fifteenth letter of the Greek alphabet?\nQuestion 13: Who won the best actor Oscar in 1997 fro the film Shine?\nQuestion 14: In darts, which score is called 'bed and breakfast'?\nQuestion 15: Boris Rankov was on the winning side six times in which famous event?", "role": "user" } ]
["[\"Apple Blossom\", \"Appleblossom\", \"Green Apples\", \"Malus domesticus\", \"Appleblossoms\", \"Culture of apple\", \"Malus domestica\", \"Apple blossom\", \"Apple/Nutritional information\", \"Nutritional information about the apple\", \"Apple production\", \"Apple-blossoms\", \"Apple blossoms\", \"Apple peel\", \"An apple a day\", \"Apple (fruit)\", \"Apple trees\", \"Malus pumila\", \"Malus communis\", \"Pyrus malus\", \"Apple tree\", \"\\ud83c\\udf4f\", \"\\ud83c\\udf4e\", \"Apple Popularity\", \"Apples\", \"Dried apple\", \"\\u0633\\u06ce\\u0648\", \"Apple (Fruit)\", \"Green Apple\", \"Apple-tree\", \"Green apples\", \"Apple\", \"Apples and teachers\", \"Aplle\", \"Apple-blossom\", \"Apple (tree)\"]", "[\"Adhesive postage stamp\", \"Postage stamps\", \"Post stamp\", \"Postage stamp\", \"Postage Stamp\", \"Stamp (postage)\", \"Postal stamp\", \"Postage stamp/how dispensed\"]", "[\"435\", \"four hundred and thirty-five\"]", "[\"Lawn tennis\", \"Tenniz\", \"TenniS\", \"Tenis\", \"Lawn-Tennis\", \"Professional tennis player\", \"Break point\", \"Tennis\", \"Tennis player\", \"Big tennis\", \"Lawn Tennis\", \"Match point (tennis)\", \"Game point\", \"Set point (tennis)\", \"Tennis coaching\", \"Match tiebreak\", \"Championship point\", \"\\ud83c\\udfbe\"]", "[\"Direct cost\", \"Total variable costs\", \"Variable Cost\", \"Variable Costs\", \"Total variable cost\", \"Prime costs\", \"Variable expense\", \"Prime cost\", \"Variable cost\", \"Variable costs\"]", "[\"Precisely when\", \"If and only if\", \"If, and only if\", \"Only if\", \"Just in case (catachresis)\", \"Iff\", \"Material equivalence\", \"\\u2194\", \"If & only if\", \"\\u21d4\", \"Bi-implication\", \"All and only\", \"Materially equivalent\"]", "[\"The Flinstones\", \"Yaba Daba Doo\", \"Loyal Order of Water Buffaloes Lodge No. 26\", \"Flintstones\", \"The Flintstones Fox\", \"Flinstones\", \"The Flinstones (2013 TV series)\", \"Loyal Order of Water Buffaloes\", \"The Flintstones (1980)\", \"Hoppy (The Flintstones)\", \"The Flintstones (Fox television series)\", \"The Flagstones\", \"List of The Flintstones characters\", \"Hollyrock\", \"Yabadabadoo\", \"The Flintstones (2013)\", \"The Flintstones (Fox TV series)\", \"Baby Puss (The Flintstones)\", \"The Flintstone\", \"Flintstones, The\", \"The Flintstones\", \"Overview of The Flintstones\", \"Mr. Slate\"]", "[\"Susan Magdalane Boyle\", \"Susan boyle\", \"Susan doyle\", \"Susan Boyle\", \"Home For Christmas (Susan Boyle album)\", \"Suzanne Boyle\", \"SUsan Boyle\", \"Susan BOyle\", \"SuBo\", \"Susan boil\"]", "[\"Poney\", \"Ponies\", \"Pony\"]", "[\"Harland & Wolf\", \"Harland & Wolff, Limited\", \"Harland and Wolfe\", \"Harland & Wolff\", \"Harland & Wolff Ltd.\", \"Harland & Wolf Ltd.\", \"Harland & Wolf, Limited\", \"Harland & wolf shipyards\", \"Harland and Wolff\", \"Harland and Wolf\", \"Harland & Wolff Ltd\", \"Harland and wolf\"]", "[\"ID-JK\", \"DKI Jakarta\", \"Jakarta Raya\", \"Jacarta\", \"Calapa\", \"DKI Jaya\", \"Djakarta\", \"City of Djakarta\", \"Djarkarta\", \"Daerah Khusus Ibukota Jakarta\", \"JAKARTA\", \"Jakarda\", \"Jayakarta\", \"Jakartanese\", \"City Jakarta\", \"Jakarta\", \"Jakarta Special Capital Region\", \"Special Capital Region of Jakarta\", \"Jakarta, Indonesia\", \"Capital of Indonesia\", \"Jakarta, Java\", \"City of Jakarta\", \"Jakarta Province\", \"Djarkata\", \"Batavia, Indonesia\"]", "[\"\\u038c\\u03bc\\u03b9\\u03ba\\u03c1\\u03bf\\u03bd\", \"Omicron (letter)\", \"Omicron (Greek)\", \"Omicon\", \"%5Comicron\", \"Omicron\", \"\\u039f\"]", "[\"Geoffrey rush\", \"Geoffrey Rush\", \"Geoff Rush\"]", "[\"26\", \"twenty-six\"]", "[\"Posh boy's thames challenge\", \"Boat Race\", \"Cambridge and Oxford Boat Race\", \"The Oxford and Cambridge University Boat Race\", \"Oxford and Cambridge Boat Race\", \"The Oxford-Cambridge Boat Race\", \"Battle of the Blues (boat race)\", \"The Xchanging Boat Race\", \"Boat race\", \"The boat race\", \"Oxford Cambridge boat race\", \"University Boat Race\", \"Xchanging Boat Race\", \"Oxford and Cambridge boat race\", \"The Boat Race\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Apple Blossom\", \"Appleblossom\", \"Green Apples\", \"Malus domesticus\", \"Appleblossoms\", \"Culture of apple\", \"Malus domestica\", \"Apple blossom\", \"Apple/Nutritional information\", \"Nutritional information about the apple\", \"Apple production\", \"Apple-blossoms\", \"Apple blossoms\", \"Apple peel\", \"An apple a day\", \"Apple (fruit)\", \"Apple trees\", \"Malus pumila\", \"Malus communis\", \"Pyrus malus\", \"Apple tree\", \"\\ud83c\\udf4f\", \"\\ud83c\\udf4e\", \"Apple Popularity\", \"Apples\", \"Dried apple\", \"\\u0633\\u06ce\\u0648\", \"Apple (Fruit)\", \"Green Apple\", \"Apple-tree\", \"Green apples\", \"Apple\", \"Apples and teachers\", \"Aplle\", \"Apple-blossom\", \"Apple (tree)\"]", "[\"Adhesive postage stamp\", \"Postage stamps\", \"Post stamp\", \"Postage stamp\", \"Postage Stamp\", \"Stamp (postage)\", \"Postal stamp\", \"Postage stamp/how dispensed\"]", "[\"435\", \"four hundred and thirty-five\"]", "[\"Lawn tennis\", \"Tenniz\", \"TenniS\", \"Tenis\", \"Lawn-Tennis\", \"Professional tennis player\", \"Break point\", \"Tennis\", \"Tennis player\", \"Big tennis\", \"Lawn Tennis\", \"Match point (tennis)\", \"Game point\", \"Set point (tennis)\", \"Tennis coaching\", \"Match tiebreak\", \"Championship point\", \"\\ud83c\\udfbe\"]", "[\"Direct cost\", \"Total variable costs\", \"Variable Cost\", \"Variable Costs\", \"Total variable cost\", \"Prime costs\", \"Variable expense\", \"Prime cost\", \"Variable cost\", \"Variable costs\"]", "[\"Precisely when\", \"If and only if\", \"If, and only if\", \"Only if\", \"Just in case (catachresis)\", \"Iff\", \"Material equivalence\", \"\\u2194\", \"If & only if\", \"\\u21d4\", \"Bi-implication\", \"All and only\", \"Materially equivalent\"]", "[\"The Flinstones\", \"Yaba Daba Doo\", \"Loyal Order of Water Buffaloes Lodge No. 26\", \"Flintstones\", \"The Flintstones Fox\", \"Flinstones\", \"The Flinstones (2013 TV series)\", \"Loyal Order of Water Buffaloes\", \"The Flintstones (1980)\", \"Hoppy (The Flintstones)\", \"The Flintstones (Fox television series)\", \"The Flagstones\", \"List of The Flintstones characters\", \"Hollyrock\", \"Yabadabadoo\", \"The Flintstones (2013)\", \"The Flintstones (Fox TV series)\", \"Baby Puss (The Flintstones)\", \"The Flintstone\", \"Flintstones, The\", \"The Flintstones\", \"Overview of The Flintstones\", \"Mr. Slate\"]", "[\"Susan Magdalane Boyle\", \"Susan boyle\", \"Susan doyle\", \"Susan Boyle\", \"Home For Christmas (Susan Boyle album)\", \"Suzanne Boyle\", \"SUsan Boyle\", \"Susan BOyle\", \"SuBo\", \"Susan boil\"]", "[\"Poney\", \"Ponies\", \"Pony\"]", "[\"Harland & Wolf\", \"Harland & Wolff, Limited\", \"Harland and Wolfe\", \"Harland & Wolff\", \"Harland & Wolff Ltd.\", \"Harland & Wolf Ltd.\", \"Harland & Wolf, Limited\", \"Harland & wolf shipyards\", \"Harland and Wolff\", \"Harland and Wolf\", \"Harland & Wolff Ltd\", \"Harland and wolf\"]", "[\"ID-JK\", \"DKI Jakarta\", \"Jakarta Raya\", \"Jacarta\", \"Calapa\", \"DKI Jaya\", \"Djakarta\", \"City of Djakarta\", \"Djarkarta\", \"Daerah Khusus Ibukota Jakarta\", \"JAKARTA\", \"Jakarda\", \"Jayakarta\", \"Jakartanese\", \"City Jakarta\", \"Jakarta\", \"Jakarta Special Capital Region\", \"Special Capital Region of Jakarta\", \"Jakarta, Indonesia\", \"Capital of Indonesia\", \"Jakarta, Java\", \"City of Jakarta\", \"Jakarta Province\", \"Djarkata\", \"Batavia, Indonesia\"]", "[\"\\u038c\\u03bc\\u03b9\\u03ba\\u03c1\\u03bf\\u03bd\", \"Omicron (letter)\", \"Omicron (Greek)\", \"Omicon\", \"%5Comicron\", \"Omicron\", \"\\u039f\"]", "[\"Geoffrey rush\", \"Geoffrey Rush\", \"Geoff Rush\"]", "[\"26\", \"twenty-six\"]", "[\"Posh boy's thames challenge\", \"Boat Race\", \"Cambridge and Oxford Boat Race\", \"The Oxford and Cambridge University Boat Race\", \"Oxford and Cambridge Boat Race\", \"The Oxford-Cambridge Boat Race\", \"Battle of the Blues (boat race)\", \"The Xchanging Boat Race\", \"Boat race\", \"The boat race\", \"Oxford Cambridge boat race\", \"University Boat Race\", \"Xchanging Boat Race\", \"Oxford and Cambridge boat race\", \"The Boat Race\"]" ]
[ "Braeburn, Jazz, Gala, and Fuji are varieties of what?", "Treskilling Yellow from Sweden, Bull's Eye from Brazil, Inverted Jenny from the United States, Basel Dove from Switzerland and Benjamin Franklin Z Grill from the United States are some of the famous specimens of what?", "How many members are there in the US lower house, the House of Representatives?", "What sport was part of the Olympic Games programme between 1896 and 1924, and returned as a full medal sport at the 1988 Olympics?", "In business accounts and financial reporting, expenses which change according to scale of performance or usage or demand are known as what?", "\"What word is used in mathematics to mean \"\"if and only if\"\"?\"", "Until the Simpsons came along, what was the most successful TV cartoon series?", "Which female singer finished second in the 2009 'Britain’s Got Talent Show'?", "In 2015, to reduce road traffic accidents, Dartmoor Cornwall UK authorities tested reflective paint on?", "What was the name of the Belfast shipyard in which RMS Titanic was built?", "Batavia was the former name, up until 1942, of which Asian city?", "What is the fifteenth letter of the Greek alphabet?", "Who won the best actor Oscar in 1997 fro the film Shine?", "In darts, which score is called 'bed and breakfast'?", "Boris Rankov was on the winning side six times in which famous event?" ]
15
[ 83820, 83821, 83822, 83823, 83824, 83825, 83826, 83827, 83828, 83829, 83830, 83831, 83832, 83833, 83834 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which comedian and comic actor played both 'the Gaffer' and 'Selwyn Froggitt' in TV series?\nQuestion 2: Who presented the TV show 'The Human Body'?\nQuestion 3: Which insect gives off the froth known as cuckoo spit\nQuestion 4: What is the common name of Hansen’s Disease?\nQuestion 5: What series of wars was an attempt by European Christians to retake the holy land?\nQuestion 6: Chamberlain seemed such a nice old gentleman that I thought I would give him my autograph.\nQuestion 7: King Stephen (1135-54) was the only king of which royal house?\nQuestion 8: What is Paul McCartney's middle name?\nQuestion 9: At which London station was a statue of John Betjeman unveiled in 2007?\nQuestion 10: Who won best actor at the 80th Academy Awards of 2008?\nQuestion 11: \"A dish cooked \"\"a la Crecy\"\" would be garnished or prepared with which ingredient?\"\nQuestion 12: What is another name for the plant Deadly Nightshade?\nQuestion 13: Which former Blue Peter presenter was involved in the first National Lottery TV draw in November 1994?\nQuestion 14: What is the American equivalent of the 'Financial Times'?\nQuestion 15: \"According to the lyrics of the song \"\"Fairytale of New York\"\", what were 'the boys of the NYPD choir singing'?\"", "role": "user" } ]
["[\"Walter Frederick George Williams\", \"Bill Maynard\"]", "[\"Robert Maurice Lipson Winston\", \"Baron Winston\", \"Bob Winston\", \"Lord Winston\", \"ROBERT WINSTON\", \"Robert Maurice Lipson Winston, Baron Winston\", \"Robert Winston, Baron Winston\", \"Robert Winston\"]", "[\"Spit bug\", \"Cercopoidea\", \"Spit Bugs\", \"Froth-fly\", \"Spittlebugs\", \"Spit Bug\", \"Cuckoo spit\", \"Spitbug\", \"Froghoppers\", \"Spit bugs\", \"Spittle bug\", \"Spittle bugs\", \"Cuckoo-spit\", \"Meadow Spittle Bug\", \"Spit insect\", \"Froghopper\", \"Froth fly\", \"Spittlebug\", \"Cuckoo-Spit\"]", "[\"Midborderline leprosy\", \"Lucio leprosy\", \"Leprocy\", \"Hansenite\", \"Hansen\\u2019s disease\", \"Hansenites\", \"Visual surveillance of extremities\", \"Hansens Disease\", \"Leprosy-3 Virus\", \"Leprosey\", \"Hansen's Disease\", \"Leprosy, tuberculoid\", \"Leprosy, indeterminate\", \"Leper hospital\", \"Lucio phenomenon\", \"Upgrading lepra reaction type 1\", \"Lepro-B1 Virus\", \"Lepers\", \"Leprosy, dimorphic\", \"Holdsveiki\", \"Leprosy Virus\", \"Leprosy, borderline lepromatous\", \"Lepracy\", \"Hansen disease\", \"Hansen's disease\", \"Leprosy, Lucio\", \"Leper\", \"Leprosy (Hansen's disease)\", \"Hanson's disease\", \"Leprosy hospital\", \"Lausma\", \"Leprosy, midborderline\", \"Hansons disease\", \"Lepra reaction type 1\", \"Leper hospitals\", \"Leprosy\", \"L\\u00edk\\u00fer\\u00e1\", \"Leperacy\", \"Leprology\", \"Dimorphic leprosy\", \"Downgrading lepra reaction type 1\", \"Likthra\", \"Leprosy, borderline tuberculoid\", \"Leprosy-B Virus\", \"Indeterminate leprosy\"]", "[\"Kreuzzuege\", \"Holy Crusades\", \"Kurishu Yudham\", \"Took the cross\", \"Holy Land Crusades\", \"The Crusades\", \"Pasagium\", \"List of crusades\", \"Croisade (Crusade)\", \"CrusaDes\", \"The crusades\", \"Holy Land Wars\", \"Kreuzz\\u00fcge\", \"Kreuzzuge\", \"Crusaders\", \"Crusading Age\", \"Crusading\", \"Crusades\", \"Cruzade\", \"Crusadex\", \"Crusade\", \"Crucades\", \"Crusading age\", \"European crusaders\", \"Medieval Crusades\"]", "[\"Hitlerian\", \"Adolph Schicklgruber\", \"HitlerAdolf\", \"Hitler's medical health\", \"Adolf Hitle\", \"Hitlar\", \"Adolph Hiedler\", \"Adolf Hiedler\", \"Adolph Hittler\", \"Day of Potsdam\", \"Adolpf Hitler\", \"Adolf Hister\", \"Adolf Hitlier\", \"Adolph Hitler's health\", \"Hitler's health\", \"Hitlers\", \"Aldof Hilter\", \"HITLER\", \"Hitler, Adolph\", \"History of Adolf Hitler\", \"Hitler,Adolph\", \"Adolph Hiter\", \"Adolf Hittler\", \"Herr Hitler\", \"Hitler,Adolf\", \"Adolf Schicklegruber\", \"Adolf hitler\", \"Adlof hitler\", \"Adolph Schickelgruber\", \"Hitler Adolf\", \"Hitlers medical health\", \"HitlerAdolph\", \"Adolph Schicklegruber\", \"Adolf Hiler\", \"Adolf Hitler's medical condition\", \"Hittler\", \"Adolf Schickelgruber\", \"Adolf Hitler\", \"Hitler's\", \"Hitler, adolf\", \"Nazi leader\", \"Hitler, Adolf\", \"Herr Wolf\", \"Adolph Hitler's medical health\", \"Adolph Hitler\", \"Adolf Hitler's health\", \"Adolf Schicklgruber\", \"AdolphHitler\", \"Adolf Hilter\", \"Health of Adolf Hitler\", \"Adolf Hitler's medical health\", \"Hitler Adolph\", \"AdolfHitler\", \"Adolf HItler\", \"Hitlet\", \"Hitler adolf\", \"Adoff Hitler\", \"Adolfus Hitler\", \"Hitler\", \"Adolph hitler\"]", "[\"Blois\", \"BLOIS\", \"Blois, Loir-et-Cher\"]", "[\"Paul\", \"Pa\\u00fal\", \"Paul (disambiguation)\"]", "[\"St. Pancras\", \"Saint Pancras\", \"St Pancreas\", \"St Pancras Church\", \"Pangratios\", \"St Pancras (disambiguation)\", \"St pancras\", \"St Pancras\", \"Pankratios\", \"St. Pancras (disambiguation)\"]", "[\"Daniel Day Lewis\", \"Daniel day lewis\", \"Daniel Day-Lewis\", \"Daniel day louis\", \"Day-Lewis, Daniel\", \"Daniel Michael Blake Day-Lewis\", \"Daniel Michael Blake Day Lewis\", \"Daniel-Day Lewis\", \"Daniel Day Luas\", \"Daniel day-lewis\", \"Sir Daniel Day-Lewis\"]", "[\"Daucus carota subsp. sativus,\", \"Carrots\", \"Karrot\", \"Bird's-nest root\", \"Devil's Plague\", \"CARROTS\", \"Carota\", \"Carrot\", \"Common carrot\", \"Bee's-nest plant\", \"Black carrot\", \"Bee's-nest\", \"Daucus carota subsp. sativus\", \"Black Carrot\"]", "[\"Bella Donna\", \"BELLADONNA\", \"Belladonna (disambiguation)\", \"Belladonna (person)\", \"Belladonna\", \"Belladona (disambiguation)\", \"Bella Donna (film)\", \"Belladona\"]", "[\"Anthea Turner\", \"Flakegate\"]", "[\"Customers' Afternoon Letter\", \"Wall St Journal\", \"The Asia Wall Street Journal\", \"The Wall Street Journals\", \"WSJ\", \"The Wallstreet Journal.\", \"Wall Street Journal News\", \"Opinion Journal\", \"Joseph B. White\", \"The Wall St. Journal\", \"WSJ.com\", \"Wall street journal\", \"Wsj\", \"The Wall Street Journal.\", \"The Wall Street journal\", \"Wallstreet Journal\", \"The fox Street Journal\", \"Wall Str. J.\", \"Wsj.com\", \"Wall St. Journal\", \"The Wall Street Journal\", \"Wall Street Journal\", \"WALL STREET JOURNAL\", \"Wallstreet journal\"]", "[\"Galway Bay Drowning Tragedy\", \"Loch Lurgain\", \"GALWAY BAY\", \"Galway Bay drowning tragedy\", \"Galway Bay\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Walter Frederick George Williams\", \"Bill Maynard\"]", "[\"Robert Maurice Lipson Winston\", \"Baron Winston\", \"Bob Winston\", \"Lord Winston\", \"ROBERT WINSTON\", \"Robert Maurice Lipson Winston, Baron Winston\", \"Robert Winston, Baron Winston\", \"Robert Winston\"]", "[\"Spit bug\", \"Cercopoidea\", \"Spit Bugs\", \"Froth-fly\", \"Spittlebugs\", \"Spit Bug\", \"Cuckoo spit\", \"Spitbug\", \"Froghoppers\", \"Spit bugs\", \"Spittle bug\", \"Spittle bugs\", \"Cuckoo-spit\", \"Meadow Spittle Bug\", \"Spit insect\", \"Froghopper\", \"Froth fly\", \"Spittlebug\", \"Cuckoo-Spit\"]", "[\"Midborderline leprosy\", \"Lucio leprosy\", \"Leprocy\", \"Hansenite\", \"Hansen\\u2019s disease\", \"Hansenites\", \"Visual surveillance of extremities\", \"Hansens Disease\", \"Leprosy-3 Virus\", \"Leprosey\", \"Hansen's Disease\", \"Leprosy, tuberculoid\", \"Leprosy, indeterminate\", \"Leper hospital\", \"Lucio phenomenon\", \"Upgrading lepra reaction type 1\", \"Lepro-B1 Virus\", \"Lepers\", \"Leprosy, dimorphic\", \"Holdsveiki\", \"Leprosy Virus\", \"Leprosy, borderline lepromatous\", \"Lepracy\", \"Hansen disease\", \"Hansen's disease\", \"Leprosy, Lucio\", \"Leper\", \"Leprosy (Hansen's disease)\", \"Hanson's disease\", \"Leprosy hospital\", \"Lausma\", \"Leprosy, midborderline\", \"Hansons disease\", \"Lepra reaction type 1\", \"Leper hospitals\", \"Leprosy\", \"L\\u00edk\\u00fer\\u00e1\", \"Leperacy\", \"Leprology\", \"Dimorphic leprosy\", \"Downgrading lepra reaction type 1\", \"Likthra\", \"Leprosy, borderline tuberculoid\", \"Leprosy-B Virus\", \"Indeterminate leprosy\"]", "[\"Kreuzzuege\", \"Holy Crusades\", \"Kurishu Yudham\", \"Took the cross\", \"Holy Land Crusades\", \"The Crusades\", \"Pasagium\", \"List of crusades\", \"Croisade (Crusade)\", \"CrusaDes\", \"The crusades\", \"Holy Land Wars\", \"Kreuzz\\u00fcge\", \"Kreuzzuge\", \"Crusaders\", \"Crusading Age\", \"Crusading\", \"Crusades\", \"Cruzade\", \"Crusadex\", \"Crusade\", \"Crucades\", \"Crusading age\", \"European crusaders\", \"Medieval Crusades\"]", "[\"Hitlerian\", \"Adolph Schicklgruber\", \"HitlerAdolf\", \"Hitler's medical health\", \"Adolf Hitle\", \"Hitlar\", \"Adolph Hiedler\", \"Adolf Hiedler\", \"Adolph Hittler\", \"Day of Potsdam\", \"Adolpf Hitler\", \"Adolf Hister\", \"Adolf Hitlier\", \"Adolph Hitler's health\", \"Hitler's health\", \"Hitlers\", \"Aldof Hilter\", \"HITLER\", \"Hitler, Adolph\", \"History of Adolf Hitler\", \"Hitler,Adolph\", \"Adolph Hiter\", \"Adolf Hittler\", \"Herr Hitler\", \"Hitler,Adolf\", \"Adolf Schicklegruber\", \"Adolf hitler\", \"Adlof hitler\", \"Adolph Schickelgruber\", \"Hitler Adolf\", \"Hitlers medical health\", \"HitlerAdolph\", \"Adolph Schicklegruber\", \"Adolf Hiler\", \"Adolf Hitler's medical condition\", \"Hittler\", \"Adolf Schickelgruber\", \"Adolf Hitler\", \"Hitler's\", \"Hitler, adolf\", \"Nazi leader\", \"Hitler, Adolf\", \"Herr Wolf\", \"Adolph Hitler's medical health\", \"Adolph Hitler\", \"Adolf Hitler's health\", \"Adolf Schicklgruber\", \"AdolphHitler\", \"Adolf Hilter\", \"Health of Adolf Hitler\", \"Adolf Hitler's medical health\", \"Hitler Adolph\", \"AdolfHitler\", \"Adolf HItler\", \"Hitlet\", \"Hitler adolf\", \"Adoff Hitler\", \"Adolfus Hitler\", \"Hitler\", \"Adolph hitler\"]", "[\"Blois\", \"BLOIS\", \"Blois, Loir-et-Cher\"]", "[\"Paul\", \"Pa\\u00fal\", \"Paul (disambiguation)\"]", "[\"St. Pancras\", \"Saint Pancras\", \"St Pancreas\", \"St Pancras Church\", \"Pangratios\", \"St Pancras (disambiguation)\", \"St pancras\", \"St Pancras\", \"Pankratios\", \"St. Pancras (disambiguation)\"]", "[\"Daniel Day Lewis\", \"Daniel day lewis\", \"Daniel Day-Lewis\", \"Daniel day louis\", \"Day-Lewis, Daniel\", \"Daniel Michael Blake Day-Lewis\", \"Daniel Michael Blake Day Lewis\", \"Daniel-Day Lewis\", \"Daniel Day Luas\", \"Daniel day-lewis\", \"Sir Daniel Day-Lewis\"]", "[\"Daucus carota subsp. sativus,\", \"Carrots\", \"Karrot\", \"Bird's-nest root\", \"Devil's Plague\", \"CARROTS\", \"Carota\", \"Carrot\", \"Common carrot\", \"Bee's-nest plant\", \"Black carrot\", \"Bee's-nest\", \"Daucus carota subsp. sativus\", \"Black Carrot\"]", "[\"Bella Donna\", \"BELLADONNA\", \"Belladonna (disambiguation)\", \"Belladonna (person)\", \"Belladonna\", \"Belladona (disambiguation)\", \"Bella Donna (film)\", \"Belladona\"]", "[\"Anthea Turner\", \"Flakegate\"]", "[\"Customers' Afternoon Letter\", \"Wall St Journal\", \"The Asia Wall Street Journal\", \"The Wall Street Journals\", \"WSJ\", \"The Wallstreet Journal.\", \"Wall Street Journal News\", \"Opinion Journal\", \"Joseph B. White\", \"The Wall St. Journal\", \"WSJ.com\", \"Wall street journal\", \"Wsj\", \"The Wall Street Journal.\", \"The Wall Street journal\", \"Wallstreet Journal\", \"The fox Street Journal\", \"Wall Str. J.\", \"Wsj.com\", \"Wall St. Journal\", \"The Wall Street Journal\", \"Wall Street Journal\", \"WALL STREET JOURNAL\", \"Wallstreet journal\"]", "[\"Galway Bay Drowning Tragedy\", \"Loch Lurgain\", \"GALWAY BAY\", \"Galway Bay drowning tragedy\", \"Galway Bay\"]" ]
[ "Which comedian and comic actor played both 'the Gaffer' and 'Selwyn Froggitt' in TV series?", "Who presented the TV show 'The Human Body'?", "Which insect gives off the froth known as cuckoo spit", "What is the common name of Hansen’s Disease?", "What series of wars was an attempt by European Christians to retake the holy land?", "Chamberlain seemed such a nice old gentleman that I thought I would give him my autograph.", "King Stephen (1135-54) was the only king of which royal house?", "What is Paul McCartney's middle name?", "At which London station was a statue of John Betjeman unveiled in 2007?", "Who won best actor at the 80th Academy Awards of 2008?", "\"A dish cooked \"\"a la Crecy\"\" would be garnished or prepared with which ingredient?\"", "What is another name for the plant Deadly Nightshade?", "Which former Blue Peter presenter was involved in the first National Lottery TV draw in November 1994?", "What is the American equivalent of the 'Financial Times'?", "\"According to the lyrics of the song \"\"Fairytale of New York\"\", what were 'the boys of the NYPD choir singing'?\"" ]
15
[ 48315, 48316, 48317, 48318, 48319, 48320, 48321, 48322, 48323, 48324, 48325, 48326, 48327, 48328, 48329 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What was patented in London by Ralph Wedgewood in 1806?\nQuestion 2: \"Which country is nicknamed \"\"The Land of The Thousand Lakes\"\"?\"\nQuestion 3: Which 1940 film was the first commercial film to be shown in stereophonic sound?\nQuestion 4: What sport is associated with Vladimir Putin, the second President of the Russian Federation?\nQuestion 5: In what card game does a player ask his opponent for one of his or her cards of a particular rank, drawing a card from the pool if the opponent has none?\nQuestion 6: Who famously wore a pink Chanel suit and matching pillbox hat?\nQuestion 7: \"\"\"Last night I dreamt I went to Manderley again,\"\" was the first line of what Daphne du Maurier novel?\"\nQuestion 8: According to the nursery rhyme, what did Old Mother Hubbard go to the cupboard to fetch?\nQuestion 9: In 2001 Martin Creed notoriously won the Turner Prize, for an installation consisting of an empty room, with what happening every five seconds?\nQuestion 10: 'Economo's Disease', or 'Trypanosomiasis' is better known as what?\nQuestion 11: In British politics, who had the nickname ‘The Beast of Bolsover’?\nQuestion 12: The humerus, paired radius, and ulna come together to form what joint?\nQuestion 13: Which international relief agency, formed in 1863, has it's headquarters at 17, Avenue de la Paix, Geneva?\nQuestion 14: According to Greek mythology who killed Achilles by shooting him in the heel with a poisoned arrow?\nQuestion 15: Jared Fogle became a spokesperson for what fast food chain, following his dramatic weight loss by eating their products?", "role": "user" } ]
["[\"Carbon paper\"]", "[\"FinlanD\", \"FINLAND\", \"Suomen tasavalta\", \"Suomen Tasavalta\", \"Republiken Finland\", \"Finlande\", \"Finland\", \"Finland during World War II\", \"Finnland\", \"Finland's\", \"Republic of Finland\", \"Etymology of Finland\", \"Fin land\", \"Name of Finland\", \"Finn Land\", \"ISO 3166-1:FI\", \"Northern Finland\"]", "[\"Fantasia (album)\", \"Fantasia\", \"Fantasia (disambiguation)\", \"Fantasia (film)\"]", "[\"Yuko (judo)\", \"Zyuudou\", \"Ju-do\", \"Judoka\", \"Judoist\", \"\\u67d4\\u9053\", \"J\\u016bd\\u014d\", \"J\\u016bd\\u014dka\", \"Juudoo\", \"Judo\", \"Kata (judo)\", \"Japanese Judo\", \"J\\u00fbd\\u00f4\", \"Zyudo\", \"JudO\", \"Kodokan Judo\", \"JUDO\", \"Juudou\", \"Jud\\u014d\", \"Judo kata\", \"Juhdoh\", \"Golden score\"]", "[\"Go fish\", \"Fish (card game)\", \"Go Fish\"]", "[\"Jackie O.\", \"Jackie O\", \"Jackie Kennedy Onassis\", \"Jacqueline Lee Bouvier Kennedy\", \"Jacqueline Bouvier Kennedy\", \"Jacqueline Lee Bouvier\", \"Jackie Onassis\", \"First Lady Jacqueline Kennedy Onassis\", \"Jackie o\", \"Jacqueline Onassis\", \"Jackie Bouvier Kennedy Onassis\", \"Jacqueline Lee Kennedy\", \"Jackie Bouvier Kennedy\", \"Jackieo\", \"Mrs. Kennedy\", \"Jacquelyn Kennedy\", \"Jacqueline Kennedy-Onassis\", \"Jacky O\", \"Jackie-O\", \"Arabella Kennedy\", \"Jackie Kennedy\", \"Jackeline Bouvier Kennedy\", \"Jacqueline Lee Bouvier Kennedy Onassis\", \"Jacqueline Bouvier Onassis\", \"Jacqueline Bouvier\", \"Jacqueline Kennedy\", \"Jacky o\", \"Jacqueline Bouvier Kennedy Onassis\", \"Jacqueline Kennedy Onassis\"]", "[\"Rifkah\", \"Rifko\", \"Rifka\", \"Rifkoh\", \"Ribhqah\", \"Rivqah\", \"Rebeccah\", \"Rebekah\", \"Rivqa\", \"Rivko\", \"Rivka\", \"Rebbecca\", \"Rebecca\", \"Rivkoh\"]", "[\"Bone lining cell\", \"Woven vs. lamellar bone\", \"Osseous\", \"Compact Bone\", \"A bone\", \"Woven bone\", \"BONES\", \"Bone\", \"Lamellar bone\", \"Bones\", \"Bone development\", \"Bone (Human Anatomy)\", \"Five funtions of bones\", \"Bone and bones\"]", "[\"Martin Creed\", \"Lights going on and off\", \"The lights going on and off\"]", "[\"Sleeping-Sickness\", \"Sleeping sickness (disambiguation)\", \"Sleeping Sickness\", \"'SLEEPING SICKNESS'\", \"Sleeping sickness\", \"Sleep illness\"]", "[\"Beast of Bolsover\", \"Dennis Edward Skinner\", \"Denis Skinner\", \"Dennis Skinner\"]", "[\"Elbows\", \"Elbow Joint\", \"Carrying angle\", \"Cubital angle\", \"Elbow examination\", \"Elbow-joint\", \"Elbow joint\", \"Anconal\", \"Elbow\", \"Cubital joint\", \"Articulatio cubiti\"]", "[\"Red Cross\", \"RED CROSS\", \"The Jordan Red Crescent\", \"Red Cross and Red Crescent Movement\", \"Red Cross and Red Crescent\", \"American Red Crescent Movement\", \"Red Cross Movement\", \"Red crescent\", \"International Red Cross Committee\", \"Jordan Red Crescent\", \"International Red Crescent\", \"International Red Cross and Red Crescent Movement\", \"The International Red Cross and Red Crescent\", \"Red Crescent\", \"Red Crescent Movement\", \"Fundamental Principles of the International Red Cross and Red Crescent Movement\", \"Red Cross or Red Crescent\", \"International Conference of the Red Cross and Red Crescent\", \"International Federation of the Red Cross\", \"International Federation of Red Cross\", \"Red Cross of North Korea\", \"Red crescent society\", \"The Red Crescent\", \"Red cross\", \"Red Crescent Society\", \"Red cresent\", \"Red Crescent Societies\", \"International Federation of Red Cross and Red Crescent\", \"Red Cross movement\", \"International Red Cross & Red Crescent Movement\", \"International Red Cross and Red Crescent\", \"Red Cross Socieites\"]", "[\"Pa\\u0159\\u00ed\\u017e\", \"FRPAR\", \"Paris\", \"Name of paris and its inhabitants\", \"Paname\", \"Paris France\", \"Ville Lumi\\u00e8re\", \"Leucetia\", \"Rue de M\\u00e9nilmontant\", \"Paris agglomeration\", \"France Paris\", \"Sports in Paris\", \"Departement de Paris\", \"Paris, Ile-De-France\", \"Rue de Menilmontant\", \"UN/LOCODE:FRPAR\", \"Pa\\u0159\\u00ed\\u017ei\", \"Ville Lumiere\", \"Paris, France\", \"Paris, \\u00cele-de-France\", \"Paris, \\u00cele-de-France, France\", \"Parijs\", \"Parisien\", \"Cuisine of Paris\", \"Suburbs of Paris\", \"Sport in Paris\", \"The weather in Paris\", \"Parisian (person)\", \"Parizi\", \"Par\\u00eds\", \"Name of Paris and its inhabitants\", \"Paree\", \"Paris, Europe\", \"Paris, Banks of the Seine\", \"Paris (etymology)\", \"Paris (France)\", \"The City of Love (city)\", \"D\\u00e9partement de Paris\"]", "[\"The Subway\", \"Subway (disambiguation)\", \"Subwya\", \"Subways\", \"Subway\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Carbon paper\"]", "[\"FinlanD\", \"FINLAND\", \"Suomen tasavalta\", \"Suomen Tasavalta\", \"Republiken Finland\", \"Finlande\", \"Finland\", \"Finland during World War II\", \"Finnland\", \"Finland's\", \"Republic of Finland\", \"Etymology of Finland\", \"Fin land\", \"Name of Finland\", \"Finn Land\", \"ISO 3166-1:FI\", \"Northern Finland\"]", "[\"Fantasia (album)\", \"Fantasia\", \"Fantasia (disambiguation)\", \"Fantasia (film)\"]", "[\"Yuko (judo)\", \"Zyuudou\", \"Ju-do\", \"Judoka\", \"Judoist\", \"\\u67d4\\u9053\", \"J\\u016bd\\u014d\", \"J\\u016bd\\u014dka\", \"Juudoo\", \"Judo\", \"Kata (judo)\", \"Japanese Judo\", \"J\\u00fbd\\u00f4\", \"Zyudo\", \"JudO\", \"Kodokan Judo\", \"JUDO\", \"Juudou\", \"Jud\\u014d\", \"Judo kata\", \"Juhdoh\", \"Golden score\"]", "[\"Go fish\", \"Fish (card game)\", \"Go Fish\"]", "[\"Jackie O.\", \"Jackie O\", \"Jackie Kennedy Onassis\", \"Jacqueline Lee Bouvier Kennedy\", \"Jacqueline Bouvier Kennedy\", \"Jacqueline Lee Bouvier\", \"Jackie Onassis\", \"First Lady Jacqueline Kennedy Onassis\", \"Jackie o\", \"Jacqueline Onassis\", \"Jackie Bouvier Kennedy Onassis\", \"Jacqueline Lee Kennedy\", \"Jackie Bouvier Kennedy\", \"Jackieo\", \"Mrs. Kennedy\", \"Jacquelyn Kennedy\", \"Jacqueline Kennedy-Onassis\", \"Jacky O\", \"Jackie-O\", \"Arabella Kennedy\", \"Jackie Kennedy\", \"Jackeline Bouvier Kennedy\", \"Jacqueline Lee Bouvier Kennedy Onassis\", \"Jacqueline Bouvier Onassis\", \"Jacqueline Bouvier\", \"Jacqueline Kennedy\", \"Jacky o\", \"Jacqueline Bouvier Kennedy Onassis\", \"Jacqueline Kennedy Onassis\"]", "[\"Rifkah\", \"Rifko\", \"Rifka\", \"Rifkoh\", \"Ribhqah\", \"Rivqah\", \"Rebeccah\", \"Rebekah\", \"Rivqa\", \"Rivko\", \"Rivka\", \"Rebbecca\", \"Rebecca\", \"Rivkoh\"]", "[\"Bone lining cell\", \"Woven vs. lamellar bone\", \"Osseous\", \"Compact Bone\", \"A bone\", \"Woven bone\", \"BONES\", \"Bone\", \"Lamellar bone\", \"Bones\", \"Bone development\", \"Bone (Human Anatomy)\", \"Five funtions of bones\", \"Bone and bones\"]", "[\"Martin Creed\", \"Lights going on and off\", \"The lights going on and off\"]", "[\"Sleeping-Sickness\", \"Sleeping sickness (disambiguation)\", \"Sleeping Sickness\", \"'SLEEPING SICKNESS'\", \"Sleeping sickness\", \"Sleep illness\"]", "[\"Beast of Bolsover\", \"Dennis Edward Skinner\", \"Denis Skinner\", \"Dennis Skinner\"]", "[\"Elbows\", \"Elbow Joint\", \"Carrying angle\", \"Cubital angle\", \"Elbow examination\", \"Elbow-joint\", \"Elbow joint\", \"Anconal\", \"Elbow\", \"Cubital joint\", \"Articulatio cubiti\"]", "[\"Red Cross\", \"RED CROSS\", \"The Jordan Red Crescent\", \"Red Cross and Red Crescent Movement\", \"Red Cross and Red Crescent\", \"American Red Crescent Movement\", \"Red Cross Movement\", \"Red crescent\", \"International Red Cross Committee\", \"Jordan Red Crescent\", \"International Red Crescent\", \"International Red Cross and Red Crescent Movement\", \"The International Red Cross and Red Crescent\", \"Red Crescent\", \"Red Crescent Movement\", \"Fundamental Principles of the International Red Cross and Red Crescent Movement\", \"Red Cross or Red Crescent\", \"International Conference of the Red Cross and Red Crescent\", \"International Federation of the Red Cross\", \"International Federation of Red Cross\", \"Red Cross of North Korea\", \"Red crescent society\", \"The Red Crescent\", \"Red cross\", \"Red Crescent Society\", \"Red cresent\", \"Red Crescent Societies\", \"International Federation of Red Cross and Red Crescent\", \"Red Cross movement\", \"International Red Cross & Red Crescent Movement\", \"International Red Cross and Red Crescent\", \"Red Cross Socieites\"]", "[\"Pa\\u0159\\u00ed\\u017e\", \"FRPAR\", \"Paris\", \"Name of paris and its inhabitants\", \"Paname\", \"Paris France\", \"Ville Lumi\\u00e8re\", \"Leucetia\", \"Rue de M\\u00e9nilmontant\", \"Paris agglomeration\", \"France Paris\", \"Sports in Paris\", \"Departement de Paris\", \"Paris, Ile-De-France\", \"Rue de Menilmontant\", \"UN/LOCODE:FRPAR\", \"Pa\\u0159\\u00ed\\u017ei\", \"Ville Lumiere\", \"Paris, France\", \"Paris, \\u00cele-de-France\", \"Paris, \\u00cele-de-France, France\", \"Parijs\", \"Parisien\", \"Cuisine of Paris\", \"Suburbs of Paris\", \"Sport in Paris\", \"The weather in Paris\", \"Parisian (person)\", \"Parizi\", \"Par\\u00eds\", \"Name of Paris and its inhabitants\", \"Paree\", \"Paris, Europe\", \"Paris, Banks of the Seine\", \"Paris (etymology)\", \"Paris (France)\", \"The City of Love (city)\", \"D\\u00e9partement de Paris\"]", "[\"The Subway\", \"Subway (disambiguation)\", \"Subwya\", \"Subways\", \"Subway\"]" ]
[ "What was patented in London by Ralph Wedgewood in 1806?", "\"Which country is nicknamed \"\"The Land of The Thousand Lakes\"\"?\"", "Which 1940 film was the first commercial film to be shown in stereophonic sound?", "What sport is associated with Vladimir Putin, the second President of the Russian Federation?", "In what card game does a player ask his opponent for one of his or her cards of a particular rank, drawing a card from the pool if the opponent has none?", "Who famously wore a pink Chanel suit and matching pillbox hat?", "\"\"\"Last night I dreamt I went to Manderley again,\"\" was the first line of what Daphne du Maurier novel?\"", "According to the nursery rhyme, what did Old Mother Hubbard go to the cupboard to fetch?", "In 2001 Martin Creed notoriously won the Turner Prize, for an installation consisting of an empty room, with what happening every five seconds?", "'Economo's Disease', or 'Trypanosomiasis' is better known as what?", "In British politics, who had the nickname ‘The Beast of Bolsover’?", "The humerus, paired radius, and ulna come together to form what joint?", "Which international relief agency, formed in 1863, has it's headquarters at 17, Avenue de la Paix, Geneva?", "According to Greek mythology who killed Achilles by shooting him in the heel with a poisoned arrow?", "Jared Fogle became a spokesperson for what fast food chain, following his dramatic weight loss by eating their products?" ]
15
[ 55620, 55621, 55622, 55623, 55624, 55625, 55626, 55627, 55628, 55629, 55630, 55631, 55632, 55633, 55634 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: 'Prog Rock' developed in the late 60's and early 70's. For what word is 'Prog' a short version?\nQuestion 2: Which NASA space shuttle was lost after exploding 73 seconds after lift off in 1986?\nQuestion 3: For which Formula One team do Roman Grosjean and Pastor Maldonado drive?\nQuestion 4: Who had a 70s No 1 hit with The Night Chicago Died?\nQuestion 5: What is the name of Captain Mainwaring's wife\nQuestion 6: Which African country replaced most of its senior police officers after they were blamed for post-election violence?\nQuestion 7: What is the capital of Suriname?\nQuestion 8: What is the most northerly county of the Irish Republic?\nQuestion 9: What is added to steel to make stainless steel?\nQuestion 10: What country had massive student and worker protests in May of 1968?\nQuestion 11: Who plays the part of Sergeant Hathaway in ITV's detective series 'Lewis'?\nQuestion 12: What country suffered the most deaths from the 2004 tsunami?\nQuestion 13: How many times has cricket been an Olympic sport?\nQuestion 14: What is the capital of The Lebanon\nQuestion 15: Which novel introduced the bully Harry Flashman", "role": "user" } ]
["[\"Progressive Magazine\", \"PROGRESSIVE\", \"The Progressive\", \"La Follette\\u2019s Weekly Magazine\", \"La Follette's Weekly Magazine\", \"LaFollette's Magazine\", \"Progressive (magazine)\"]", "[\"Challenger\", \"Challengers\", \"Challengers (disambiguation)\", \"Challenger (album)\", \"Challenger (disambiguation)\"]", "[\"Lotus\", \"The lotus\", \"Lotus leaf\", \"Lotus (band)\", \"LOTUS\", \"Lotus (disambiguation)\", \"Lotus (album)\", \"Lotus (Album)\"]", "[\"Paper Lace\", \"Cliff Fish\"]", "[\"Elizabet\", \"Elizabeth\", \"Elizabeth (city, United States)\", \"Elishava\", \"\\u00c9lisabeth\", \"Elizabeta\", \"Elisabeth\", \"Elishebha\", \"Babeth\", \"Elizabeth (disambiguation)\", \"Elishabha\", \"Elishaba\", \"Elizabeta (disambiguation)\", \"Elisabeth (disambiguation)\"]", "[\"Kenyan\", \"Prehistory of Kenya\", \"Kenya-Africa\", \"ISO 3166-1:KE\", \"Jamhuri ya Kenya\", \"Kenya\", \"Republic of Kenya\", \"Kenya (disambiguation)\", \"Etymology of Kenya\"]", "[\"America/Paramaribo\", \"Paramabibo\", \"Parbo\", \"Paramaribo, Surinam\", \"Capital of Suriname\", \"Paramaribo\", \"Paramaribo, Suriname\"]", "[\"Donegall\", \"County Tyrconnel\", \"County Donegal\", \"Donegal County\", \"County Tyrconnell\", \"County of Donegal\", \"Co. Donegal\", \"Co Donegal\", \"D\\u00fan na nGall (county)\", \"Freedom of Donegal\", \"County Donegal, Ireland\", \"Freedom of donegal\"]", "[\"Chromium compounds\", \"Chromium(III)\", \"Chromium (element)\", \"Element 24\", \"Dichromium\", \"Cromium\", \"Chromium\", \"Chronium\"]", "[\"La Republique francaise\", \"Franciaorsz\\u00e1g\", \"La Republique fran\\u00e7aise\", \"Belle France\", \"FRANCE\", \"Republique fran\\u00e7aise\", \"France\", \"Ranska\", \"Franciaorszag\", \"French Republic\", \"R\\u00e9publique francaise\", \"R\\u00e9publique fran\\u00e7aise\", \"ISO 3166-1:FR\", \"Frankreich\", \"France (country)\", \"Etymology of France\", \"FrancE\", \"La R\\u00e9publique fran\\u00e7aise\", \"People of France\", \"Republic of France\", \"Fracne\", \"Le France\", \"The French Republic\", \"Republique francaise\", \"The Republic of France\", \"La R\\u00e9publique francaise\", \"La France\", \"Rain in France\", \"Republic of france\", \"FRance\", \"Frakkland\", \"Climate of France\", \"Franse\"]", "[\"Lawrence Fox\", \"LAWRENCE FOX\", \"Laurence Fox\"]", "[\"Unitary state of republic of indonesia\", \"Indonesian Republic\", \"INDONESIA\", \"ISO 3166-1:ID\", \"The world's most populous Muslim nation\", \"Unitary State of Republic of Indonesia\", \"Indonezio\", \"Wildlife of Indonesia\", \"Indonnesia\", \"Indoneshia\", \"Etymology of Indonesia\", \"Republic of Indonesia\", \"Indonesia, Republic of\", \"Unitary State of the Republic of Indonesia\", \"Indonesia\", \"Indonesie\", \"Indonesian government\", \"Ecology of Indonesia\", \"Indnonesia\", \"Republic Of Indonesia\", \"Unitary state of the republic of indonesia\", \"Indonesian Empire\", \"Indon\\u00e9sie\", \"Indonisia\", \"Republik Indonesia\"]", "[\"1\", \"one\"]", "[\"Beyreuth\", \"Beiro\\u00fbt\", \"Beroth\", \"Pigeon's Rock\", \"Beirut VI\", \"Minet el Hosn\", \"Byblos Cinema\", \"West Beirut\", \"Laodicea in Phoenicia\", \"Bayrut\", \"\\u0628\\u064a\\u0631\\u0648\\u062a\", \"Bayr\\u00fbt\", \"Beirut\", \"Beirut west\", \"Biruta\", \"Western Beirut\", \"Bkirki\", \"Beiruit\", \"Um el Khatib\", \"Plateau Tabet\", \"Rmeil\", \"Beirut V\", \"Furn esh Shebbak\", \"Beruit\", \"Beirut, Lebanon\", \"Beyrut\", \"Bayr\\u016bt\", \"Paris of the Middle East\", \"West Beirut lebanon\", \"Beyrout\", \"Beirut IV\", \"Capital of Lebanon\", \"East beirut\", \"BEIRUT\", \"Bairut\", \"Galerie Semaan\", \"Beirut District\", \"Furn esh Shebbak (river banks)\", \"Beirut VII\", \"Beirute\", \"Beiruth\", \"Beiruti\", \"Beyrouth\", \"Asia/Beirut\", \"East Beirut\"]", "[\"Tom Brown's Schol Days\", \"Tom Brown's School Days\", \"Tom Browns schooldays\", \"Tom Brown's Schooldays\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Progressive Magazine\", \"PROGRESSIVE\", \"The Progressive\", \"La Follette\\u2019s Weekly Magazine\", \"La Follette's Weekly Magazine\", \"LaFollette's Magazine\", \"Progressive (magazine)\"]", "[\"Challenger\", \"Challengers\", \"Challengers (disambiguation)\", \"Challenger (album)\", \"Challenger (disambiguation)\"]", "[\"Lotus\", \"The lotus\", \"Lotus leaf\", \"Lotus (band)\", \"LOTUS\", \"Lotus (disambiguation)\", \"Lotus (album)\", \"Lotus (Album)\"]", "[\"Paper Lace\", \"Cliff Fish\"]", "[\"Elizabet\", \"Elizabeth\", \"Elizabeth (city, United States)\", \"Elishava\", \"\\u00c9lisabeth\", \"Elizabeta\", \"Elisabeth\", \"Elishebha\", \"Babeth\", \"Elizabeth (disambiguation)\", \"Elishabha\", \"Elishaba\", \"Elizabeta (disambiguation)\", \"Elisabeth (disambiguation)\"]", "[\"Kenyan\", \"Prehistory of Kenya\", \"Kenya-Africa\", \"ISO 3166-1:KE\", \"Jamhuri ya Kenya\", \"Kenya\", \"Republic of Kenya\", \"Kenya (disambiguation)\", \"Etymology of Kenya\"]", "[\"America/Paramaribo\", \"Paramabibo\", \"Parbo\", \"Paramaribo, Surinam\", \"Capital of Suriname\", \"Paramaribo\", \"Paramaribo, Suriname\"]", "[\"Donegall\", \"County Tyrconnel\", \"County Donegal\", \"Donegal County\", \"County Tyrconnell\", \"County of Donegal\", \"Co. Donegal\", \"Co Donegal\", \"D\\u00fan na nGall (county)\", \"Freedom of Donegal\", \"County Donegal, Ireland\", \"Freedom of donegal\"]", "[\"Chromium compounds\", \"Chromium(III)\", \"Chromium (element)\", \"Element 24\", \"Dichromium\", \"Cromium\", \"Chromium\", \"Chronium\"]", "[\"La Republique francaise\", \"Franciaorsz\\u00e1g\", \"La Republique fran\\u00e7aise\", \"Belle France\", \"FRANCE\", \"Republique fran\\u00e7aise\", \"France\", \"Ranska\", \"Franciaorszag\", \"French Republic\", \"R\\u00e9publique francaise\", \"R\\u00e9publique fran\\u00e7aise\", \"ISO 3166-1:FR\", \"Frankreich\", \"France (country)\", \"Etymology of France\", \"FrancE\", \"La R\\u00e9publique fran\\u00e7aise\", \"People of France\", \"Republic of France\", \"Fracne\", \"Le France\", \"The French Republic\", \"Republique francaise\", \"The Republic of France\", \"La R\\u00e9publique francaise\", \"La France\", \"Rain in France\", \"Republic of france\", \"FRance\", \"Frakkland\", \"Climate of France\", \"Franse\"]", "[\"Lawrence Fox\", \"LAWRENCE FOX\", \"Laurence Fox\"]", "[\"Unitary state of republic of indonesia\", \"Indonesian Republic\", \"INDONESIA\", \"ISO 3166-1:ID\", \"The world's most populous Muslim nation\", \"Unitary State of Republic of Indonesia\", \"Indonezio\", \"Wildlife of Indonesia\", \"Indonnesia\", \"Indoneshia\", \"Etymology of Indonesia\", \"Republic of Indonesia\", \"Indonesia, Republic of\", \"Unitary State of the Republic of Indonesia\", \"Indonesia\", \"Indonesie\", \"Indonesian government\", \"Ecology of Indonesia\", \"Indnonesia\", \"Republic Of Indonesia\", \"Unitary state of the republic of indonesia\", \"Indonesian Empire\", \"Indon\\u00e9sie\", \"Indonisia\", \"Republik Indonesia\"]", "[\"1\", \"one\"]", "[\"Beyreuth\", \"Beiro\\u00fbt\", \"Beroth\", \"Pigeon's Rock\", \"Beirut VI\", \"Minet el Hosn\", \"Byblos Cinema\", \"West Beirut\", \"Laodicea in Phoenicia\", \"Bayrut\", \"\\u0628\\u064a\\u0631\\u0648\\u062a\", \"Bayr\\u00fbt\", \"Beirut\", \"Beirut west\", \"Biruta\", \"Western Beirut\", \"Bkirki\", \"Beiruit\", \"Um el Khatib\", \"Plateau Tabet\", \"Rmeil\", \"Beirut V\", \"Furn esh Shebbak\", \"Beruit\", \"Beirut, Lebanon\", \"Beyrut\", \"Bayr\\u016bt\", \"Paris of the Middle East\", \"West Beirut lebanon\", \"Beyrout\", \"Beirut IV\", \"Capital of Lebanon\", \"East beirut\", \"BEIRUT\", \"Bairut\", \"Galerie Semaan\", \"Beirut District\", \"Furn esh Shebbak (river banks)\", \"Beirut VII\", \"Beirute\", \"Beiruth\", \"Beiruti\", \"Beyrouth\", \"Asia/Beirut\", \"East Beirut\"]", "[\"Tom Brown's Schol Days\", \"Tom Brown's School Days\", \"Tom Browns schooldays\", \"Tom Brown's Schooldays\"]" ]
[ "'Prog Rock' developed in the late 60's and early 70's. For what word is 'Prog' a short version?", "Which NASA space shuttle was lost after exploding 73 seconds after lift off in 1986?", "For which Formula One team do Roman Grosjean and Pastor Maldonado drive?", "Who had a 70s No 1 hit with The Night Chicago Died?", "What is the name of Captain Mainwaring's wife", "Which African country replaced most of its senior police officers after they were blamed for post-election violence?", "What is the capital of Suriname?", "What is the most northerly county of the Irish Republic?", "What is added to steel to make stainless steel?", "What country had massive student and worker protests in May of 1968?", "Who plays the part of Sergeant Hathaway in ITV's detective series 'Lewis'?", "What country suffered the most deaths from the 2004 tsunami?", "How many times has cricket been an Olympic sport?", "What is the capital of The Lebanon", "Which novel introduced the bully Harry Flashman" ]
15
[ 98550, 98551, 98552, 98553, 98554, 98555, 98556, 98557, 98558, 98559, 98560, 98561, 98562, 98563, 98564 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: 'An Unearthly Child' was the first episode of which TV series?\nQuestion 2: Which capital city is known to its inhabitants as Lefkosia?\nQuestion 3: Who was kidnapped from the Colby's by a UFO and later turned up in Dynasty\nQuestion 4: What country is due north of Hawaii?\nQuestion 5: \"The long-running murder mystery play, \"\"The Mousetrap\"\" by Agatha Christie, was developed from an earlier radio play by the same author called what?\"\nQuestion 6: What trade did the Dutch East India Company dominate in 17th and 18th centuries?\nQuestion 7: Known as the Father of Western Medicine, Hippocrates was born on which Greek island?\nQuestion 8: What artist lost an ear?\nQuestion 9: The English National Opera is resident in which London theatre?\nQuestion 10: What is the capital of Thailand\nQuestion 11: \"The song, \"\"Food, Glorious Food\"\" comes from which musical?\"\nQuestion 12: At which weight did both Randolph Turpin and Nigel Benn win boxing world titles?\nQuestion 13: What plant provides the raw material for linen?\nQuestion 14: Blenheim Palace is in which English county?\nQuestion 15: From which wood are castanets traditionally made?", "role": "user" } ]
["[\"Dr Who\", \"Doctor Who Legacy\", \"Anna Zhou\", \"Nightmare child\", \"Doctor Who New Series\", \"Doc. Who\", \"Dr.Who\", \"Doctor Who\", \"The Doctor and Rose\", \"The Doctor (nickname)\", \"DoctorWho\", \"Dr who\", \"Doc Who\", \"Doctor Who%3F\", \"Doctor Who: Legacy\", \"Doctor Who classic series\", \"Who doctor\", \"Doc who characters\", \"Doctor Who series\", \"Doctor Who \\u2013 The New Series\", \"Doctorwho\", \"Dr w\", \"Doctor Roo\", \"Docter Who\", \"Dr. Who Novels\", \"Brian Minchin\", \"Drwho\", \"Dr. Who\", \"Dr Who%3F\", \"Doctor Who new series\", \"Class (2016 TV series)\", \"New Who\", \"Doctor Who Glossary of Terms and Names\", \"Dr. Who Books\", \"DrWho\", \"Doctor who characters\", \"Doctor Who - The New Series\", \"Doctor Who (new series)\", \"Doctor who\", \"The doctor and Rose\", \"Archangel Network\", \"The Child (Doctor Who audio)\", \"Doctor Who (TV series)\"]", "[\"Lefkosha\", \"Lefko\\u015fa\", \"Leukosia\", \"Capital of Cyprus\", \"Lefkosa\", \"LefkoAYa\", \"Nicosia, Cyprus\", \"Levkosia\", \"Transport in Nicosia\", \"UN/LOCODE:CYNIC\", \"Asia/Nicosia\", \"Nicosia, Republic of Cyprus\", \"Nicosia\", \"Nikosia\", \"Lefko\\u0219a\", \"Lefk\\u00f2sia\", \"Levk\\u00f2sia\", \"Lefkosia\", \"Lefko\\u00c5\\u0178a\", \"Europe/Nicosia\"]", "[\"Fallon\", \"Fallon (disambiguation)\"]", "[\"The United States of America\", \"United States Of Amerca\", \"Us of a\", \"U.\\u2013S.\\u2013A.\", \"Americaland\", \"United States (U.S.A.)\", \"Amurika\", \"Unite states of america\", \"United States of America (redirect)\", \"The U S A\", \"Unietd States\", \"EE UU\", \"The U.S.A.\", \"U.-S.-A.\", \"Usa\", \"United Staets of America\", \"Unites States\", \"\\u00c9tats-Unis d'Am\\u00e9rique\", \"Verenigde State\", \"U.\\u2013S.\", \"The United States of America.\", \"The U-S-A\", \"EEUU\", \"U. S. A.\", \"Nagkaisang mga Estado\", \"The U. S. of America\", \"The USA\", \"America (United States)\", \"The U. S. A.\", \"U S of America\", \"UNITED STATES\", \"Estados Unidos\", \"The U\\u2013S\", \"American United States\", \"US and A\", \"Unitd states\", \"The US of A\", \"EE.UU.\", \"U-S\", \"The U-S\", \"Etymology of the United States\", \"U.S.A.)\", \"EE. UU.\", \"United states of america\", \"US of america\", \"Verenigde State van Amerika\", \"Nited States\", \"United-States\", \"Unite States\", \"Estados Unidos de Am\\u00e9rica\", \"UnitedStates\", \"Estaos Unios\", \"US of America\", \"The Usa\", \"United states of America\", \"Untied States of America\", \"The U S of America\", \"THE AMERICAN UNITED STATES\", \"The United-States\", \"U S A\", \"AmericA\", \"Estados Unidos de America\", \"United states\", \"The U.S. of America\", \"Amerka\", \"United\\u2013States\", \"U.s.a.\", \"United States of America\", \"United State of America\", \"United States (US)\", \"The U.S. of A\", \"America\", \"Amercia\", \"Stati Uniti d'America\", \"Los Estados Unidos de America\", \"United Stated\", \"U.S.\", \"United States (of America)\", \"United States\", \"States of America\", \"America-class\", \"Los Estados Unidos\", \"U,S,\", \"United States (country)\", \"Federal United States\", \"ISO 3166-1:US\", \"Untied States\", \"The U.\\u2013S.\\u2013A.\", \"VS America\", \"Amurica\", \"Etats-Unis d'Amerique\", \"US\", \"U.S. OF A\", \"USofA\", \"Etats-Unis\", \"U.S. of A\", \"United States of America (U.S.A.)\", \"Amarica\", \"The United States\", \"U-S-A\", \"United States/Introduction\", \"The Us\", \"Unitesd states\", \"The U S of A\", \"America class\", \"America magazine\", \"\\u0627\\u0644\\u0648\\u0644\\u0627\\u064a\\u0627\\u062a \\u0627\\u0644\\u0645\\u062a\\u062d\\u062f\\u0629 \\u0627\\u0644\\u0623\\u0645\\u0631\\u064a\\u0643\\u064a\\u0629\", \"The U. S. of A\", \"U S\", \"(USA)\", \"The United\\u2013States\", \"United States (U.S.)\", \"U.-S.\", \"United States of America (USA)\", \"'merica\", \"The US\", \"United States of America.\", \"UNited States\", \"The U.S.\", \"AMERICA\", \"United States of America/OldPage\", \"United+States\", \"The U S\", \"United Sates\", \"THE UNITED STATES OF AMERICA\", \"U\\u2013S\\u2013A\", \"United States Of America\", \"U.S. of America\", \"U\\u2013S\", \"Los Estados Unidos de Am\\u00e9rica\", \"The U.-S.\", \"United sates\", \"The United States Of America\", \"America (country)\", \"United States of American\", \"United state of america\", \"The U.\\u2013S.\", \"Amurka\", \"U. S. of A\", \"The U. S.\", \"United States America\", \"US of A\", \"\\u00c9tats-Unis\", \"USoA\", \"USA\", \"Estaos Un\\u00edos\", \"America, United States of\", \"U. S. of America\", \"U.S.American\", \"(US)\", \"The U\\u2013S\\u2013A\", \"U. S.\", \"U.S. America\", \"U.S. A\", \"Yankee land\", \"America (US)\", \"U.S\", \"America (United States of)\", \"US (country)\", \"UNITED STATES OF AMERICA\", \"U.S.A\", \"Estados unidos\", \"Americia\", \"The US of america\", \"Vereinigte Staaten\", \"US America\", \"These United States of America\", \"VS Amerika\", \"Name of the United States\", \"The united states of america\", \"Estatos Unitos\", \"America (USA)\", \"The U.-S.-A.\", \"United States of America/Introduction\", \"The US of America\", \"Americophile\", \"V.S. America\", \"U.S.A.\", \"U S of A\", \"V.S. Amerika\", \"United+States+of+America\", \"The Unites States of America\"]", "[\"Three Blinde Mice\", \"3 blind mice\", \"Three Blind Mice\", \"The Three Blind Mice\"]", "[\"Spicier\", \"Spicing\", \"Spicedly\", \"Spice rack\", \"Spiced\", \"Spice\", \"Spicy food\", \"Spices\", \"Spicingly\"]", "[\"Cos (disambiguation)\", \"Cos\", \"CoS\", \"COS (disambiguation)\"]", "[\"Vincent Willem Van Gogh\", \"Vincent van Gogh\", \"Vincent VanGogh\", \"Vangogh\", \"Van Gogh's ear\", \"Van go\", \"Vincent Van Gogh\", \"Vincent Willem van Gogh\", \"Vincent van Gogh's ear\", \"Van Goth\", \"Van Gough\", \"Vince Van Gogh\", \"Van Gogh\", \"Vince van Gogh\", \"Vincent Van Goth\", \"Vincent van gogh\", \"Van goh\", \"Vincent Van Gough\", \"Van Goh\", \"Vincent Van gough\"]", "[\"Colliseum\", \"Colosseum, Italy\", \"Coliseum\", \"Flavian amphitheatre\", \"Colosseum in Rome\", \"Flavius amphitheatre\", \"Flavian amphitheater\", \"Flavian Ampitheatre\", \"Collosseum\", \"COLISEUM\", \"Colosseum - 9/5/05\", \"Colosseo\", \"Collusem\", \"Vespasian Amphitheatre\", \"Collosium\", \"Colisseum\", \"Roman Coliseum\", \"Anfiteatro Flavio\", \"Roman Colosseum\", \"Rome Colosseum\", \"Coliseum (Rome)\", \"Amphitheatrum Flavium\", \"The Roman Colosseum\", \"The Coliseum of Rome\", \"Coliseum (theatre)\", \"The Colosseum\", \"Colloseum\", \"Coloseum\", \"Flavian Amphitheatre\", \"Flavian Ampitheater\", \"The Coliseum\", \"Colosseum\", \"Flavian Amphitheater\"]", "[\"Krung-devamahanagara amararatanakosindra mahindrayudhya mahatilakabhava navaratanarajadhani puriramasya utamarajanivesana mahasthana amaravimana avatarasthitya shakrasdattiya vishnukarmaprasiddhi\", \"Capital of Thailand\", \"Bangkok Bus\", \"Bangkok Special Governed District\", \"Bangkok Province\", \"KrungThepMahaNakhon\", \"Krung Thep Municipality, Thailand\", \"Bangkok province\", \"Bangkock\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharn\", \"Bangkok/weatherbox\", \"Krungthep Mahanakhon Amonrattanakosin Mahintharayutthaya Mahadilokphop Noppharatratchathani Burirom-udomratchaniwet Mahasathan Amonphiman Awatansathit Sakkathattiya Witsanu Kamprasit\", \"Bangkok, Thailand\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop nopparatrajathaniburiromudomrajaniwesmahasatharn amornphimarnavatarnsathitsakkattiyavisanukamprasit\", \"Bangkok\", \"UN/LOCODE:THBKK\", \"Krung Thep Mahanakhon Province, Thailand\", \"Krung Thep municipality, Thailand\", \"\\u0e01\\u0e23\\u0e38\\u0e07\\u0e40\\u0e17\\u0e1e\\u0e21\\u0e2b\\u0e32\\u0e19\\u0e04\\u0e23\", \"Krung Thep Mahanakhon Amon Rattanakosin Mahinthara Ayuthaya Mahadilok Phop Noppharat Ratchathani Burirom Udomratchaniwet Mahasathan Amon Piman Awatan Sathit Sakkathattiya Witsanukam Prasit\", \"Krungthepmahanakhon Amonrattanakosin Mahintharayutthaya Mahadilokphop Noppharatratchathaniburirom Udomratchaniwetmahasathan Amonphimanawatansathit Sakkathattiyawitsanukamprasit\", \"Krung Thep Maha Nakhon\", \"Culture of Bangkok\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimar- navatarnsathitsakkattiyavisanukamprasit\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit\", \"Bangcock\", \"Buses in bangkok\", \"Krung thep mahanakhon bovorn ratanakosin mahintharayutthaya mahadilok pop noparatratchathani burirom udomratchanivetmahasathan amornpiman avatarnsathit sakkathattiyavisnukarmprasit\", \"Krung-d\\u0113vamah\\u0101nagara amararatanakosindra mahindrayudhy\\u0101 mah\\u0101tilakabhava navaratanar\\u0101jadh\\u0101n\\u012b pur\\u012br\\u0101masya utamar\\u0101janiv\\u0113sana mah\\u0101sth\\u0101na amaravim\\u0101na avat\\u0101rasthitya shakrasdattiya vishnukarmaprasiddhi\", \"Krungthep mahanakhon amon rattanakosin mahintara ayuthaya mahadilok popnopparat ratchathani burirom udomratchaniwet mahasathan amonpiman avatansathit sakkathattiya visnukamprasit\", \"Krung Thep Mahanakhon Amon Rattanakosin Mahinthara Yuthaya Mahadilok Phop Noppharat Ratchathani Burirom Udomratchaniwet Mahasathan Amon Piman Awatan Sathit Sakkathattiya Witsanukam Prasit\", \"Krung Thep municipality\", \"Bankok\", \"Bang Makok\", \"Krungthepmahanakornamornratanakosinmahintarayutth...\", \"Krung Thep Maha Nakhon Amon Rattanakosin Mahinthara Ayutthaya Mahadilok Phop Noppharat Ratchathani Burirom Udom Ratchaniwet Mahasathan Amon Phiman Awatan Sathit Sakkathattiya Witsanu Kamprasit\"]", "[\"Oliver (disambiguation)\", \"Oliver\", \"'OLIVER'\"]", "[\"MIDDLEWEIGHT\", \"Middle-weight\", \"Middleweight\"]", "[\"Linseed meal\", \"ATCvet code QA06AC05\", \"Linum usitatissimum L.\", \"Flax seed\", \"Flaxseed meal\", \"Alsi\", \"Flaxseeds\", \"Flax\", \"Ground flaxseed\", \"Flax Lignans\", \"Lineseed\", \"Common Flax\", \"Linseed\", \"Javas\", \"Common flax\", \"Flax seeds\", \"Flaxseed\", \"Flaxes\", \"Linum usitatissimum\", \"ATC code A06AC05\"]", "[\"Oxon, England\", \"Oxfordshire\", \"Oxon England\", \"List of settlements in Oxfordshire by population\", \"Oxfordshire, England\", \"County of Oxford\", \"Oxfordshire County Hall\", \"List of oxfordshire towns by population\", \"Oxfordshire (England)\", \"List of Oxfordshire towns by population\", \"List of Oxfordshire settlements by population\"]", "[\"Chestnut\", \"Culture of chestnut\", \"Chestnuts\", \"Chincapin\", \"Chesnut wood\", \"Castanea (plant)\", \"Chestnut tree\", \"\\ud83c\\udf30\", \"Castanea species\", \"Castanea (genus)\", \"Chestnut wood\", \"Chesnut\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Dr Who\", \"Doctor Who Legacy\", \"Anna Zhou\", \"Nightmare child\", \"Doctor Who New Series\", \"Doc. Who\", \"Dr.Who\", \"Doctor Who\", \"The Doctor and Rose\", \"The Doctor (nickname)\", \"DoctorWho\", \"Dr who\", \"Doc Who\", \"Doctor Who%3F\", \"Doctor Who: Legacy\", \"Doctor Who classic series\", \"Who doctor\", \"Doc who characters\", \"Doctor Who series\", \"Doctor Who \\u2013 The New Series\", \"Doctorwho\", \"Dr w\", \"Doctor Roo\", \"Docter Who\", \"Dr. Who Novels\", \"Brian Minchin\", \"Drwho\", \"Dr. Who\", \"Dr Who%3F\", \"Doctor Who new series\", \"Class (2016 TV series)\", \"New Who\", \"Doctor Who Glossary of Terms and Names\", \"Dr. Who Books\", \"DrWho\", \"Doctor who characters\", \"Doctor Who - The New Series\", \"Doctor Who (new series)\", \"Doctor who\", \"The doctor and Rose\", \"Archangel Network\", \"The Child (Doctor Who audio)\", \"Doctor Who (TV series)\"]", "[\"Lefkosha\", \"Lefko\\u015fa\", \"Leukosia\", \"Capital of Cyprus\", \"Lefkosa\", \"LefkoAYa\", \"Nicosia, Cyprus\", \"Levkosia\", \"Transport in Nicosia\", \"UN/LOCODE:CYNIC\", \"Asia/Nicosia\", \"Nicosia, Republic of Cyprus\", \"Nicosia\", \"Nikosia\", \"Lefko\\u0219a\", \"Lefk\\u00f2sia\", \"Levk\\u00f2sia\", \"Lefkosia\", \"Lefko\\u00c5\\u0178a\", \"Europe/Nicosia\"]", "[\"Fallon\", \"Fallon (disambiguation)\"]", "[\"The United States of America\", \"United States Of Amerca\", \"Us of a\", \"U.\\u2013S.\\u2013A.\", \"Americaland\", \"United States (U.S.A.)\", \"Amurika\", \"Unite states of america\", \"United States of America (redirect)\", \"The U S A\", \"Unietd States\", \"EE UU\", \"The U.S.A.\", \"U.-S.-A.\", \"Usa\", \"United Staets of America\", \"Unites States\", \"\\u00c9tats-Unis d'Am\\u00e9rique\", \"Verenigde State\", \"U.\\u2013S.\", \"The United States of America.\", \"The U-S-A\", \"EEUU\", \"U. S. A.\", \"Nagkaisang mga Estado\", \"The U. S. of America\", \"The USA\", \"America (United States)\", \"The U. S. A.\", \"U S of America\", \"UNITED STATES\", \"Estados Unidos\", \"The U\\u2013S\", \"American United States\", \"US and A\", \"Unitd states\", \"The US of A\", \"EE.UU.\", \"U-S\", \"The U-S\", \"Etymology of the United States\", \"U.S.A.)\", \"EE. UU.\", \"United states of america\", \"US of america\", \"Verenigde State van Amerika\", \"Nited States\", \"United-States\", \"Unite States\", \"Estados Unidos de Am\\u00e9rica\", \"UnitedStates\", \"Estaos Unios\", \"US of America\", \"The Usa\", \"United states of America\", \"Untied States of America\", \"The U S of America\", \"THE AMERICAN UNITED STATES\", \"The United-States\", \"U S A\", \"AmericA\", \"Estados Unidos de America\", \"United states\", \"The U.S. of America\", \"Amerka\", \"United\\u2013States\", \"U.s.a.\", \"United States of America\", \"United State of America\", \"United States (US)\", \"The U.S. of A\", \"America\", \"Amercia\", \"Stati Uniti d'America\", \"Los Estados Unidos de America\", \"United Stated\", \"U.S.\", \"United States (of America)\", \"United States\", \"States of America\", \"America-class\", \"Los Estados Unidos\", \"U,S,\", \"United States (country)\", \"Federal United States\", \"ISO 3166-1:US\", \"Untied States\", \"The U.\\u2013S.\\u2013A.\", \"VS America\", \"Amurica\", \"Etats-Unis d'Amerique\", \"US\", \"U.S. OF A\", \"USofA\", \"Etats-Unis\", \"U.S. of A\", \"United States of America (U.S.A.)\", \"Amarica\", \"The United States\", \"U-S-A\", \"United States/Introduction\", \"The Us\", \"Unitesd states\", \"The U S of A\", \"America class\", \"America magazine\", \"\\u0627\\u0644\\u0648\\u0644\\u0627\\u064a\\u0627\\u062a \\u0627\\u0644\\u0645\\u062a\\u062d\\u062f\\u0629 \\u0627\\u0644\\u0623\\u0645\\u0631\\u064a\\u0643\\u064a\\u0629\", \"The U. S. of A\", \"U S\", \"(USA)\", \"The United\\u2013States\", \"United States (U.S.)\", \"U.-S.\", \"United States of America (USA)\", \"'merica\", \"The US\", \"United States of America.\", \"UNited States\", \"The U.S.\", \"AMERICA\", \"United States of America/OldPage\", \"United+States\", \"The U S\", \"United Sates\", \"THE UNITED STATES OF AMERICA\", \"U\\u2013S\\u2013A\", \"United States Of America\", \"U.S. of America\", \"U\\u2013S\", \"Los Estados Unidos de Am\\u00e9rica\", \"The U.-S.\", \"United sates\", \"The United States Of America\", \"America (country)\", \"United States of American\", \"United state of america\", \"The U.\\u2013S.\", \"Amurka\", \"U. S. of A\", \"The U. S.\", \"United States America\", \"US of A\", \"\\u00c9tats-Unis\", \"USoA\", \"USA\", \"Estaos Un\\u00edos\", \"America, United States of\", \"U. S. of America\", \"U.S.American\", \"(US)\", \"The U\\u2013S\\u2013A\", \"U. S.\", \"U.S. America\", \"U.S. A\", \"Yankee land\", \"America (US)\", \"U.S\", \"America (United States of)\", \"US (country)\", \"UNITED STATES OF AMERICA\", \"U.S.A\", \"Estados unidos\", \"Americia\", \"The US of america\", \"Vereinigte Staaten\", \"US America\", \"These United States of America\", \"VS Amerika\", \"Name of the United States\", \"The united states of america\", \"Estatos Unitos\", \"America (USA)\", \"The U.-S.-A.\", \"United States of America/Introduction\", \"The US of America\", \"Americophile\", \"V.S. America\", \"U.S.A.\", \"U S of A\", \"V.S. Amerika\", \"United+States+of+America\", \"The Unites States of America\"]", "[\"Three Blinde Mice\", \"3 blind mice\", \"Three Blind Mice\", \"The Three Blind Mice\"]", "[\"Spicier\", \"Spicing\", \"Spicedly\", \"Spice rack\", \"Spiced\", \"Spice\", \"Spicy food\", \"Spices\", \"Spicingly\"]", "[\"Cos (disambiguation)\", \"Cos\", \"CoS\", \"COS (disambiguation)\"]", "[\"Vincent Willem Van Gogh\", \"Vincent van Gogh\", \"Vincent VanGogh\", \"Vangogh\", \"Van Gogh's ear\", \"Van go\", \"Vincent Van Gogh\", \"Vincent Willem van Gogh\", \"Vincent van Gogh's ear\", \"Van Goth\", \"Van Gough\", \"Vince Van Gogh\", \"Van Gogh\", \"Vince van Gogh\", \"Vincent Van Goth\", \"Vincent van gogh\", \"Van goh\", \"Vincent Van Gough\", \"Van Goh\", \"Vincent Van gough\"]", "[\"Colliseum\", \"Colosseum, Italy\", \"Coliseum\", \"Flavian amphitheatre\", \"Colosseum in Rome\", \"Flavius amphitheatre\", \"Flavian amphitheater\", \"Flavian Ampitheatre\", \"Collosseum\", \"COLISEUM\", \"Colosseum - 9/5/05\", \"Colosseo\", \"Collusem\", \"Vespasian Amphitheatre\", \"Collosium\", \"Colisseum\", \"Roman Coliseum\", \"Anfiteatro Flavio\", \"Roman Colosseum\", \"Rome Colosseum\", \"Coliseum (Rome)\", \"Amphitheatrum Flavium\", \"The Roman Colosseum\", \"The Coliseum of Rome\", \"Coliseum (theatre)\", \"The Colosseum\", \"Colloseum\", \"Coloseum\", \"Flavian Amphitheatre\", \"Flavian Ampitheater\", \"The Coliseum\", \"Colosseum\", \"Flavian Amphitheater\"]", "[\"Krung-devamahanagara amararatanakosindra mahindrayudhya mahatilakabhava navaratanarajadhani puriramasya utamarajanivesana mahasthana amaravimana avatarasthitya shakrasdattiya vishnukarmaprasiddhi\", \"Capital of Thailand\", \"Bangkok Bus\", \"Bangkok Special Governed District\", \"Bangkok Province\", \"KrungThepMahaNakhon\", \"Krung Thep Municipality, Thailand\", \"Bangkok province\", \"Bangkock\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharn\", \"Bangkok/weatherbox\", \"Krungthep Mahanakhon Amonrattanakosin Mahintharayutthaya Mahadilokphop Noppharatratchathani Burirom-udomratchaniwet Mahasathan Amonphiman Awatansathit Sakkathattiya Witsanu Kamprasit\", \"Bangkok, Thailand\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop nopparatrajathaniburiromudomrajaniwesmahasatharn amornphimarnavatarnsathitsakkattiyavisanukamprasit\", \"Bangkok\", \"UN/LOCODE:THBKK\", \"Krung Thep Mahanakhon Province, Thailand\", \"Krung Thep municipality, Thailand\", \"\\u0e01\\u0e23\\u0e38\\u0e07\\u0e40\\u0e17\\u0e1e\\u0e21\\u0e2b\\u0e32\\u0e19\\u0e04\\u0e23\", \"Krung Thep Mahanakhon Amon Rattanakosin Mahinthara Ayuthaya Mahadilok Phop Noppharat Ratchathani Burirom Udomratchaniwet Mahasathan Amon Piman Awatan Sathit Sakkathattiya Witsanukam Prasit\", \"Krungthepmahanakhon Amonrattanakosin Mahintharayutthaya Mahadilokphop Noppharatratchathaniburirom Udomratchaniwetmahasathan Amonphimanawatansathit Sakkathattiyawitsanukamprasit\", \"Krung Thep Maha Nakhon\", \"Culture of Bangkok\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimar- navatarnsathitsakkattiyavisanukamprasit\", \"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit\", \"Bangcock\", \"Buses in bangkok\", \"Krung thep mahanakhon bovorn ratanakosin mahintharayutthaya mahadilok pop noparatratchathani burirom udomratchanivetmahasathan amornpiman avatarnsathit sakkathattiyavisnukarmprasit\", \"Krung-d\\u0113vamah\\u0101nagara amararatanakosindra mahindrayudhy\\u0101 mah\\u0101tilakabhava navaratanar\\u0101jadh\\u0101n\\u012b pur\\u012br\\u0101masya utamar\\u0101janiv\\u0113sana mah\\u0101sth\\u0101na amaravim\\u0101na avat\\u0101rasthitya shakrasdattiya vishnukarmaprasiddhi\", \"Krungthep mahanakhon amon rattanakosin mahintara ayuthaya mahadilok popnopparat ratchathani burirom udomratchaniwet mahasathan amonpiman avatansathit sakkathattiya visnukamprasit\", \"Krung Thep Mahanakhon Amon Rattanakosin Mahinthara Yuthaya Mahadilok Phop Noppharat Ratchathani Burirom Udomratchaniwet Mahasathan Amon Piman Awatan Sathit Sakkathattiya Witsanukam Prasit\", \"Krung Thep municipality\", \"Bankok\", \"Bang Makok\", \"Krungthepmahanakornamornratanakosinmahintarayutth...\", \"Krung Thep Maha Nakhon Amon Rattanakosin Mahinthara Ayutthaya Mahadilok Phop Noppharat Ratchathani Burirom Udom Ratchaniwet Mahasathan Amon Phiman Awatan Sathit Sakkathattiya Witsanu Kamprasit\"]", "[\"Oliver (disambiguation)\", \"Oliver\", \"'OLIVER'\"]", "[\"MIDDLEWEIGHT\", \"Middle-weight\", \"Middleweight\"]", "[\"Linseed meal\", \"ATCvet code QA06AC05\", \"Linum usitatissimum L.\", \"Flax seed\", \"Flaxseed meal\", \"Alsi\", \"Flaxseeds\", \"Flax\", \"Ground flaxseed\", \"Flax Lignans\", \"Lineseed\", \"Common Flax\", \"Linseed\", \"Javas\", \"Common flax\", \"Flax seeds\", \"Flaxseed\", \"Flaxes\", \"Linum usitatissimum\", \"ATC code A06AC05\"]", "[\"Oxon, England\", \"Oxfordshire\", \"Oxon England\", \"List of settlements in Oxfordshire by population\", \"Oxfordshire, England\", \"County of Oxford\", \"Oxfordshire County Hall\", \"List of oxfordshire towns by population\", \"Oxfordshire (England)\", \"List of Oxfordshire towns by population\", \"List of Oxfordshire settlements by population\"]", "[\"Chestnut\", \"Culture of chestnut\", \"Chestnuts\", \"Chincapin\", \"Chesnut wood\", \"Castanea (plant)\", \"Chestnut tree\", \"\\ud83c\\udf30\", \"Castanea species\", \"Castanea (genus)\", \"Chestnut wood\", \"Chesnut\"]" ]
[ "'An Unearthly Child' was the first episode of which TV series?", "Which capital city is known to its inhabitants as Lefkosia?", "Who was kidnapped from the Colby's by a UFO and later turned up in Dynasty", "What country is due north of Hawaii?", "\"The long-running murder mystery play, \"\"The Mousetrap\"\" by Agatha Christie, was developed from an earlier radio play by the same author called what?\"", "What trade did the Dutch East India Company dominate in 17th and 18th centuries?", "Known as the Father of Western Medicine, Hippocrates was born on which Greek island?", "What artist lost an ear?", "The English National Opera is resident in which London theatre?", "What is the capital of Thailand", "\"The song, \"\"Food, Glorious Food\"\" comes from which musical?\"", "At which weight did both Randolph Turpin and Nigel Benn win boxing world titles?", "What plant provides the raw material for linen?", "Blenheim Palace is in which English county?", "From which wood are castanets traditionally made?" ]
15
[ 102450, 102451, 102452, 102453, 102454, 102455, 102456, 102457, 102458, 102459, 102460, 102461, 102462, 102463, 102464 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which town in Suffolk is the most easterly point in England ?\nQuestion 2: Which country won the Eurovision Song Contest in 1992, 1993 and 1994?\nQuestion 3: Which Football League side was once known as Small Heath Alliance\nQuestion 4: Kosciuszko is the highest mountain in which Southern Hemisphere country?\nQuestion 5: English musician Ian Curtis, who died on 18th May 1980, was best known as lead singer of which post-punk band?\nQuestion 6: \"What was the name of the last surviving \"\"Tommy\"\", from World War I, who died in 2009, aged 111?\"\nQuestion 7: Who received the Nobel Prize for Physiology or Medicine in 1902 for his work on the transmission of malaria, becoming the first British Nobel laureate?\nQuestion 8: What was the occupation of Vaslav Nijinsky from 1908?\nQuestion 9: What type of leaf did US baseball player Babe Ruth wear under his cap to keep him cool?\nQuestion 10: According to legend, who fell asleep in the Catskill Mountains for 20 years, following a game of 9-pins with the ghosts of Henry Hudson's crew?\nQuestion 11: In the Bible to where was the Good Samaritan traveling?\nQuestion 12: Who won the 2011 Turner Prize for his installation 'Do Words Have Voices'?\nQuestion 13: Which of the Romantic Poets wrote 'The Revolt Of Islam'?\nQuestion 14: \"While most juries can only provide a verdict of \"\"Guilty\"\" or \"\"Not Guilty\"\", in which country can a jury decide \"\"Not Proven\"\"?\"\nQuestion 15: Who composed the opera ‘Peter Grimes’?", "role": "user" } ]
["[\"London Road North\", \"Lowestoft Lighthouse\", \"Belle Vue Park (Lowestoft)\", \"Sparrow's Nest\", \"Lowestoft Mayor\", \"The britten centre\", \"Lowestoft, Suffolk\", \"The Britten Centre\", \"Lowestoft\", \"LOWESTOFT\", \"London Road North Shopping Precinct\"]", "[\"Irlanda\", \"Island ireland\", \"Ireland (region)\", \"Irlandia\", \"Erin's Isle\", \"Airlan\", \"Ireland\", \"West Coast of Ireland\", \"The island of Ireland\", \"Island Ireland\", \"Ireland (island)\", \"Irland\", \"H\\u00c9ireann\", \"Ireland Ulster\", \"Population of Ireland\", \"Irelander\", \"Ireland and Ulster\", \"Ireland (Island)\", \"IRELAND\", \"Symbol of Ireland\", \"Scotia major\", \"Island of Ireland\", \"Airlann\", \"Mikra Britannia\", \"Irelanders\", \"Auld Sod\", \"Ierne (placename)\"]", "[\"Birmingham city managers\", \"Birmingham City F.C.\", \"Birmingham City F.C\", \"Birmingham Blues\", \"Birmingham City FC\", \"Birmingham City Football Club\", \"Birmingham City\", \"Birmingham F.C.\", \"Birmingham City Squad\", \"Birmingham FC\", \"Birmingham city fc\", \"Birmingham City F C\", \"Small Heath Alliance\", \"The Blues (Birmingham)\", \"Small Heath Football Club\", \"Birmingham City F. C.\", \"Small Heath F.C.\", \"Birmingham Football Club\"]", "[\"Australia (Commonwealth realm)\", \"AustraliA\", \"Continental Australia\", \"Australias\", \"Peace of Australia\", \"Australian city life\", \"City life in Australia\", \"Australocentrist\", \"Mainland Australia\", \"Australiia\", \"Straya\", \"Australia (commonwealth)\", \"Austraila\", \"Ausrtalia\", \"Australia (nation)\", \"Australien\", \"New Australian\", \"Australia (dominion)\", \"Australia (federation)\", \"Australia (country)\", \"Aussieland\", \"Federal Australia\", \"Country life in Australia\", \"Orstraya\", \"Australia (nation state)\", \"Australia (commonwealth realm)\", \"Australia\", \"Australocentrism\", \"Austraya\", \"Australie\", \"AUSTRALIA\", \"Geopolitics of Australia\", \"Australia (nation-state)\", \"Australia's\", \"Australian mainland\", \"Australian country life\", \"Australian Woman's Day\", \"Imperial Australia\", \"United States of Australia\", \"Australia (realm)\", \"Australia (constitutional monarchy)\", \"Austalia\", \"Etymology of Australia\", \"Philosophy in Australia\", \"Commonwealth of Australia\", \"Australija\", \"Australia (monarchy)\", \"Dominion of Australia\", \"Empire of Australia\", \"Ostralia\", \"Modern Australia\", \"Commonwealth of australia\", \"Australia (empire)\", \"Australo\", \"The Commonwealth of Australia\", \"Australia.\", \"Austrlia\", \"Australlia\", \"AUSTRALIAN\", \"Australia (state)\", \"ISO 3166-1:AU\", \"Austrailia\", \"Commonwealth Australia\", \"Pax Australiana\", \"Australian Commonwealth\", \"Australocentric\", \"Austrlaia\", \"Technology in Australia\", \"Australia (Commonwealth)\", \"Australai\", \"Australian geopolitics\", \"Asutralia\", \"Australo-\", \"Australian's\", \"Science in Australia\"]", "[\"The Stiff Kittens\", \"Joy Division\", \"Joy Division song list\", \"Joy Division/New Order\", \"Warsaw (band)\", \"Joy division\", \"Joy Division (band)\"]", "[\"Harry Patch\", \"HARRY PATCH\", \"Henry John Patch\"]", "[\"(Sir Ronald) Ross\", \"Sir Ronald Ross\", \"Ronald ross\", \"Ronald Ross\"]", "[\"Dancer and choreographer\"]", "[\"Cabbage leaf\"]", "[\"Rip van Winkle\", \"Rip van winkle\", \"Rip van Winkel\", \"Rip Wan Winkle\", \"Rip Van Winkle\", \"Rip Van winkle\"]", "[\"Medieval jericho\", \"Jericho, Palestine\", \"Jericho Area\", \"Jericho in the middle ages\", \"Jericho, West Bank City\", \"Classical jericho\", \"Jericho\", \"City of palms\", \"Jeriho\", \"Tel el-Sultan\", \"Tell el-Sultan\", \"Ancient jericho\", \"Jericho, West Bank\", \"Tell es-Sultan\", \"Jericho (town)\"]", "[\"MARTIN BOYCE\", \"Martin Boyce\"]", "[\"Percy Bysse Shelley\", \"Percy Byshe Shelley\", \"A Gentleman of the University of Oxford\", \"Percy Bysshe Shelley\", \"My Aunt Margaret Nicholson\", \"Bysshe\", \"PB shelley\", \"P.B. Shelley\", \"Percy Bysshe\", \"Percy Shelley\", \"Elena Adelaide Shelley\", \"A Gentleman of Oxford\", \"PERCY BYSSHE SHELLEY\", \"The Question (Shelley)\", \"Percy Bysshe Shelly\", \"Percy B. Shelley\", \"The Question (poem)\", \"P. B. Shelley\", \"Percy Shelly\"]", "[\"The Scottish Nation\", \"Scotlander\", \"Scotland\", \"Northern Great Britain\", \"Scot Land\", \"Scottland\", \"Scotlanders\", \"Scotland, UK\", \"Scotland's\", \"Scottish nation\", \"North Great Britain\", \"Autonomous Province of Scotland\", \"Scottish Nation\", \"Communications in Scotland\", \"Maps of scotland\", \"North of Great Britain\", \"Scotia minor\", \"Auld Country\", \"Scotchland\", \"H-Alba\", \"SCOTLAND\", \"East coast of Scotland\"]", "[\"Britten, Benjamin\", \"Benjamin, Baron Britten\", \"Edward Benjamin Britten\", \"Ballets by Benjamin Britten\", \"Britten\", \"Lord Britten\", \"Benjamin BRITTEN\", \"Edward Benjamin Britten, Baron Britten\", \"Baron Britten\", \"Baron Britten of Aldeburgh\", \"Britten, Benjamin, Baron\", \"Benjamin Britten\", \"Edward Benjamin Britten, Baron Britten OM CH\", \"Benjamin Britten, 1st Baron Britten\", \"Benjamen Britten\", \"E B Britten\", \"Benjamin Britten, Baron Britten\", \"Benjamin Britain\", \"Benjamin britten\", \"Edward Benjamin Britten, Baron Britten, OM CH\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"London Road North\", \"Lowestoft Lighthouse\", \"Belle Vue Park (Lowestoft)\", \"Sparrow's Nest\", \"Lowestoft Mayor\", \"The britten centre\", \"Lowestoft, Suffolk\", \"The Britten Centre\", \"Lowestoft\", \"LOWESTOFT\", \"London Road North Shopping Precinct\"]", "[\"Irlanda\", \"Island ireland\", \"Ireland (region)\", \"Irlandia\", \"Erin's Isle\", \"Airlan\", \"Ireland\", \"West Coast of Ireland\", \"The island of Ireland\", \"Island Ireland\", \"Ireland (island)\", \"Irland\", \"H\\u00c9ireann\", \"Ireland Ulster\", \"Population of Ireland\", \"Irelander\", \"Ireland and Ulster\", \"Ireland (Island)\", \"IRELAND\", \"Symbol of Ireland\", \"Scotia major\", \"Island of Ireland\", \"Airlann\", \"Mikra Britannia\", \"Irelanders\", \"Auld Sod\", \"Ierne (placename)\"]", "[\"Birmingham city managers\", \"Birmingham City F.C.\", \"Birmingham City F.C\", \"Birmingham Blues\", \"Birmingham City FC\", \"Birmingham City Football Club\", \"Birmingham City\", \"Birmingham F.C.\", \"Birmingham City Squad\", \"Birmingham FC\", \"Birmingham city fc\", \"Birmingham City F C\", \"Small Heath Alliance\", \"The Blues (Birmingham)\", \"Small Heath Football Club\", \"Birmingham City F. C.\", \"Small Heath F.C.\", \"Birmingham Football Club\"]", "[\"Australia (Commonwealth realm)\", \"AustraliA\", \"Continental Australia\", \"Australias\", \"Peace of Australia\", \"Australian city life\", \"City life in Australia\", \"Australocentrist\", \"Mainland Australia\", \"Australiia\", \"Straya\", \"Australia (commonwealth)\", \"Austraila\", \"Ausrtalia\", \"Australia (nation)\", \"Australien\", \"New Australian\", \"Australia (dominion)\", \"Australia (federation)\", \"Australia (country)\", \"Aussieland\", \"Federal Australia\", \"Country life in Australia\", \"Orstraya\", \"Australia (nation state)\", \"Australia (commonwealth realm)\", \"Australia\", \"Australocentrism\", \"Austraya\", \"Australie\", \"AUSTRALIA\", \"Geopolitics of Australia\", \"Australia (nation-state)\", \"Australia's\", \"Australian mainland\", \"Australian country life\", \"Australian Woman's Day\", \"Imperial Australia\", \"United States of Australia\", \"Australia (realm)\", \"Australia (constitutional monarchy)\", \"Austalia\", \"Etymology of Australia\", \"Philosophy in Australia\", \"Commonwealth of Australia\", \"Australija\", \"Australia (monarchy)\", \"Dominion of Australia\", \"Empire of Australia\", \"Ostralia\", \"Modern Australia\", \"Commonwealth of australia\", \"Australia (empire)\", \"Australo\", \"The Commonwealth of Australia\", \"Australia.\", \"Austrlia\", \"Australlia\", \"AUSTRALIAN\", \"Australia (state)\", \"ISO 3166-1:AU\", \"Austrailia\", \"Commonwealth Australia\", \"Pax Australiana\", \"Australian Commonwealth\", \"Australocentric\", \"Austrlaia\", \"Technology in Australia\", \"Australia (Commonwealth)\", \"Australai\", \"Australian geopolitics\", \"Asutralia\", \"Australo-\", \"Australian's\", \"Science in Australia\"]", "[\"The Stiff Kittens\", \"Joy Division\", \"Joy Division song list\", \"Joy Division/New Order\", \"Warsaw (band)\", \"Joy division\", \"Joy Division (band)\"]", "[\"Harry Patch\", \"HARRY PATCH\", \"Henry John Patch\"]", "[\"(Sir Ronald) Ross\", \"Sir Ronald Ross\", \"Ronald ross\", \"Ronald Ross\"]", "[\"Dancer and choreographer\"]", "[\"Cabbage leaf\"]", "[\"Rip van Winkle\", \"Rip van winkle\", \"Rip van Winkel\", \"Rip Wan Winkle\", \"Rip Van Winkle\", \"Rip Van winkle\"]", "[\"Medieval jericho\", \"Jericho, Palestine\", \"Jericho Area\", \"Jericho in the middle ages\", \"Jericho, West Bank City\", \"Classical jericho\", \"Jericho\", \"City of palms\", \"Jeriho\", \"Tel el-Sultan\", \"Tell el-Sultan\", \"Ancient jericho\", \"Jericho, West Bank\", \"Tell es-Sultan\", \"Jericho (town)\"]", "[\"MARTIN BOYCE\", \"Martin Boyce\"]", "[\"Percy Bysse Shelley\", \"Percy Byshe Shelley\", \"A Gentleman of the University of Oxford\", \"Percy Bysshe Shelley\", \"My Aunt Margaret Nicholson\", \"Bysshe\", \"PB shelley\", \"P.B. Shelley\", \"Percy Bysshe\", \"Percy Shelley\", \"Elena Adelaide Shelley\", \"A Gentleman of Oxford\", \"PERCY BYSSHE SHELLEY\", \"The Question (Shelley)\", \"Percy Bysshe Shelly\", \"Percy B. Shelley\", \"The Question (poem)\", \"P. B. Shelley\", \"Percy Shelly\"]", "[\"The Scottish Nation\", \"Scotlander\", \"Scotland\", \"Northern Great Britain\", \"Scot Land\", \"Scottland\", \"Scotlanders\", \"Scotland, UK\", \"Scotland's\", \"Scottish nation\", \"North Great Britain\", \"Autonomous Province of Scotland\", \"Scottish Nation\", \"Communications in Scotland\", \"Maps of scotland\", \"North of Great Britain\", \"Scotia minor\", \"Auld Country\", \"Scotchland\", \"H-Alba\", \"SCOTLAND\", \"East coast of Scotland\"]", "[\"Britten, Benjamin\", \"Benjamin, Baron Britten\", \"Edward Benjamin Britten\", \"Ballets by Benjamin Britten\", \"Britten\", \"Lord Britten\", \"Benjamin BRITTEN\", \"Edward Benjamin Britten, Baron Britten\", \"Baron Britten\", \"Baron Britten of Aldeburgh\", \"Britten, Benjamin, Baron\", \"Benjamin Britten\", \"Edward Benjamin Britten, Baron Britten OM CH\", \"Benjamin Britten, 1st Baron Britten\", \"Benjamen Britten\", \"E B Britten\", \"Benjamin Britten, Baron Britten\", \"Benjamin Britain\", \"Benjamin britten\", \"Edward Benjamin Britten, Baron Britten, OM CH\"]" ]
[ "Which town in Suffolk is the most easterly point in England ?", "Which country won the Eurovision Song Contest in 1992, 1993 and 1994?", "Which Football League side was once known as Small Heath Alliance", "Kosciuszko is the highest mountain in which Southern Hemisphere country?", "English musician Ian Curtis, who died on 18th May 1980, was best known as lead singer of which post-punk band?", "\"What was the name of the last surviving \"\"Tommy\"\", from World War I, who died in 2009, aged 111?\"", "Who received the Nobel Prize for Physiology or Medicine in 1902 for his work on the transmission of malaria, becoming the first British Nobel laureate?", "What was the occupation of Vaslav Nijinsky from 1908?", "What type of leaf did US baseball player Babe Ruth wear under his cap to keep him cool?", "According to legend, who fell asleep in the Catskill Mountains for 20 years, following a game of 9-pins with the ghosts of Henry Hudson's crew?", "In the Bible to where was the Good Samaritan traveling?", "Who won the 2011 Turner Prize for his installation 'Do Words Have Voices'?", "Which of the Romantic Poets wrote 'The Revolt Of Islam'?", "\"While most juries can only provide a verdict of \"\"Guilty\"\" or \"\"Not Guilty\"\", in which country can a jury decide \"\"Not Proven\"\"?\"", "Who composed the opera ‘Peter Grimes’?" ]
15
[ 109065, 109066, 109067, 109068, 109069, 109070, 109071, 109072, 109073, 109074, 109075, 109076, 109077, 109078, 109079 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: In which year did the following events occur; Helen Sharman became the first Briton in space, Tim Berners-Lee established the first website and Robert Maxwell died?\nQuestion 2: What year were these people born: Jackie Chan, John Travolta and Oprah Winfrey?\nQuestion 3: Which '60's pop group new line-up included Jimmy Page, John Paul Jones, John Bonham and Robert Plant?\nQuestion 4: Garuda Indonesia is the country's official national?\nQuestion 5: Astronomer Tycho Brahe was born in which European country in 1546?\nQuestion 6: \"Which actress received an Oscar nomination for her role in the film \"\"Trans America\"\"?\"\nQuestion 7: Coach Claudio Raniero spent how many years in management before winning his first top-level league championship with Leicester FC in 2016?\nQuestion 8: By what name is Theodor Geisel better known?\nQuestion 9: The American woodchuck is also known by what name?\nQuestion 10: An important Biafran army base in the 1967-70 conflict then known as the Biafran War, in which African country is Lake Oguta?\nQuestion 11: Which is the brightest planet to be seen in the night sky?\nQuestion 12: Pogonology is the study of what?\nQuestion 13: What is the transverse portion of a cross shaped church known as?\nQuestion 14: At the 2014 FIFA World Cup which German player became the top scorer, with a total of 16 goals?\nQuestion 15: Paul Jones was succeeded by Mike D'Abo as singer with which 60s group?", "role": "user" } ]
["[\"1991\", \"one thousand, nine hundred and ninety-one\"]", "[\"1954\", \"one thousand, nine hundred and fifty-four\"]", "[\"The Yard Birds\", \"The Yardbirds\", \"THE YARDBIRDS\", \"Yardbirds (band)\", \"Yardbirds\"]", "[\"Commercial airline\", \"Airline industry\", \"Airline companies\", \"Scheduled air carriers\", \"Commercial air transport\", \"Passenger aeroplane\", \"Airline\", \"Airlines\", \"The Airline\", \"Air carrier\", \"Scheduled air transport\", \"Air carriers\", \"Airline flights\", \"Scheduled airline\", \"Airline company\", \"Commercial flights\"]", "[\"Eastern Denmark\", \"Kingdom of denmark\", \"Denmarke\", \"Subdivisions of Denmark\", \"Kongeriget Danmark\", \"Mainland Denmark\", \"Danmoerk\", \"Denmark proper\", \"Danimarca\", \"ISO 3166-1:DK\", \"Denmark\", \"D\\u00e4nemark\", \"Danska\", \"Denmarc\", \"KingdomOfDenmark\", \"DENMARK\", \"Kingdom of Denmark\", \"Denemarke\", \"Administrative divisions of denmark\", \"Danish kingdom\", \"Danemark\", \"Daenemark\", \"Media in Denmark\", \"Danm\\u00f6rk\", \"DenmarK\", \"Danmork\", \"Administrative divisions of Denmark\", \"Media of Denmark\", \"Danish Kingdom\", \"Dinamarca\"]", "[\"Felicity K Huffman\", \"Felicity Huffman Macy\", \"Felicity Huffman\", \"Felicity K. Huffman\", \"Felicity Kendall Huffman\"]", "[\"28\", \"twenty-eight\"]", "[\"Biography of dr.seuss\", \"Theodore Geissel\", \"Theodore geisel\", \"Dr.Seuss\", \"Gerald McBoing-Boing (2000 book)\", \"Dr. Soice\", \"Theodore Seuss Geisel\", \"List of films based on Dr. Seuss books\", \"Doctor Seuss\", \"Dr. Seus\", \"Dr seuss\", \"Theo LeSeig\", \"Dr. Theodore Seuss Giesel\", \"Dr sues\", \"Teddy Geisel\", \"Dr.suess\", \"Dr. Seuss' Birthday\", \"Theo Geisel\", \"Dr. Seuss\", \"Theodor Suess Geisel\", \"Theo LeSieg\", \"List of Dr. Seuss films\", \"Theodore (Dr. Seuss) Geisel's\", \"Suess books\", \"Doctor sues\", \"Seuss\", \"The Story of Dr. Seuss (film)\", \"Dr. Suess\", \"Theodor Seuss Geisel\", \"Theodor (Dr. Seuss) Geisel's\", \"Doctor suess\", \"Dr. sues\", \"Theodore Geisel\", \"Theodor Seuss\", \"Gerald McBoing-Boing (book)\", \"Doctor seus\", \"Seussian\", \"Dr.seuss\", \"Audrey Geisel\", \"Theo. LeSieg\", \"Hunches in bunches\", \"Theodor %22Dr. Seuss%22 Geisel\", \"Ted Geisel\", \"Dr Seuss\", \"The Story of Dr. Seuss\", \"Dr seus\", \"Dr Suess\"]", "[\"Whistle-pig\", \"Grundsau\", \"Dirtpig\", \"Groundhogs\", \"Ground hog\", \"Groundhog\", \"Squirrel beaver\", \"Woodchuck tongue twister poem\", \"Whistle pig\", \"Ground-hog\", \"Marmota monax\", \"Whistlepig\", \"Wood chuck\", \"Grundsow\", \"Woodchuck\", \"Landbeaver\", \"Whistle Pig\", \"Land-beaver\"]", "[\"Nigerian Independence\", \"\\u00ccj\\u1ecdba-\\u00c0pap\\u1ecd\\u0300 Or\\u00edl\\u1eb9\\u0300-\\u00e8d\\u00e8 Na\\u00ecj\\u00edr\\u00ec\\u00e0\", \"Nig\\u00e9rie\", \"Nigeeria\", \"Nig\\u00e9ria\", \"Nigerias agriculture\", \"Nigeri\\u00eb\", \"Chawaka\", \"Crime in Nigeria\", \"NGR\", \"Nig\\u00e8ria\", \"Nigeria\", \"Ethnic groups of Nigeria\", \"Nicheria\", \"Nigerie\", \"Nigeriya\", \"Nigerija\", \"Naija\", \"Kufai, Nigeria\", \"Nigerian sport\", \"Na\\u00ecj\\u00edr\\u00ec\\u00e0\", \"Ijoba-Apapo Orile-ede Naijiria\", \"Naigeria\", \"Sport in Nigeria\", \"Nijeriya\", \"Negeria\", \"Republic nde Naigeria\", \"Western Region, Nigeria\", \"Niiseriya\", \"Or\\u00edl\\u1eb9\\u0300-\\u00e8d\\u00e8 Ol\\u00f3m\\u00ecnira \\u00c0pap\\u1ecd\\u0300 N\\u00e0\\u00ecj\\u00edr\\u00ed\\u00e0\", \"South-west Nigeria\", \"Republik Nijeriya\", \"Population in nigeria 2009\", \"ISO 3166-1:NG\", \"Jamhuriyar Taraiyar Nijeriya\", \"Na\\u00edj\\u00edr\\u00ed\\u00e0\", \"Republik Federaal bu Niiseriya\", \"Agoi\", \"Naijiria\", \"Nixeria\", \"Conseil de Salut National\", \"N\\u00e0\\u00ecj\\u00edr\\u00ed\\u00e0\", \"Federal Republic of Nigeria\"]", "[\"Sol 2\", \"Venus (Planet)\", \"The planet Venus\", \"Venis\", \"Venus (astronomy)\", \"Venus (planet)\", \"Metal Star\", \"Sol-2\", \"Structure of Venus\", \"Venerian year\", \"Aitorma\", \"Venus the planet\", \"Planet Venus\", \"Astronomy Venus\", \"Sol c\", \"Venus\", \"Sun c\", \"Second planet\", \"Sol II\", \"Studies of Venus\", \"2nd planet\", \"Kleinchen\", \"Cytherocentric orbit\"]", "[\"Beard\", \"Bearded\", \"Neard\", \"Manbeard\", \"BEARDS\", \"Pogonology\", \"Full beard\", \"Neckbeard\", \"\\u0627\\u0644\\u0631\\u062c\\u0644 \\u0628\\u0644\\u0627 \\u0634\\u0646\\u0628 \\u0643\\u0627\\u0644\\u0642\\u0637 \\u0628\\u0644\\u0627 \\u0630\\u0646\\u0628\", \"Neck beard\", \"Neck hair\", \"Beards\", \"Bearded people\", \"Five o'clock shadow\"]", "[\"Madonna University\", \"The Transept\", \"Madonna College\", \"TRANSEPT\", \"Madonna Crusaders\"]", "[\"Miroslav Klose\", \"Miroslave Klose\", \"Miros\\u0142aw Klose\", \"M Klose\", \"Miro Klose\"]", "[\"The Ascent Of Mann\", \"Manfred Man\", \"Manfred Mann (band)\", \"Manfred Mann\", \"5\\u20134\\u20133\\u20132\\u20131\", \"5-4-3-2-1\", \"Mannfred Mann\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"1991\", \"one thousand, nine hundred and ninety-one\"]", "[\"1954\", \"one thousand, nine hundred and fifty-four\"]", "[\"The Yard Birds\", \"The Yardbirds\", \"THE YARDBIRDS\", \"Yardbirds (band)\", \"Yardbirds\"]", "[\"Commercial airline\", \"Airline industry\", \"Airline companies\", \"Scheduled air carriers\", \"Commercial air transport\", \"Passenger aeroplane\", \"Airline\", \"Airlines\", \"The Airline\", \"Air carrier\", \"Scheduled air transport\", \"Air carriers\", \"Airline flights\", \"Scheduled airline\", \"Airline company\", \"Commercial flights\"]", "[\"Eastern Denmark\", \"Kingdom of denmark\", \"Denmarke\", \"Subdivisions of Denmark\", \"Kongeriget Danmark\", \"Mainland Denmark\", \"Danmoerk\", \"Denmark proper\", \"Danimarca\", \"ISO 3166-1:DK\", \"Denmark\", \"D\\u00e4nemark\", \"Danska\", \"Denmarc\", \"KingdomOfDenmark\", \"DENMARK\", \"Kingdom of Denmark\", \"Denemarke\", \"Administrative divisions of denmark\", \"Danish kingdom\", \"Danemark\", \"Daenemark\", \"Media in Denmark\", \"Danm\\u00f6rk\", \"DenmarK\", \"Danmork\", \"Administrative divisions of Denmark\", \"Media of Denmark\", \"Danish Kingdom\", \"Dinamarca\"]", "[\"Felicity K Huffman\", \"Felicity Huffman Macy\", \"Felicity Huffman\", \"Felicity K. Huffman\", \"Felicity Kendall Huffman\"]", "[\"28\", \"twenty-eight\"]", "[\"Biography of dr.seuss\", \"Theodore Geissel\", \"Theodore geisel\", \"Dr.Seuss\", \"Gerald McBoing-Boing (2000 book)\", \"Dr. Soice\", \"Theodore Seuss Geisel\", \"List of films based on Dr. Seuss books\", \"Doctor Seuss\", \"Dr. Seus\", \"Dr seuss\", \"Theo LeSeig\", \"Dr. Theodore Seuss Giesel\", \"Dr sues\", \"Teddy Geisel\", \"Dr.suess\", \"Dr. Seuss' Birthday\", \"Theo Geisel\", \"Dr. Seuss\", \"Theodor Suess Geisel\", \"Theo LeSieg\", \"List of Dr. Seuss films\", \"Theodore (Dr. Seuss) Geisel's\", \"Suess books\", \"Doctor sues\", \"Seuss\", \"The Story of Dr. Seuss (film)\", \"Dr. Suess\", \"Theodor Seuss Geisel\", \"Theodor (Dr. Seuss) Geisel's\", \"Doctor suess\", \"Dr. sues\", \"Theodore Geisel\", \"Theodor Seuss\", \"Gerald McBoing-Boing (book)\", \"Doctor seus\", \"Seussian\", \"Dr.seuss\", \"Audrey Geisel\", \"Theo. LeSieg\", \"Hunches in bunches\", \"Theodor %22Dr. Seuss%22 Geisel\", \"Ted Geisel\", \"Dr Seuss\", \"The Story of Dr. Seuss\", \"Dr seus\", \"Dr Suess\"]", "[\"Whistle-pig\", \"Grundsau\", \"Dirtpig\", \"Groundhogs\", \"Ground hog\", \"Groundhog\", \"Squirrel beaver\", \"Woodchuck tongue twister poem\", \"Whistle pig\", \"Ground-hog\", \"Marmota monax\", \"Whistlepig\", \"Wood chuck\", \"Grundsow\", \"Woodchuck\", \"Landbeaver\", \"Whistle Pig\", \"Land-beaver\"]", "[\"Nigerian Independence\", \"\\u00ccj\\u1ecdba-\\u00c0pap\\u1ecd\\u0300 Or\\u00edl\\u1eb9\\u0300-\\u00e8d\\u00e8 Na\\u00ecj\\u00edr\\u00ec\\u00e0\", \"Nig\\u00e9rie\", \"Nigeeria\", \"Nig\\u00e9ria\", \"Nigerias agriculture\", \"Nigeri\\u00eb\", \"Chawaka\", \"Crime in Nigeria\", \"NGR\", \"Nig\\u00e8ria\", \"Nigeria\", \"Ethnic groups of Nigeria\", \"Nicheria\", \"Nigerie\", \"Nigeriya\", \"Nigerija\", \"Naija\", \"Kufai, Nigeria\", \"Nigerian sport\", \"Na\\u00ecj\\u00edr\\u00ec\\u00e0\", \"Ijoba-Apapo Orile-ede Naijiria\", \"Naigeria\", \"Sport in Nigeria\", \"Nijeriya\", \"Negeria\", \"Republic nde Naigeria\", \"Western Region, Nigeria\", \"Niiseriya\", \"Or\\u00edl\\u1eb9\\u0300-\\u00e8d\\u00e8 Ol\\u00f3m\\u00ecnira \\u00c0pap\\u1ecd\\u0300 N\\u00e0\\u00ecj\\u00edr\\u00ed\\u00e0\", \"South-west Nigeria\", \"Republik Nijeriya\", \"Population in nigeria 2009\", \"ISO 3166-1:NG\", \"Jamhuriyar Taraiyar Nijeriya\", \"Na\\u00edj\\u00edr\\u00ed\\u00e0\", \"Republik Federaal bu Niiseriya\", \"Agoi\", \"Naijiria\", \"Nixeria\", \"Conseil de Salut National\", \"N\\u00e0\\u00ecj\\u00edr\\u00ed\\u00e0\", \"Federal Republic of Nigeria\"]", "[\"Sol 2\", \"Venus (Planet)\", \"The planet Venus\", \"Venis\", \"Venus (astronomy)\", \"Venus (planet)\", \"Metal Star\", \"Sol-2\", \"Structure of Venus\", \"Venerian year\", \"Aitorma\", \"Venus the planet\", \"Planet Venus\", \"Astronomy Venus\", \"Sol c\", \"Venus\", \"Sun c\", \"Second planet\", \"Sol II\", \"Studies of Venus\", \"2nd planet\", \"Kleinchen\", \"Cytherocentric orbit\"]", "[\"Beard\", \"Bearded\", \"Neard\", \"Manbeard\", \"BEARDS\", \"Pogonology\", \"Full beard\", \"Neckbeard\", \"\\u0627\\u0644\\u0631\\u062c\\u0644 \\u0628\\u0644\\u0627 \\u0634\\u0646\\u0628 \\u0643\\u0627\\u0644\\u0642\\u0637 \\u0628\\u0644\\u0627 \\u0630\\u0646\\u0628\", \"Neck beard\", \"Neck hair\", \"Beards\", \"Bearded people\", \"Five o'clock shadow\"]", "[\"Madonna University\", \"The Transept\", \"Madonna College\", \"TRANSEPT\", \"Madonna Crusaders\"]", "[\"Miroslav Klose\", \"Miroslave Klose\", \"Miros\\u0142aw Klose\", \"M Klose\", \"Miro Klose\"]", "[\"The Ascent Of Mann\", \"Manfred Man\", \"Manfred Mann (band)\", \"Manfred Mann\", \"5\\u20134\\u20133\\u20132\\u20131\", \"5-4-3-2-1\", \"Mannfred Mann\"]" ]
[ "In which year did the following events occur; Helen Sharman became the first Briton in space, Tim Berners-Lee established the first website and Robert Maxwell died?", "What year were these people born: Jackie Chan, John Travolta and Oprah Winfrey?", "Which '60's pop group new line-up included Jimmy Page, John Paul Jones, John Bonham and Robert Plant?", "Garuda Indonesia is the country's official national?", "Astronomer Tycho Brahe was born in which European country in 1546?", "\"Which actress received an Oscar nomination for her role in the film \"\"Trans America\"\"?\"", "Coach Claudio Raniero spent how many years in management before winning his first top-level league championship with Leicester FC in 2016?", "By what name is Theodor Geisel better known?", "The American woodchuck is also known by what name?", "An important Biafran army base in the 1967-70 conflict then known as the Biafran War, in which African country is Lake Oguta?", "Which is the brightest planet to be seen in the night sky?", "Pogonology is the study of what?", "What is the transverse portion of a cross shaped church known as?", "At the 2014 FIFA World Cup which German player became the top scorer, with a total of 16 goals?", "Paul Jones was succeeded by Mike D'Abo as singer with which 60s group?" ]
15
[ 4845, 4846, 4847, 4848, 4849, 4850, 4851, 4852, 4853, 4854, 4855, 4856, 4857, 4858, 4859 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Around which city did Charles I make his H.Q. during the Civil War?\nQuestion 2: The Red River is a tributary of which U.S.river?\nQuestion 3: What scale measures cola at 2.5, orange juice at 3.5, beer at 4.5, coffee at 5.0, tea at 5.5, milk at 6.5 and blood at nearly 7.4?\nQuestion 4: The teacher Miss Hooley and P.C. Plum appear in which children's TV series?\nQuestion 5: What was the name of the twin brother of the only female member of The Beano's Bash Street Kids; his outfit consisted of a black and blue hooped top and black shorts?\nQuestion 6: Who had a U.K. No 1 in the 80's with The Edge of Heaven\nQuestion 7: \"Which US president was re-elected with the slogan \"\"Don't change horses in mid-stream\"\"?\"\nQuestion 8: Who presents the TV show Reflex?\nQuestion 9: What was the name of Ghana prior to independence?\nQuestion 10: In human anatomy, what is the name of the wall that separates the nostrils?\nQuestion 11: Which horse won the 1967 Grand National at odds of 100/1 after a melee at the 23rd. fence caused most of the field to pull up?\nQuestion 12: In a 1965 film, by what name is Eric Stoner better known?\nQuestion 13: Which UK country did Queen Elizabeth II visit on her first official tour after her coronation?\nQuestion 14: Ramadan is which number month of the Islamic calendar\nQuestion 15: What was Wolfgang Amadeus Mozart's (original) middle name?", "role": "user" } ]
["[\"Oxford, england\", \"Oxeford\", \"Lion Brewery (U.K.)\", \"Oxford, UK\", \"Oxford astrophysics\", \"City of Dreaming Spires\", \"Oxford, England\", \"Oxford (England)\", \"Oxford\", \"Oxford, Oxfordshire\", \"The Dreaming Spires\", \"City of Oxford\", \"UN/LOCODE:GBOXF\", \"OXFORD\", \"City of dreaming spires\", \"Ford of the Oxen\", \"County Borough of Oxford\", \"The weather in Oxford\", \"Oxford, United Kingdom\", \"Morrells brewery\", \"The city of dreaming spires\", \"Oxenaforda\"]", "[\"Mizzipy\", \"Misisipi River\", \"Mississippi-Missouri\", \"Mississippi Basin\", \"The Father of Waters\", \"River Colbert\", \"Mississippi river\", \"Mississippi river basin\", \"Missisippi River\", \"River of Immaculate Conception\", \"Rio de Espiritu Santo\", \"Missippi river\", \"Rio Misisipi\", \"The Mississippi River\", \"Mississippi River\", \"The Mississippi\", \"Mississippi Valley\", \"Mississippi (river)\", \"Mississipi river\", \"Mississippi watershed\", \"Mississippi River (United States)\", \"R\\u00edo Misisipi\", \"The mississippi\", \"The big muddy\", \"Mississippi River watershed\", \"River Mississippi\", \"Mississipi River\", \"Mississippi Missouri\", \"Mississippi River-Missouri River\", \"Mississippi.\"]", "[\"Ocean acidity\", \"Ph\", \"Neutral solution\", \"Ph Scale\", \"PH Scale\", \"PH 7\", \"PH level\", \"PH strip\", \"Potential of hydrogen\", \"Pondus hydrogenii\", \"Acid and base\", \"P H\", \"pH scale\", \"Acids and bases\", \"PH scale\", \"Hydrogen-ion concentration\", \"Power of hydrogen\", \"\\u33d7\", \"P.H.\", \"PH\", \"PH balance\", \"Potentia Hydrogenii\", \"Ph scale\", \"PH Imbalance\", \"Potential hydrogen\", \"Negative pH\", \"Potential Of Hydrogen\", \"PH value\", \"P.h.\"]", "[\"Balamory\", \"Miss Hoolie\", \"PC Plum\", \"BALAMORY\"]", "[\"Sidney (disambiguation)\", \"SIDNEY\", \"Sidny\", \"Sidney\"]", "[\"Wham! UK\", \"Wham!\", \"Wham\", \"Wham! (pop duo)\", \"WHAM!\"]", "[\"Abaraham lincoln\", \"Abe licnoln\", \"President Lincoln\", \"Abe Lincon\", \"A Lincoln\", \"Lincoln (president)\", \"President Abraham\", \"President Abraham Lincoln\", \"Abraham (president)\", \"The Rail Splitter\", \"Abe Lincoln\", \"Honest Abe\", \"Lincoln's cabinet\", \"Lincoln, Abraham\", \"Abraham Lincon\", \"Abraham Lincoln\", \"Abraham Lincoln and the American Civil War\", \"Great Emancipator\", \"Aberham lincoln\", \"Abraham Lincoln (president)\", \"Lincolnian\", \"President Abe Lincoln\", \"Honest Abe Lincoln\", \"Abraham lincoln\", \"A. Lincoln\", \"Presedent Lincon\", \"Abrahm Lincoln\", \"Abraham Lincoln's Life\", \"Abe lincolin\", \"Abaham lincoln\", \"The Great Emancipator\", \"16th President of the United States\"]", "[\"Shane Richie\", \"Shane Ritchie\"]", "[\"GOLD COAST\", \"The Gold Coast\", \"Litus Aureum\", \"Gold Coast (disambiguation)\", \"The Gold Coast (book)\", \"Gold coast\", \"Gold coats\", \"Gold Coast\", \"The Gold Coast (novel)\"]", "[\"Septum (anatomy)\", \"Heart septum\", \"Septal\", \"Aseptate\", \"Septae\", \"Cardiac septa\", \"Septum\"]", "[\"Foinavon\", \"FOINAVON\"]", "[\"The Cincinnati Kid\", \"Cincinnatti Kid\", \"Cinncinati Kid\", \"Cincinati Kid\", \"The Cincinnatti Kid\", \"Cincinnati Kid\", \"Cincinatti kid\", \"The Cincinatti Kid\", \"Cincinatti Kid\", \"Cinncinnatti Kid\", \"The Cinncinnati Kid\", \"Lancey %22The Man%22 Howard\", \"The Cinncinati Kid\", \"The Cincinati Kid\", \"The Cinncinnatti Kid\", \"Cinncinnati Kid\", \"Eric %22The Kid%22 Stoner\", \"The Cinncinatti Kid\", \"Cinncinatti Kid\"]", "[\"The Norn Iron\", \"Irland du nord\", \"Irlanda del Norte\", \"Norrn Iron\", \"Geography of Northern Ireland\", \"North Ireland\", \"Northern ireland\", \"Governance of Northern Ireland\", \"Ireland (Northern Ireland)\", \"The North of Ireland\", \"N. Ireland\", \"Northern Ireland, UK\", \"The Northern Ireland\", \"6 counties\", \"N Ireland\", \"Ulster (UK)\", \"Six counties\", \"Northeast of Ireland\", \"North ireland\", \"Northern Ireland assembly and Executive\", \"Nothern Irish\", \"Tuaisceart Eireann\", \"North of ireland\", \"Nothern Ireland\", \"Na S\\u00e9 Contaethe\", \"Norlin Airlan\", \"Northern irish\", \"Northern Irish politics\", \"Northern Ireland, United Kingdom\", \"Norn iron\", \"Norlin Airlann\", \"Northern Ireland (UK)\", \"Norn Iron\", \"Na Se Contaethe\", \"Northern Ireland Assembly and Executive\", \"Norn Irn\", \"Northern Ireland's national anthem\", \"National anthem of Northern Ireland\", \"Ulster (occupied)\", \"Communications in Northern Ireland\", \"Norn Ireland\", \"Ireland (north)\", \"The Occupied 6 Counties\", \"Northern Ireland\", \"Tuaisceart \\u00c9ireann\", \"North of Ireland\"]", "[\"Ninth (interval)\", \"Second (chord)\", \"Sharpened ninth\", \"Ninth (music)\", \"Augmented ninth\", \"Ninth\", \"Second chord\", \"Flat ninth\", \"Minor ninth\", \"Ninth (chord)\", \"Major ninth\"]", "[\"Wolfgang\", \"Wolfgang (disambiguation)\", \"Wolfgang's\", \"Wolfgang (name)\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Oxford, england\", \"Oxeford\", \"Lion Brewery (U.K.)\", \"Oxford, UK\", \"Oxford astrophysics\", \"City of Dreaming Spires\", \"Oxford, England\", \"Oxford (England)\", \"Oxford\", \"Oxford, Oxfordshire\", \"The Dreaming Spires\", \"City of Oxford\", \"UN/LOCODE:GBOXF\", \"OXFORD\", \"City of dreaming spires\", \"Ford of the Oxen\", \"County Borough of Oxford\", \"The weather in Oxford\", \"Oxford, United Kingdom\", \"Morrells brewery\", \"The city of dreaming spires\", \"Oxenaforda\"]", "[\"Mizzipy\", \"Misisipi River\", \"Mississippi-Missouri\", \"Mississippi Basin\", \"The Father of Waters\", \"River Colbert\", \"Mississippi river\", \"Mississippi river basin\", \"Missisippi River\", \"River of Immaculate Conception\", \"Rio de Espiritu Santo\", \"Missippi river\", \"Rio Misisipi\", \"The Mississippi River\", \"Mississippi River\", \"The Mississippi\", \"Mississippi Valley\", \"Mississippi (river)\", \"Mississipi river\", \"Mississippi watershed\", \"Mississippi River (United States)\", \"R\\u00edo Misisipi\", \"The mississippi\", \"The big muddy\", \"Mississippi River watershed\", \"River Mississippi\", \"Mississipi River\", \"Mississippi Missouri\", \"Mississippi River-Missouri River\", \"Mississippi.\"]", "[\"Ocean acidity\", \"Ph\", \"Neutral solution\", \"Ph Scale\", \"PH Scale\", \"PH 7\", \"PH level\", \"PH strip\", \"Potential of hydrogen\", \"Pondus hydrogenii\", \"Acid and base\", \"P H\", \"pH scale\", \"Acids and bases\", \"PH scale\", \"Hydrogen-ion concentration\", \"Power of hydrogen\", \"\\u33d7\", \"P.H.\", \"PH\", \"PH balance\", \"Potentia Hydrogenii\", \"Ph scale\", \"PH Imbalance\", \"Potential hydrogen\", \"Negative pH\", \"Potential Of Hydrogen\", \"PH value\", \"P.h.\"]", "[\"Balamory\", \"Miss Hoolie\", \"PC Plum\", \"BALAMORY\"]", "[\"Sidney (disambiguation)\", \"SIDNEY\", \"Sidny\", \"Sidney\"]", "[\"Wham! UK\", \"Wham!\", \"Wham\", \"Wham! (pop duo)\", \"WHAM!\"]", "[\"Abaraham lincoln\", \"Abe licnoln\", \"President Lincoln\", \"Abe Lincon\", \"A Lincoln\", \"Lincoln (president)\", \"President Abraham\", \"President Abraham Lincoln\", \"Abraham (president)\", \"The Rail Splitter\", \"Abe Lincoln\", \"Honest Abe\", \"Lincoln's cabinet\", \"Lincoln, Abraham\", \"Abraham Lincon\", \"Abraham Lincoln\", \"Abraham Lincoln and the American Civil War\", \"Great Emancipator\", \"Aberham lincoln\", \"Abraham Lincoln (president)\", \"Lincolnian\", \"President Abe Lincoln\", \"Honest Abe Lincoln\", \"Abraham lincoln\", \"A. Lincoln\", \"Presedent Lincon\", \"Abrahm Lincoln\", \"Abraham Lincoln's Life\", \"Abe lincolin\", \"Abaham lincoln\", \"The Great Emancipator\", \"16th President of the United States\"]", "[\"Shane Richie\", \"Shane Ritchie\"]", "[\"GOLD COAST\", \"The Gold Coast\", \"Litus Aureum\", \"Gold Coast (disambiguation)\", \"The Gold Coast (book)\", \"Gold coast\", \"Gold coats\", \"Gold Coast\", \"The Gold Coast (novel)\"]", "[\"Septum (anatomy)\", \"Heart septum\", \"Septal\", \"Aseptate\", \"Septae\", \"Cardiac septa\", \"Septum\"]", "[\"Foinavon\", \"FOINAVON\"]", "[\"The Cincinnati Kid\", \"Cincinnatti Kid\", \"Cinncinati Kid\", \"Cincinati Kid\", \"The Cincinnatti Kid\", \"Cincinnati Kid\", \"Cincinatti kid\", \"The Cincinatti Kid\", \"Cincinatti Kid\", \"Cinncinnatti Kid\", \"The Cinncinnati Kid\", \"Lancey %22The Man%22 Howard\", \"The Cinncinati Kid\", \"The Cincinati Kid\", \"The Cinncinnatti Kid\", \"Cinncinnati Kid\", \"Eric %22The Kid%22 Stoner\", \"The Cinncinatti Kid\", \"Cinncinatti Kid\"]", "[\"The Norn Iron\", \"Irland du nord\", \"Irlanda del Norte\", \"Norrn Iron\", \"Geography of Northern Ireland\", \"North Ireland\", \"Northern ireland\", \"Governance of Northern Ireland\", \"Ireland (Northern Ireland)\", \"The North of Ireland\", \"N. Ireland\", \"Northern Ireland, UK\", \"The Northern Ireland\", \"6 counties\", \"N Ireland\", \"Ulster (UK)\", \"Six counties\", \"Northeast of Ireland\", \"North ireland\", \"Northern Ireland assembly and Executive\", \"Nothern Irish\", \"Tuaisceart Eireann\", \"North of ireland\", \"Nothern Ireland\", \"Na S\\u00e9 Contaethe\", \"Norlin Airlan\", \"Northern irish\", \"Northern Irish politics\", \"Northern Ireland, United Kingdom\", \"Norn iron\", \"Norlin Airlann\", \"Northern Ireland (UK)\", \"Norn Iron\", \"Na Se Contaethe\", \"Northern Ireland Assembly and Executive\", \"Norn Irn\", \"Northern Ireland's national anthem\", \"National anthem of Northern Ireland\", \"Ulster (occupied)\", \"Communications in Northern Ireland\", \"Norn Ireland\", \"Ireland (north)\", \"The Occupied 6 Counties\", \"Northern Ireland\", \"Tuaisceart \\u00c9ireann\", \"North of Ireland\"]", "[\"Ninth (interval)\", \"Second (chord)\", \"Sharpened ninth\", \"Ninth (music)\", \"Augmented ninth\", \"Ninth\", \"Second chord\", \"Flat ninth\", \"Minor ninth\", \"Ninth (chord)\", \"Major ninth\"]", "[\"Wolfgang\", \"Wolfgang (disambiguation)\", \"Wolfgang's\", \"Wolfgang (name)\"]" ]
[ "Around which city did Charles I make his H.Q. during the Civil War?", "The Red River is a tributary of which U.S.river?", "What scale measures cola at 2.5, orange juice at 3.5, beer at 4.5, coffee at 5.0, tea at 5.5, milk at 6.5 and blood at nearly 7.4?", "The teacher Miss Hooley and P.C. Plum appear in which children's TV series?", "What was the name of the twin brother of the only female member of The Beano's Bash Street Kids; his outfit consisted of a black and blue hooped top and black shorts?", "Who had a U.K. No 1 in the 80's with The Edge of Heaven", "\"Which US president was re-elected with the slogan \"\"Don't change horses in mid-stream\"\"?\"", "Who presents the TV show Reflex?", "What was the name of Ghana prior to independence?", "In human anatomy, what is the name of the wall that separates the nostrils?", "Which horse won the 1967 Grand National at odds of 100/1 after a melee at the 23rd. fence caused most of the field to pull up?", "In a 1965 film, by what name is Eric Stoner better known?", "Which UK country did Queen Elizabeth II visit on her first official tour after her coronation?", "Ramadan is which number month of the Islamic calendar", "What was Wolfgang Amadeus Mozart's (original) middle name?" ]
15
[ 35280, 35281, 35282, 35283, 35284, 35285, 35286, 35287, 35288, 35289, 35290, 35291, 35292, 35293, 35294 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: In which Shakespeare play does Caliban appear?\nQuestion 2: At what battle was the Mexican general Santa Anna defeated by Sam Houston in 1836?\nQuestion 3: Love is All Around was a number one hit for Wet Wet Wet in 1994. In which film of that year did it feature?\nQuestion 4: Released in 1995, which was the first fully computer- animated feature film?\nQuestion 5: Dilma Rousseff has been under a political cloud recently after allegations of finance tampering have led to a clamour for her impeachment, at the time of writing (20/4) of which country is she president?\nQuestion 6: Which novel did Charles Dickens leave unfinished upon his death in 1870?\nQuestion 7: Which island lies between, and is connected by causeways to, North Uist and South Uist?\nQuestion 8: Rhinotillexomania is the medical name of which bad habit\nQuestion 9: Which motor manufacturer produces a model called the Yaris?\nQuestion 10: Spain has been through the upheaval of civil war more than once; what were the dates of the war in the 20th century?\nQuestion 11: What was the title of the 1960's American TV series, which starred Richard Boone as a gentleman turned gunfighter named Paladin?\nQuestion 12: Who became president of Uganda after Idi Amin was overthrown in 1980?\nQuestion 13: Which French electronic dance music duo had a UK Number Number One single in 2013 with 'Get Lucky'?\nQuestion 14: Which musical featured the song How To Handle A Woman?\nQuestion 15: \"Name the composer, born in Moravia in 1854, whose works include :- The rhapsody \"\"Taras Bulba\"\" and the opera \"\"The Beginning of a romance\"\"?\"", "role": "user" } ]
["[\"The twempes\", \"List of Characters in The Tempest\", \"Trinculo (The Tempest)\", \"The Tempest (play)\", \"The Tempest\", \"The Tempest Musical\", \"The tempest\", \"Alonso (character)\", \"Alonso (Shakespeare)\", \"Alonso (Character)\"]", "[\"San Jacinto\", \"San Jacinto (disambiguation)\"]", "[\"Four Weddings and A Funeral\", \"Four Weddings and a Funeral\", \"Four Weddings & a Funeral\", \"FOUR WEDDINGS AND A FUNERAL\", \"4 Weddings and a Funeral\", \"4 weddings\", \"4 weddings and a funeral\", \"Four weddings and a funeral\", \"Four Weddings & A Funeral\", \"Four Weddings and a Funeral (film)\"]", "[\"To Infinity and Beyond (catchphrase)\", \"Toy Story (soundtrack)\", \"Toy Story 1\", \"Toy Story (movie)\", \"Toy Story\", \"Toy story\", \"Toystory\", \"'TOY STORY'\", \"A Toy Story\", \"Toy Story 3-D\", \"ToyStory\", \"To Infinity and Beyond\", \"To Infity and Beyond (catchphrase)\", \"Production of Toy Story\", \"You are a toy\", \"Live Action Toy Story\"]", "[\"Brazil\", \"Etymology of Brazil\", \"Federal Republic of Brazil\", \"Brasil\", \"Barzil\", \"Federative Republic of Brazil\", \"Brazil (country)\", \"Brassil\", \"Republic of Brazil\", \"Br\\u00e9sil\", \"Brzil\", \"Brazilian Federative Republic\", \"Republica Federativa do Brasil\", \"Bresil\", \"Brazilian Republic\", \"ISO 3166-1:BR\", \"Rep\\u00fablica Federativa do Brasil\", \"Brazilo\"]", "[\"The Mystery of Edwin Drood (film)\", \"Mystery of Edwin Drood\", \"The Mystery of Edwin Drood\", \"Edwin Drood\", \"'THE MYSTERY OF EDWIN DROOD'\", \"The Mystery Of Edwin Drood\"]", "[\"Benbecula\", \"Isle of Benbecula\", \"Benebecula\", \"Craigstrome\", \"Benbeculla\"]", "[\"Nosepicking\", \"Picking one's nose\", \"Nosepick\", \"Digital trauma\", \"Picking your nose\", \"Nose picking\", \"Rhinotillexomania\", \"Nose-picking\", \"Rhinotillexisis\", \"Rhinotillexomaniac\", \"Rhinotillectomania\", \"Rhinotillexis\", \"Picking the nose\"]", "[\"Toyota Motor Manufacturing, U.S.A., Inc.\", \"Toyota automobile collectibles\", \"Toyopet\", \"Toyota Motors Philippines\", \"\\u30c8\\u30e8\\u30bf\", \"Zeronise\", \"Toyota (company)\", \"Toyota cars\", \"Toyota motor corp\", \"Toyotathon\", \"Toyota Motor Corp.\", \"Toyota 89CV\", \"Toyota Central R&D Labs\", \"Toyotas\", \"Toyota Netz\", \"Toyota Motor Company\", \"Toyta\", \"\\u30c8\\u30e8\\u30bf\\u81ea\\u52d5\\u8eca\\u682a\\u5f0f\\u4f1a\\u793e\", \"Toyota.com\", \"Toyopet Store\", \"Toyota Corporation\", \"Www.toyota.com\", \"Toyota Motor\", \"Toyota NETZ\", \"Toyota\", \"Toyota Motors Manufacturing\", \"Toyota Jidosha Kabushiki-gaisha\", \"Toyota Motor Corp\", \"Toyota company\", \"Toyota Motor Corporation\", \"Toyota Motor Philippines\", \"Toyota Vista Store\", \"TOYOTA\", \"Toyota Corolla Store\", \"Wins for Toyota \\u2014 Safety Group\", \"Toyota Store\", \"Toyota Jidousha Kabushiki-gaisha\", \"Toyota Motors\", \"Toyota 58-79 timeline\", \"Toyota (automobile)\"]", "[\"1936-39\"]", "[\"Have Gun - Will Travel (TV series)\", \"Hey Boy (TV Character)\", \"Have Gun-Will Travel\", \"Have Gun \\u2013 Will Travel\", \"Have Gun -- Will Travel\", \"Have Gun\\u2014Will Travel\", \"Have Gun Will Travel\", \"Have Gun \\u2014 Will Travel\", \"Paladin (Western character)\", \"Have Gun - Will Travel\", \"Have Gun\\u2013Will Travel\", \"Hey Boy (character)\", \"Wire Paladin\", \"Have Gun--Will Travel\", \"Have Gun, Will Travel\", \"HAVE GUN, WILL TRAVEL\"]", "[\"Apollo Milton Obote\", \"Obote, (Apollo)\", \"Apolo Milton Obote\", \"Obote (Apollo)\", \"Milton Obote\", \"1985 Ugandan coup d'\\u00e9tat\"]", "[\"Daft punk\", \"Daft Punk\", \"DAFT PUNK\", \"Draft Punk\", \"Daftpunk\", \"Daft Punk (band)\", \"Daft+punk\"]", "[\"Camelot\"]", "[\"Janacek\", \"Jan\\u00e1cek\", \"Leo\\u0161 Jan\\u00e1cek\", \"Leos Jan\\u00e1\\u00c4ek\", \"Leos Janarek\", \"Janacek, Leos\", \"Leo Eugen Jan\\u00e1\\u010dek\", \"Jan\\u00e1\\u010dek, Leo\\u0161\", \"Leos Jan\\u00e1cek\", \"JANACEK\", \"Janacak\", \"Jan\\u00e1\\u010dek\", \"Leo Eugen Janacek\", \"Leo\\u0161 Jan\\u00e1\\u010dek\", \"Leos janacek\", \"Moravian modulation\", \"Leos JanaAek\", \"Leos Jan\\u00e1\\u010dek\", \"Leos Jan\\u00e1rek\", \"Leos Janacek\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"The twempes\", \"List of Characters in The Tempest\", \"Trinculo (The Tempest)\", \"The Tempest (play)\", \"The Tempest\", \"The Tempest Musical\", \"The tempest\", \"Alonso (character)\", \"Alonso (Shakespeare)\", \"Alonso (Character)\"]", "[\"San Jacinto\", \"San Jacinto (disambiguation)\"]", "[\"Four Weddings and A Funeral\", \"Four Weddings and a Funeral\", \"Four Weddings & a Funeral\", \"FOUR WEDDINGS AND A FUNERAL\", \"4 Weddings and a Funeral\", \"4 weddings\", \"4 weddings and a funeral\", \"Four weddings and a funeral\", \"Four Weddings & A Funeral\", \"Four Weddings and a Funeral (film)\"]", "[\"To Infinity and Beyond (catchphrase)\", \"Toy Story (soundtrack)\", \"Toy Story 1\", \"Toy Story (movie)\", \"Toy Story\", \"Toy story\", \"Toystory\", \"'TOY STORY'\", \"A Toy Story\", \"Toy Story 3-D\", \"ToyStory\", \"To Infinity and Beyond\", \"To Infity and Beyond (catchphrase)\", \"Production of Toy Story\", \"You are a toy\", \"Live Action Toy Story\"]", "[\"Brazil\", \"Etymology of Brazil\", \"Federal Republic of Brazil\", \"Brasil\", \"Barzil\", \"Federative Republic of Brazil\", \"Brazil (country)\", \"Brassil\", \"Republic of Brazil\", \"Br\\u00e9sil\", \"Brzil\", \"Brazilian Federative Republic\", \"Republica Federativa do Brasil\", \"Bresil\", \"Brazilian Republic\", \"ISO 3166-1:BR\", \"Rep\\u00fablica Federativa do Brasil\", \"Brazilo\"]", "[\"The Mystery of Edwin Drood (film)\", \"Mystery of Edwin Drood\", \"The Mystery of Edwin Drood\", \"Edwin Drood\", \"'THE MYSTERY OF EDWIN DROOD'\", \"The Mystery Of Edwin Drood\"]", "[\"Benbecula\", \"Isle of Benbecula\", \"Benebecula\", \"Craigstrome\", \"Benbeculla\"]", "[\"Nosepicking\", \"Picking one's nose\", \"Nosepick\", \"Digital trauma\", \"Picking your nose\", \"Nose picking\", \"Rhinotillexomania\", \"Nose-picking\", \"Rhinotillexisis\", \"Rhinotillexomaniac\", \"Rhinotillectomania\", \"Rhinotillexis\", \"Picking the nose\"]", "[\"Toyota Motor Manufacturing, U.S.A., Inc.\", \"Toyota automobile collectibles\", \"Toyopet\", \"Toyota Motors Philippines\", \"\\u30c8\\u30e8\\u30bf\", \"Zeronise\", \"Toyota (company)\", \"Toyota cars\", \"Toyota motor corp\", \"Toyotathon\", \"Toyota Motor Corp.\", \"Toyota 89CV\", \"Toyota Central R&D Labs\", \"Toyotas\", \"Toyota Netz\", \"Toyota Motor Company\", \"Toyta\", \"\\u30c8\\u30e8\\u30bf\\u81ea\\u52d5\\u8eca\\u682a\\u5f0f\\u4f1a\\u793e\", \"Toyota.com\", \"Toyopet Store\", \"Toyota Corporation\", \"Www.toyota.com\", \"Toyota Motor\", \"Toyota NETZ\", \"Toyota\", \"Toyota Motors Manufacturing\", \"Toyota Jidosha Kabushiki-gaisha\", \"Toyota Motor Corp\", \"Toyota company\", \"Toyota Motor Corporation\", \"Toyota Motor Philippines\", \"Toyota Vista Store\", \"TOYOTA\", \"Toyota Corolla Store\", \"Wins for Toyota \\u2014 Safety Group\", \"Toyota Store\", \"Toyota Jidousha Kabushiki-gaisha\", \"Toyota Motors\", \"Toyota 58-79 timeline\", \"Toyota (automobile)\"]", "[\"1936-39\"]", "[\"Have Gun - Will Travel (TV series)\", \"Hey Boy (TV Character)\", \"Have Gun-Will Travel\", \"Have Gun \\u2013 Will Travel\", \"Have Gun -- Will Travel\", \"Have Gun\\u2014Will Travel\", \"Have Gun Will Travel\", \"Have Gun \\u2014 Will Travel\", \"Paladin (Western character)\", \"Have Gun - Will Travel\", \"Have Gun\\u2013Will Travel\", \"Hey Boy (character)\", \"Wire Paladin\", \"Have Gun--Will Travel\", \"Have Gun, Will Travel\", \"HAVE GUN, WILL TRAVEL\"]", "[\"Apollo Milton Obote\", \"Obote, (Apollo)\", \"Apolo Milton Obote\", \"Obote (Apollo)\", \"Milton Obote\", \"1985 Ugandan coup d'\\u00e9tat\"]", "[\"Daft punk\", \"Daft Punk\", \"DAFT PUNK\", \"Draft Punk\", \"Daftpunk\", \"Daft Punk (band)\", \"Daft+punk\"]", "[\"Camelot\"]", "[\"Janacek\", \"Jan\\u00e1cek\", \"Leo\\u0161 Jan\\u00e1cek\", \"Leos Jan\\u00e1\\u00c4ek\", \"Leos Janarek\", \"Janacek, Leos\", \"Leo Eugen Jan\\u00e1\\u010dek\", \"Jan\\u00e1\\u010dek, Leo\\u0161\", \"Leos Jan\\u00e1cek\", \"JANACEK\", \"Janacak\", \"Jan\\u00e1\\u010dek\", \"Leo Eugen Janacek\", \"Leo\\u0161 Jan\\u00e1\\u010dek\", \"Leos janacek\", \"Moravian modulation\", \"Leos JanaAek\", \"Leos Jan\\u00e1\\u010dek\", \"Leos Jan\\u00e1rek\", \"Leos Janacek\"]" ]
[ "In which Shakespeare play does Caliban appear?", "At what battle was the Mexican general Santa Anna defeated by Sam Houston in 1836?", "Love is All Around was a number one hit for Wet Wet Wet in 1994. In which film of that year did it feature?", "Released in 1995, which was the first fully computer- animated feature film?", "Dilma Rousseff has been under a political cloud recently after allegations of finance tampering have led to a clamour for her impeachment, at the time of writing (20/4) of which country is she president?", "Which novel did Charles Dickens leave unfinished upon his death in 1870?", "Which island lies between, and is connected by causeways to, North Uist and South Uist?", "Rhinotillexomania is the medical name of which bad habit", "Which motor manufacturer produces a model called the Yaris?", "Spain has been through the upheaval of civil war more than once; what were the dates of the war in the 20th century?", "What was the title of the 1960's American TV series, which starred Richard Boone as a gentleman turned gunfighter named Paladin?", "Who became president of Uganda after Idi Amin was overthrown in 1980?", "Which French electronic dance music duo had a UK Number Number One single in 2013 with 'Get Lucky'?", "Which musical featured the song How To Handle A Woman?", "\"Name the composer, born in Moravia in 1854, whose works include :- The rhapsody \"\"Taras Bulba\"\" and the opera \"\"The Beginning of a romance\"\"?\"" ]
15
[ 38865, 38866, 38867, 38868, 38869, 38870, 38871, 38872, 38873, 38874, 38875, 38876, 38877, 38878, 38879 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What animal was the symbol of freedom in ancient Rome?\nQuestion 2: Which composer wrote the operas 'Lohengrin' and 'Tannhauser'?\nQuestion 3: The lines on the Lisbon Metro are identified by colours. What colour is Linha Amarela?\nQuestion 4: Who in Greek mythology was the cupbearer to the gods and Goddess of eternal youth and was later replaced by Ganymede?\nQuestion 5: Who was the father of Romulus and Remus?\nQuestion 6: In which English city would you find The Mathematical Bridge?\nQuestion 7: Lcio Costa was the principal urban planner, Oscar Niemeyer was the principal architect, and Roberto Burle Marx was the landscape designer for which purpose-built capital city?\nQuestion 8: According to popular songs which bird flew over the rainbow and the white cliffs of Dover\nQuestion 9: Which football club have appeared in 13 FA Cup finals, winning five and losing eight their first final appearance was in 1893 ?\nQuestion 10: What is the name of the prehistoric figure, of a man holding a club, that is carved into the chalk near Dorchester, England?\nQuestion 11: Which Scottish patriot was executed in 1305?\nQuestion 12: What is stolen in over half of the UK’s robberies?\nQuestion 13: Catherine de Medici was the wife of which French monarch?\nQuestion 14: \"Who said \"\"Only two things are infinite, the universe and human stupidity, and I'm not sure about the former\"\"?\"\nQuestion 15: The Four Noble truths are a key feature of which religion?", "role": "user" } ]
["[\"Housecat\", \"Felis Silvestris Catus\", \"Cats have 9 lives\", \"Moggies\", \"Moggie\", \"Felis Catus\", \"Alley-cat\", \"\\ud83d\\udc08\", \"Felis domesticus catus\", \"Cats\", \"House cat\", \"Domestic Feline\", \"Evening Crazies\", \"Common housecat\", \"Domestic cat\", \"Domestic cats\", \"Felis silverstris catus\", \"Tom (cat)\", \"Asocial Aggression\", \"A Cat\", \"Domestic housecats\", \"Feline Asocial Aggression\", \"Felix domesticus\", \"\\ud83d\\udc31\", \"Cat (animal)\", \"Moggy\", \"Felis domesticus\", \"House Cat\", \"\\ud83d\\ude3b\", \"Midnight crazies\", \"Felis silvestris catus\", \"Felis cattus\", \"Domestic Cat\", \"House cats\", \"Goyang-i\", \"Domesticated cat\", \"Goyangi\", \"Felis familiaris\", \"Cat\", \"Felis sylvestris catus\", \"Felis cattus domesticus\", \"Felis catus domesticus\", \"Cat poison\", \"Feline sexual behavior\", \"Cat baths\", \"Housecats\", \"F. catus\", \"Domestic Cats\", \"Felis catus\", \"Pet cat\", \"F. domesticus\", \"Felis silvestris domesticus\", \"Felis catus Domesticus\", \"Domestic feline\"]", "[\"Wagner's\", \"Wilhelm Richard Wagner\", \"W. Richard Wagner\", \"Wagnerian opera\", \"W. R. Wagner\", \"Wagnerian\", \"Wagner\", \"Richard Wagnerr\", \"R Wagner\", \"Ricard Wagner\", \"R.Wagner\", \"RICHARD WAGNER\", \"Richard Wagner\"]", "[\"Yellowest\", \"Whiteyellow\", \"Yelow\", \"Yellow color\", \"Yellowishness\", \"Yellower\", \"White-yellow\", \"Rgb(255, 255, 0)\", \"Dark yellow\", \"Yellowwhite\", \"Symbolism of yellow\", \"Yellow (color)\", \"Yellow (colour)\", \"Yellowy\", \"Yellow white\", \"Yellowishly\", \"White yellow\", \"Yellow (Colour)\", \"(255, 255, 0)\", \"Yellow\", \"Royal yellow\", \"Yellow-white\"]", "[\"Hebe (disambiguation)\", \"Hebe\", \"HEBE\"]", "[\"Fourth planet\", \"Sol 4\", \"Mars surface features\", \"Mars\", \"Mars/Planet\", \"Hydrology of Mars\", \"Magnetosphere of Mars\", \"Marte (planet)\", \"Mars (planet)\", \"Sol-4\", \"2003 opposition of Mars\", \"4th planet\", \"Planet Mars\", \"Sun e\", \"Sol e\", \"Mars (Planet)\", \"Physical characteristics of Mars\", \"Mars opposition\", \"Sol IV\", \"Oblate Mars\", \"Opposition of Mars\", \"Mars orbit\"]", "[\"Cambridge, United Kingdom\", \"Cambridge, UK\", \"CAMBRIDGE\", \"Cantabrigiae\", \"The weather in Cambridge\", \"Christ's Piece\", \"Caergrawnt\", \"Cambridge, East Anglia\", \"England Cambridge\", \"UN/LOCODE:GBCMG\", \"Cambridge, Cambridgeshire\", \"Cambridge (England)\", \"Cambridge\", \"Park Street Church of England Primary School\", \"Cambridge, England\", \"Grantabridge\"]", "[\"Bras\\u00edlia\", \"UN/LOCODE:BRBSB\", \"Brasilia\", \"Capital of brazil\", \"Brasilea\", \"Braz\\u00edliav\\u00e1ros\", \"Brazillia\", \"Braz\\u00edlia\", \"Brazilia\", \"Braziliavaros\", \"Brasillia\", \"Bras\\u00edlia, Brazil\", \"Brasilia, Brazil\", \"Bras%5CxC3%5CxADlia\", \"Bras\\u00edlia DF\", \"Bras\\u00edlia, DF\"]", "[\"Sialia\", \"Blue bird\", \"Bluebird\", \"Bluebirds\"]", "[\"Everton\", \"Everton (disambiguation)\", \"EVERTON\"]", "[\"Cerne man\", \"Trendle Hill\", \"Cerne giant\", \"Cerne Giant\", \"The Cerne Giant\", \"Rude Man\", \"Cerne abbas giant\", \"Cerne Abbas giant\", \"Cerne Abbas Giant\"]", "[\"Wallace's Larder\", \"Battle of Loudoun Hill (1297)\", \"Loudoun Hill Skirmish\", \"Uilleam Uallas\", \"Guillelmum le Walois\", \"Sir William Wallace\", \"Battle of elcho park\", \"William Wallace\", \"W. Wallace\", \"Guillelmum le Walois de Scotia militem\", \"William walles\", \"Guillelmum le Walois de Scotia\", \"Willliam wallace\"]", "[\"Cellular telephone\", \"Mobile telephones\", \"Mobile terminal\", \"Hand phone\", \"Mobile Phone\", \"Cellular phone\", \"Cellular device\", \"Mobile phones\", \"Mobile Telephone\", \"Celphone\", \"Mobile handset\", \"Hand phones\", \"Celluar telephone\", \"Cell Phone\", \"Mobile wireless communication\", \"Flip fone\", \"Mobile phone dance\", \"GSM phone\", \"Mobile wireless\", \"Cellphones\", \"Mobile cellular wireless\", \"Cellular Radio\", \"Mobile screen\", \"Mobile telephone\", \"Mobile phone\", \"Secret cell phone\", \"Phone dance\", \"0-G\", \"Mobile loop\", \"Cell phone\", \"Mobile handsets\", \"Cellular Telephone Technology\", \"Cellphone\", \"Mobilephone\", \"Cell Phones\", \"Cellular radio\", \"Cell phone dance\", \"Mobil phone\", \"Mobile telecom\", \"Mobile Phones\", \"Cellular telephones\", \"Mobile dance\", \"Cellphone video\", \"Cellular Telephone\", \"Cell telephones\", \"Flipfone\", \"Radio Common Carrier\", \"Hand Phone\", \"Cellular phones\", \"Hand telephone\", \"Cellular communication standard\", \"Mobile cellular\", \"Cell phones\", \"Wireless phone\", \"Mobile display\", \"Handphones\", \"Cell telephone\", \"Handphone\", \"\\ud83d\\udcf1\", \"Cell-phone\", \"Mobil Phone\", \"Environmental impact of mobile phones\", \"Cell phone carrier\", \"Mobile communication standard\", \"Cellular communication\", \"Hand telephones\", \"Kosher phone\", \"Cellular mobile\"]", "[\"Henry II\", \"Henry ii\", \"Enrico II\", \"Enrique II\", \"Heinrich II\", \"Henri II\", \"Hendrik II\", \"Henry 2\", \"Henry Ii\", \"Henry the Second\", \"Henry II (disambiguation)\", \"King Henry II\"]", "[\"Albert Enstien\", \"A Tribute to Einstein\", \"Albert Einstien\", \"Einstein (physicist)\", \"Einsetein\", \"Albert Einstin\", \"Einstien\", \"Albert Eienstein\", \"Albert Einstein\", \"Einstein, Albert\", \"Albert Enstein\", \"Einsteinian\", \"Alber Enstien\", \"Albert Einstein's\", \"Einstein\", \"Einstien, Albert\", \"A. Einstein\", \"Al Einstein\", \"Albert einstein\", \"Alber Einstein\"]", "[\"B\\u00fadachas\", \"Buddhadharma\", \"Buddhadhamma\", \"Buddhism in Asia\", \"Budddhism\", \"Buddhist\", \"Budddhist\", \"Buddhist Saying\", \"Buddhism\", \"Buddha's gospel\", \"Buddh\", \"Dhamma-Vinaya\", \"Bouddhism\", \"Bhuudis\", \"Buddhisam\", \"Budhism\", \"Budhda birth date controversies\", \"BuddhIsm\", \"Buddha birth date controversies\", \"BuddHism\", \"Buddhists\", \"Buhhdism\", \"Dhamma-vinaya\", \"Buddhity\", \"Buddha Dharma\", \"Buddhasasana\", \"Budhist\", \"Bauddhadharma\", \"The teaching of the Buddha\", \"Dhammavinaya\", \"Buddhism religion\", \"Buddhaity\", \"Superbuddha\", \"Budism\", \"Buddist\", \"Buddhisem\", \"Buddism\", \"\\u0411\\u0443\\u0434\\u0438\\u0437\\u044a\\u043c\", \"Boudhism\", \"Bhuddist\", \"Dhamma Vinaya\", \"Buddha Dhamma\", \"Buddhist religious philosophy\", \"BUDDHISM\", \"Budddhists\", \"Bhuddism\", \"Three levels of suffering\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Housecat\", \"Felis Silvestris Catus\", \"Cats have 9 lives\", \"Moggies\", \"Moggie\", \"Felis Catus\", \"Alley-cat\", \"\\ud83d\\udc08\", \"Felis domesticus catus\", \"Cats\", \"House cat\", \"Domestic Feline\", \"Evening Crazies\", \"Common housecat\", \"Domestic cat\", \"Domestic cats\", \"Felis silverstris catus\", \"Tom (cat)\", \"Asocial Aggression\", \"A Cat\", \"Domestic housecats\", \"Feline Asocial Aggression\", \"Felix domesticus\", \"\\ud83d\\udc31\", \"Cat (animal)\", \"Moggy\", \"Felis domesticus\", \"House Cat\", \"\\ud83d\\ude3b\", \"Midnight crazies\", \"Felis silvestris catus\", \"Felis cattus\", \"Domestic Cat\", \"House cats\", \"Goyang-i\", \"Domesticated cat\", \"Goyangi\", \"Felis familiaris\", \"Cat\", \"Felis sylvestris catus\", \"Felis cattus domesticus\", \"Felis catus domesticus\", \"Cat poison\", \"Feline sexual behavior\", \"Cat baths\", \"Housecats\", \"F. catus\", \"Domestic Cats\", \"Felis catus\", \"Pet cat\", \"F. domesticus\", \"Felis silvestris domesticus\", \"Felis catus Domesticus\", \"Domestic feline\"]", "[\"Wagner's\", \"Wilhelm Richard Wagner\", \"W. Richard Wagner\", \"Wagnerian opera\", \"W. R. Wagner\", \"Wagnerian\", \"Wagner\", \"Richard Wagnerr\", \"R Wagner\", \"Ricard Wagner\", \"R.Wagner\", \"RICHARD WAGNER\", \"Richard Wagner\"]", "[\"Yellowest\", \"Whiteyellow\", \"Yelow\", \"Yellow color\", \"Yellowishness\", \"Yellower\", \"White-yellow\", \"Rgb(255, 255, 0)\", \"Dark yellow\", \"Yellowwhite\", \"Symbolism of yellow\", \"Yellow (color)\", \"Yellow (colour)\", \"Yellowy\", \"Yellow white\", \"Yellowishly\", \"White yellow\", \"Yellow (Colour)\", \"(255, 255, 0)\", \"Yellow\", \"Royal yellow\", \"Yellow-white\"]", "[\"Hebe (disambiguation)\", \"Hebe\", \"HEBE\"]", "[\"Fourth planet\", \"Sol 4\", \"Mars surface features\", \"Mars\", \"Mars/Planet\", \"Hydrology of Mars\", \"Magnetosphere of Mars\", \"Marte (planet)\", \"Mars (planet)\", \"Sol-4\", \"2003 opposition of Mars\", \"4th planet\", \"Planet Mars\", \"Sun e\", \"Sol e\", \"Mars (Planet)\", \"Physical characteristics of Mars\", \"Mars opposition\", \"Sol IV\", \"Oblate Mars\", \"Opposition of Mars\", \"Mars orbit\"]", "[\"Cambridge, United Kingdom\", \"Cambridge, UK\", \"CAMBRIDGE\", \"Cantabrigiae\", \"The weather in Cambridge\", \"Christ's Piece\", \"Caergrawnt\", \"Cambridge, East Anglia\", \"England Cambridge\", \"UN/LOCODE:GBCMG\", \"Cambridge, Cambridgeshire\", \"Cambridge (England)\", \"Cambridge\", \"Park Street Church of England Primary School\", \"Cambridge, England\", \"Grantabridge\"]", "[\"Bras\\u00edlia\", \"UN/LOCODE:BRBSB\", \"Brasilia\", \"Capital of brazil\", \"Brasilea\", \"Braz\\u00edliav\\u00e1ros\", \"Brazillia\", \"Braz\\u00edlia\", \"Brazilia\", \"Braziliavaros\", \"Brasillia\", \"Bras\\u00edlia, Brazil\", \"Brasilia, Brazil\", \"Bras%5CxC3%5CxADlia\", \"Bras\\u00edlia DF\", \"Bras\\u00edlia, DF\"]", "[\"Sialia\", \"Blue bird\", \"Bluebird\", \"Bluebirds\"]", "[\"Everton\", \"Everton (disambiguation)\", \"EVERTON\"]", "[\"Cerne man\", \"Trendle Hill\", \"Cerne giant\", \"Cerne Giant\", \"The Cerne Giant\", \"Rude Man\", \"Cerne abbas giant\", \"Cerne Abbas giant\", \"Cerne Abbas Giant\"]", "[\"Wallace's Larder\", \"Battle of Loudoun Hill (1297)\", \"Loudoun Hill Skirmish\", \"Uilleam Uallas\", \"Guillelmum le Walois\", \"Sir William Wallace\", \"Battle of elcho park\", \"William Wallace\", \"W. Wallace\", \"Guillelmum le Walois de Scotia militem\", \"William walles\", \"Guillelmum le Walois de Scotia\", \"Willliam wallace\"]", "[\"Cellular telephone\", \"Mobile telephones\", \"Mobile terminal\", \"Hand phone\", \"Mobile Phone\", \"Cellular phone\", \"Cellular device\", \"Mobile phones\", \"Mobile Telephone\", \"Celphone\", \"Mobile handset\", \"Hand phones\", \"Celluar telephone\", \"Cell Phone\", \"Mobile wireless communication\", \"Flip fone\", \"Mobile phone dance\", \"GSM phone\", \"Mobile wireless\", \"Cellphones\", \"Mobile cellular wireless\", \"Cellular Radio\", \"Mobile screen\", \"Mobile telephone\", \"Mobile phone\", \"Secret cell phone\", \"Phone dance\", \"0-G\", \"Mobile loop\", \"Cell phone\", \"Mobile handsets\", \"Cellular Telephone Technology\", \"Cellphone\", \"Mobilephone\", \"Cell Phones\", \"Cellular radio\", \"Cell phone dance\", \"Mobil phone\", \"Mobile telecom\", \"Mobile Phones\", \"Cellular telephones\", \"Mobile dance\", \"Cellphone video\", \"Cellular Telephone\", \"Cell telephones\", \"Flipfone\", \"Radio Common Carrier\", \"Hand Phone\", \"Cellular phones\", \"Hand telephone\", \"Cellular communication standard\", \"Mobile cellular\", \"Cell phones\", \"Wireless phone\", \"Mobile display\", \"Handphones\", \"Cell telephone\", \"Handphone\", \"\\ud83d\\udcf1\", \"Cell-phone\", \"Mobil Phone\", \"Environmental impact of mobile phones\", \"Cell phone carrier\", \"Mobile communication standard\", \"Cellular communication\", \"Hand telephones\", \"Kosher phone\", \"Cellular mobile\"]", "[\"Henry II\", \"Henry ii\", \"Enrico II\", \"Enrique II\", \"Heinrich II\", \"Henri II\", \"Hendrik II\", \"Henry 2\", \"Henry Ii\", \"Henry the Second\", \"Henry II (disambiguation)\", \"King Henry II\"]", "[\"Albert Enstien\", \"A Tribute to Einstein\", \"Albert Einstien\", \"Einstein (physicist)\", \"Einsetein\", \"Albert Einstin\", \"Einstien\", \"Albert Eienstein\", \"Albert Einstein\", \"Einstein, Albert\", \"Albert Enstein\", \"Einsteinian\", \"Alber Enstien\", \"Albert Einstein's\", \"Einstein\", \"Einstien, Albert\", \"A. Einstein\", \"Al Einstein\", \"Albert einstein\", \"Alber Einstein\"]", "[\"B\\u00fadachas\", \"Buddhadharma\", \"Buddhadhamma\", \"Buddhism in Asia\", \"Budddhism\", \"Buddhist\", \"Budddhist\", \"Buddhist Saying\", \"Buddhism\", \"Buddha's gospel\", \"Buddh\", \"Dhamma-Vinaya\", \"Bouddhism\", \"Bhuudis\", \"Buddhisam\", \"Budhism\", \"Budhda birth date controversies\", \"BuddhIsm\", \"Buddha birth date controversies\", \"BuddHism\", \"Buddhists\", \"Buhhdism\", \"Dhamma-vinaya\", \"Buddhity\", \"Buddha Dharma\", \"Buddhasasana\", \"Budhist\", \"Bauddhadharma\", \"The teaching of the Buddha\", \"Dhammavinaya\", \"Buddhism religion\", \"Buddhaity\", \"Superbuddha\", \"Budism\", \"Buddist\", \"Buddhisem\", \"Buddism\", \"\\u0411\\u0443\\u0434\\u0438\\u0437\\u044a\\u043c\", \"Boudhism\", \"Bhuddist\", \"Dhamma Vinaya\", \"Buddha Dhamma\", \"Buddhist religious philosophy\", \"BUDDHISM\", \"Budddhists\", \"Bhuddism\", \"Three levels of suffering\"]" ]
[ "What animal was the symbol of freedom in ancient Rome?", "Which composer wrote the operas 'Lohengrin' and 'Tannhauser'?", "The lines on the Lisbon Metro are identified by colours. What colour is Linha Amarela?", "Who in Greek mythology was the cupbearer to the gods and Goddess of eternal youth and was later replaced by Ganymede?", "Who was the father of Romulus and Remus?", "In which English city would you find The Mathematical Bridge?", "Lcio Costa was the principal urban planner, Oscar Niemeyer was the principal architect, and Roberto Burle Marx was the landscape designer for which purpose-built capital city?", "According to popular songs which bird flew over the rainbow and the white cliffs of Dover", "Which football club have appeared in 13 FA Cup finals, winning five and losing eight their first final appearance was in 1893 ?", "What is the name of the prehistoric figure, of a man holding a club, that is carved into the chalk near Dorchester, England?", "Which Scottish patriot was executed in 1305?", "What is stolen in over half of the UK’s robberies?", "Catherine de Medici was the wife of which French monarch?", "\"Who said \"\"Only two things are infinite, the universe and human stupidity, and I'm not sure about the former\"\"?\"", "The Four Noble truths are a key feature of which religion?" ]
15
[ 43095, 43096, 43097, 43098, 43099, 43100, 43101, 43102, 43103, 43104, 43105, 43106, 43107, 43108, 43109 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: There are three colours on the flag of Madagascar, red, white and which other colour?\nQuestion 2: Which species of bird can be Reed, Corn or Cirl?\nQuestion 3: In 1803, which European country was the first to outlaw slavery?\nQuestion 4: In which film is the murder of Miriam Haines seen reflected in her (dropped) spectacles?\nQuestion 5: Which artist did Valerie Solanas shoot and wound in New York in 1968?\nQuestion 6: Harold Pinter's play Betrayal was inspired by his seven-year affair in the 1960s with which BBC TV presenter, referred to by Frank Muir as 'the thinking man's crumpet'?\nQuestion 7: The now defunct food hamper firm Farepak was based in which city?\nQuestion 8: Coventry Cathedra! is dedicated to which Saint?\nQuestion 9: Which light-heavyweight boxer won a gold medal when he competed at an Olympic Games for the first time in 1960 at Rome?\nQuestion 10: The hamadryas is a species of which monkey?\nQuestion 11: In Greek mythology who was the husband of Hecuba?\nQuestion 12: Which position is currently held by Liam Donaldson?\nQuestion 13: Used during World War I, what is a Sopwith Camel?\nQuestion 14: What country does the name Pádraig come from?\nQuestion 15: Who directed the 2002 film 'The Pianist'?", "role": "user" } ]
["[\"Green (crater)\", \"Green (song)\", \"Green (disambiguation)\", \"GREEN\", \"GREEN (disambiguation)\", \"Green (album)\"]", "[\"Bunting\", \"Bunting (disambiguation)\", \"BUNTING\"]", "[\"Eastern Denmark\", \"Kingdom of denmark\", \"Denmarke\", \"Subdivisions of Denmark\", \"Kongeriget Danmark\", \"Mainland Denmark\", \"Danmoerk\", \"Denmark proper\", \"Danimarca\", \"ISO 3166-1:DK\", \"Denmark\", \"D\\u00e4nemark\", \"Danska\", \"Denmarc\", \"KingdomOfDenmark\", \"DENMARK\", \"Kingdom of Denmark\", \"Denemarke\", \"Administrative divisions of denmark\", \"Danish kingdom\", \"Danemark\", \"Daenemark\", \"Media in Denmark\", \"Danm\\u00f6rk\", \"DenmarK\", \"Danmork\", \"Administrative divisions of Denmark\", \"Media of Denmark\", \"Danish Kingdom\", \"Dinamarca\"]", "[\"Strangers on a Train (disambiguation)\", \"Strangers On A Train\", \"Strangers on a train\", \"Strangers On a Train\", \"Strangers on a Train\"]", "[\"Andy Warhaul\", \"Warhol\", \"Warholian Pop\", \"Andy Warhola\", \"Andrew warhola\", \"Andy Warhol Foundation for the Visual Arts\", \"Warholite\", \"Andy warhol\", \"Drella\", \"Andrew Warhol\", \"Andy Wahrol\", \"Andy worhol\", \"Andrew Warhola\", \"Andy Warhol Foundation\", \"Warholesque\", \"Warholian\", \"Warhol Foundation\", \"Andy Warhol\", \"Paul Warhola\"]", "[\"Joan Dawson Bakewell\", \"Joan Bakewell, Baroness Bakewell\", \"Baroness Bakewell\", \"Joan Bakewell\", \"Dame Joan Bakewell\"]", "[\"Swindon, Wiltshire\", \"Swindon, England\", \"Kingsdown, Wiltshire\", \"Swindon UA\", \"Swindon\", \"The weather in Swindon\"]", "[\"Michael (archangel)\", \"Michael Archangel\", \"S Michele Arcangelo\", \"Mikail\", \"S. Michele Arcangelo\", \"Michael, Military Orders of Saint\", \"St. Michael\", \"Viceroy of Heaven\", \"Archistratege of God\", \"San Michele Arcangelo\", \"Michael (angel)\", \"Archangel Michael\", \"St Michael the Archangel\", \"Aran\\u0111elovdan\", \"Military Orders of Saint Michael\", \"S. Michele\", \"ST. MICHAEL THE ARCHANGEL\", \"S. Michele arcangelo\", \"St.Michael\", \"St. Michael Catholic Church\", \"St Michael\", \"Michael the Archangel\", \"San Michele arcangelo\", \"Saint Michael the Archangel\", \"The Advocate of the Jews\", \"Taxiarch Michael\", \"Michael the Archangel, Saint\", \"Michael of Nebadon\", \"Saint Michael\", \"S Michele\", \"S Michele arcangelo\", \"Saint Michael, the Archangel\", \"Taxiarch Archangel Michael\", \"Michael the archangel\", \"St. Michael, the Archangel\", \"Angel Michael\", \"St. Michael the Archangel\", \"Michael (Angel)\", \"Islamic view of Michael\", \"Prince of Israel\", \"M\\u00eekh\\u0101\\u2019\\u0113l\"]", "[\"Float like a butter fly sting like a bee\", \"Louisville lip\", \"Ali shuffle\", \"Float like a butterfly and sting like a bee\", \"Cassius Marcellus Clay Junior\", \"Muhummad Ali\", \"Maryum Ali\", \"Cassius X\", \"Cassius Marcellus Clay, Junior\", \"Louisville Lip\", \"Muhammad Ali\", \"Muhammud Ali\", \"Khalilah 'Belinda' Ali\", \"Cassius Clay Junior\", \"Float like a butterfly sting like a bee\", \"Muhammad Ali (boxer)\", \"Cassius Marcellus Clay, Jr.\", \"Sonji Roi\", \"Ale Muhammad\", \"Cassius Marcellus Clay, Jr\", \"Cassius Marcellus Clay Jr.\", \"Cassius Marcellus Clay (Muhammad Ali)\", \"Cassius Clay, Junior\", \"Mohammed Al\\u00ec\", \"Cassius Marcellus Clay Jr\", \"Muhamad Ali\", \"Yolanda Williams\", \"I am the greatest!\", \"Ali, Muhammad\", \"Cassius Clay\", \"Muhammet ali\", \"Yolanda 'Lonnie' Ali\", \"I am the greatest\", \"Cassius Clay, Jr.\", \"Muhammed Ali\", \"Cassius Clay Jr\", \"Cassius clay\", \"Lonnie Ali\", \"Cassius Clay, Jr\", \"May May\"]", "[\"Baboon\", \"Papio\", \"Comopithecus\", \"Babboon\", \"Baboons\"]", "[\"Priam of Troy\", \"Priamos\", \"Priam\", \"\\u03a0\\u03c1\\u03af\\u03b1\\u03bc\\u03bf\\u03c2\", \"Priimuua\", \"Exceptionally courageous\", \"Priamus\"]", "[\"CHIEF MEDICAL OFFICER OF ENGLAND\"]", "[\"The plane\", \"Plane (Mathematics)\", \"Plane (mathematics)\", \"Plane (geometry)\", \"Infinite Plane\", \"Infinite plane\", \"Mathematical plane\", \"A plane\", \"Intersection of two planes\", \"Plane (physics)\"]", "[\"Irlanda\", \"Island ireland\", \"Ireland (region)\", \"Irlandia\", \"Erin's Isle\", \"Airlan\", \"Ireland\", \"West Coast of Ireland\", \"The island of Ireland\", \"Island Ireland\", \"Ireland (island)\", \"Irland\", \"H\\u00c9ireann\", \"Ireland Ulster\", \"Population of Ireland\", \"Irelander\", \"Ireland and Ulster\", \"Ireland (Island)\", \"IRELAND\", \"Symbol of Ireland\", \"Scotia major\", \"Island of Ireland\", \"Airlann\", \"Mikra Britannia\", \"Irelanders\", \"Auld Sod\", \"Ierne (placename)\"]", "[\"Roman Polanski filmography\", \"Polanski, Roman\", \"Zaczarowany rower\", \"Roman polanski\", \"Rajmund Roman Liebling\", \"Pola\\u0144ski\", \"Roman Pulanski\", \"Polanski\", \"Roman Polanksi\", \"Roman Polanski\", \"Roman Polansky\", \"ROMAN POLANSKI\", \"Roman Pola\\u0144ski\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Green (crater)\", \"Green (song)\", \"Green (disambiguation)\", \"GREEN\", \"GREEN (disambiguation)\", \"Green (album)\"]", "[\"Bunting\", \"Bunting (disambiguation)\", \"BUNTING\"]", "[\"Eastern Denmark\", \"Kingdom of denmark\", \"Denmarke\", \"Subdivisions of Denmark\", \"Kongeriget Danmark\", \"Mainland Denmark\", \"Danmoerk\", \"Denmark proper\", \"Danimarca\", \"ISO 3166-1:DK\", \"Denmark\", \"D\\u00e4nemark\", \"Danska\", \"Denmarc\", \"KingdomOfDenmark\", \"DENMARK\", \"Kingdom of Denmark\", \"Denemarke\", \"Administrative divisions of denmark\", \"Danish kingdom\", \"Danemark\", \"Daenemark\", \"Media in Denmark\", \"Danm\\u00f6rk\", \"DenmarK\", \"Danmork\", \"Administrative divisions of Denmark\", \"Media of Denmark\", \"Danish Kingdom\", \"Dinamarca\"]", "[\"Strangers on a Train (disambiguation)\", \"Strangers On A Train\", \"Strangers on a train\", \"Strangers On a Train\", \"Strangers on a Train\"]", "[\"Andy Warhaul\", \"Warhol\", \"Warholian Pop\", \"Andy Warhola\", \"Andrew warhola\", \"Andy Warhol Foundation for the Visual Arts\", \"Warholite\", \"Andy warhol\", \"Drella\", \"Andrew Warhol\", \"Andy Wahrol\", \"Andy worhol\", \"Andrew Warhola\", \"Andy Warhol Foundation\", \"Warholesque\", \"Warholian\", \"Warhol Foundation\", \"Andy Warhol\", \"Paul Warhola\"]", "[\"Joan Dawson Bakewell\", \"Joan Bakewell, Baroness Bakewell\", \"Baroness Bakewell\", \"Joan Bakewell\", \"Dame Joan Bakewell\"]", "[\"Swindon, Wiltshire\", \"Swindon, England\", \"Kingsdown, Wiltshire\", \"Swindon UA\", \"Swindon\", \"The weather in Swindon\"]", "[\"Michael (archangel)\", \"Michael Archangel\", \"S Michele Arcangelo\", \"Mikail\", \"S. Michele Arcangelo\", \"Michael, Military Orders of Saint\", \"St. Michael\", \"Viceroy of Heaven\", \"Archistratege of God\", \"San Michele Arcangelo\", \"Michael (angel)\", \"Archangel Michael\", \"St Michael the Archangel\", \"Aran\\u0111elovdan\", \"Military Orders of Saint Michael\", \"S. Michele\", \"ST. MICHAEL THE ARCHANGEL\", \"S. Michele arcangelo\", \"St.Michael\", \"St. Michael Catholic Church\", \"St Michael\", \"Michael the Archangel\", \"San Michele arcangelo\", \"Saint Michael the Archangel\", \"The Advocate of the Jews\", \"Taxiarch Michael\", \"Michael the Archangel, Saint\", \"Michael of Nebadon\", \"Saint Michael\", \"S Michele\", \"S Michele arcangelo\", \"Saint Michael, the Archangel\", \"Taxiarch Archangel Michael\", \"Michael the archangel\", \"St. Michael, the Archangel\", \"Angel Michael\", \"St. Michael the Archangel\", \"Michael (Angel)\", \"Islamic view of Michael\", \"Prince of Israel\", \"M\\u00eekh\\u0101\\u2019\\u0113l\"]", "[\"Float like a butter fly sting like a bee\", \"Louisville lip\", \"Ali shuffle\", \"Float like a butterfly and sting like a bee\", \"Cassius Marcellus Clay Junior\", \"Muhummad Ali\", \"Maryum Ali\", \"Cassius X\", \"Cassius Marcellus Clay, Junior\", \"Louisville Lip\", \"Muhammad Ali\", \"Muhammud Ali\", \"Khalilah 'Belinda' Ali\", \"Cassius Clay Junior\", \"Float like a butterfly sting like a bee\", \"Muhammad Ali (boxer)\", \"Cassius Marcellus Clay, Jr.\", \"Sonji Roi\", \"Ale Muhammad\", \"Cassius Marcellus Clay, Jr\", \"Cassius Marcellus Clay Jr.\", \"Cassius Marcellus Clay (Muhammad Ali)\", \"Cassius Clay, Junior\", \"Mohammed Al\\u00ec\", \"Cassius Marcellus Clay Jr\", \"Muhamad Ali\", \"Yolanda Williams\", \"I am the greatest!\", \"Ali, Muhammad\", \"Cassius Clay\", \"Muhammet ali\", \"Yolanda 'Lonnie' Ali\", \"I am the greatest\", \"Cassius Clay, Jr.\", \"Muhammed Ali\", \"Cassius Clay Jr\", \"Cassius clay\", \"Lonnie Ali\", \"Cassius Clay, Jr\", \"May May\"]", "[\"Baboon\", \"Papio\", \"Comopithecus\", \"Babboon\", \"Baboons\"]", "[\"Priam of Troy\", \"Priamos\", \"Priam\", \"\\u03a0\\u03c1\\u03af\\u03b1\\u03bc\\u03bf\\u03c2\", \"Priimuua\", \"Exceptionally courageous\", \"Priamus\"]", "[\"CHIEF MEDICAL OFFICER OF ENGLAND\"]", "[\"The plane\", \"Plane (Mathematics)\", \"Plane (mathematics)\", \"Plane (geometry)\", \"Infinite Plane\", \"Infinite plane\", \"Mathematical plane\", \"A plane\", \"Intersection of two planes\", \"Plane (physics)\"]", "[\"Irlanda\", \"Island ireland\", \"Ireland (region)\", \"Irlandia\", \"Erin's Isle\", \"Airlan\", \"Ireland\", \"West Coast of Ireland\", \"The island of Ireland\", \"Island Ireland\", \"Ireland (island)\", \"Irland\", \"H\\u00c9ireann\", \"Ireland Ulster\", \"Population of Ireland\", \"Irelander\", \"Ireland and Ulster\", \"Ireland (Island)\", \"IRELAND\", \"Symbol of Ireland\", \"Scotia major\", \"Island of Ireland\", \"Airlann\", \"Mikra Britannia\", \"Irelanders\", \"Auld Sod\", \"Ierne (placename)\"]", "[\"Roman Polanski filmography\", \"Polanski, Roman\", \"Zaczarowany rower\", \"Roman polanski\", \"Rajmund Roman Liebling\", \"Pola\\u0144ski\", \"Roman Pulanski\", \"Polanski\", \"Roman Polanksi\", \"Roman Polanski\", \"Roman Polansky\", \"ROMAN POLANSKI\", \"Roman Pola\\u0144ski\"]" ]
[ "There are three colours on the flag of Madagascar, red, white and which other colour?", "Which species of bird can be Reed, Corn or Cirl?", "In 1803, which European country was the first to outlaw slavery?", "In which film is the murder of Miriam Haines seen reflected in her (dropped) spectacles?", "Which artist did Valerie Solanas shoot and wound in New York in 1968?", "Harold Pinter's play Betrayal was inspired by his seven-year affair in the 1960s with which BBC TV presenter, referred to by Frank Muir as 'the thinking man's crumpet'?", "The now defunct food hamper firm Farepak was based in which city?", "Coventry Cathedra! is dedicated to which Saint?", "Which light-heavyweight boxer won a gold medal when he competed at an Olympic Games for the first time in 1960 at Rome?", "The hamadryas is a species of which monkey?", "In Greek mythology who was the husband of Hecuba?", "Which position is currently held by Liam Donaldson?", "Used during World War I, what is a Sopwith Camel?", "What country does the name Pádraig come from?", "Who directed the 2002 film 'The Pianist'?" ]
15
[ 49530, 49531, 49532, 49533, 49534, 49535, 49536, 49537, 49538, 49539, 49540, 49541, 49542, 49543, 49544 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: The bossa nova is a type of what more generic dance?\nQuestion 2: The 16th Century Battle of Molodi was fought in which country?\nQuestion 3: \"What is the main ingredient in the Indian drink, \"\"lassi\"\"?\"\nQuestion 4: Which cruise ship sank in the Antarctic in late 2007, after hitting an iceberg?\nQuestion 5: In the human body, what is produced by the Parotid Gland?\nQuestion 6: Bonny light, Forcados, Qua Ibo, and Brass River are types of what major Nigerian export commodity?\nQuestion 7: What were the first names of English author H G Wells?\nQuestion 8: Whose operatic works include Lucia di Lammermoor and Ann Boleyn?\nQuestion 9: Henry VIII suffered a leg injury participating in what sport?\nQuestion 10: Which is the only vein in the body to carry oxygenated blood?\nQuestion 11: Which movie, starring Steve McQueen and Ali MacGraw, was remade with Alec Baldwin and Kim Basinger in the leading roles?\nQuestion 12: Which bird features on the Buckinghamshire flag ?\nQuestion 13: Outside of which building in Whitehall was King Charles I executed?\nQuestion 14: What's the name of the actor who played 'Huggy Bear' in the Starsky and Hutch TV series?\nQuestion 15: Which US state in 1907 was the last to declare Christmas a legal holiday?", "role": "user" } ]
["[\"Samba4\", \"SAMBA\", \"NMBD\", \"Smb.conf\", \"Nmbd\", \"Samba Web Administration Tool\", \"Smbclient\", \"Samba configuration\", \"Libsmb\", \"Samba TNG software\", \"Smbmount\", \"Samba software\", \"Samba TNG\", \"Samba Configuration\", \"Samba (software)\", \"Smbd\", \"SMBD\", \"Samba 4\"]", "[\"Russia (1991-1993)\", \"\\u041e\\u0440\\u043e\\u0441\\u044b\\u043d \\u0425\\u043e\\u043b\\u0431\\u043e\\u043e\\u043d\\u044b \\u0423\\u043b\\u0441\", \"Etymology of Russia\", \"The Russian federation\", \"\\u0420\\u04d9\\u0441\\u04d9\\u0439\", \"ISO 3166-1:RU\", \"Russia (1990-1993)\", \"\\u0420\\u0435\\u0441\\u0435\\u0439\", \"Novaya russia\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0301\\u044f\", \"\\u0420\\u0430\\u04ab\\u04ab\\u0435\\u0439\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0439\\u0441\\u043a\\u0430\\u044f \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0446\\u0438\\u044f\", \"Poccnr\", \"\\u0420\\u043e\\u0441\\u0456\\u044f\", \"\\u041e\\u0440\\u043e\\u0434\\u043e\\u0439 \\u0425\\u043e\\u043b\\u0431\\u043e\\u043e\\u043d\\u043e\\u0439 \\u0423\\u043b\\u0430\\u0441\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0438\", \"The Russian Federation\", \"Russsia\", \"Russian (citizen)\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0301\\u0439\\u0441\\u043a\\u0430\\u044f \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0301\\u0446\\u0438\\u044f\", \"\\u0423\\u0440\\u044b\\u0441\\u0435\\u0439\", \"\\u0410\\u0440\\u0430\\u0441\\u0441\\u044b\\u044b\\u0439\\u0430\", \"Rossiyskaya Federatsiya\", \"\\u041e\\u044c\\u0440\\u0441\\u0438\\u0439\\u043d \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0446\\u0438\\u0439\", \"Russian-born\", \"\\u0410\\u044c\\u0440\\u0430\\u0441\\u0430\\u0442\", \"Russia (Federation)\", \"POCCNR\", \"Northern Russia\", \"Federation of Russia\", \"Russia (country)\", \"\\u0420\\u043e\\u0447\\u043c\\u0443\", \"\\u0420\\u0435\\u0441\\u0435\\u0439 \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0446\\u0438\\u044f\\u0441\\u044b\", \"Venaja\", \"\\u0420\\u0443\\u0441\\u0438\\u044f\", \"\\u0423\\u0440\\u044b\\u0441\\u0442\\u04d9\\u044b\\u043b\\u0430\", \"Resey\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u044f\", \"Wildlife of Russia\", \"The Country Russia\", \"\\u0423\\u00e6\\u0440\\u00e6\\u0441\\u0435\", \"Venaejae\", \"Russian federation\", \"Russie\", \"Russia\", \"Rossijskaja Federatsija\", \"RUSSIA\", \"Ryssland\", \"Russian Federation\", \"Russiya\", \"\\u0420\\u0443\\u0441\\u0438\\u0458\\u0430\", \"RusSia\", \"\\u041e\\u0440\\u0441\\u0438\\u043d \\u041d\\u0438\\u0438\\u0446\\u04d9\\u043d\", \"Russland\", \"\\u0420\\u0443\\u0437\\u043c\\u0430\\u0441\\u0442\\u043e\\u0440\", \"RussiA\"]", "[\"Drinkable yogurt\", \"Yogurt Ice-cream\", \"Sweetened yogurt\", \"Yoghurd\", \"Maast\", \"Yogu\", \"Yogurt\", \"Yoghurt\", \"Joghourt\", \"Zabady\", \"Yoghourt\", \"Jogurt\", \"Yogurt maker\", \"Youghurt\", \"Yogourt\", \"Yougert\", \"Bulgarian yogurt (Kiselo mlyako)\", \"Yoghurt smoothie\", \"Yo\\u011furt\", \"Fruit bottom\", \"YOGHURT\", \"Yahourt\", \"Drinkable yoghurt\", \"Joghurt\", \"Yogurt smoothie\", \"Bulgarian yogurt\", \"Sweetened Yogurt\", \"Yaghourt\"]", "[\"M/S Explorer\", \"MV Explorer\", \"Ms explorer\", \"MS Explorer\", \"M/V Explorer\"]", "[\"Saccharidase\", \"Saliva\", \"Spittle\", \"George the Volcano\", \"Salivary proteins\", \"Salivate\", \"SALIVA\", \"Mouth water\", \"Salivation\", \"Ptysma\"]", "[\"Alternatives to petroleum\", \"Black gold (Oil)\", \"Petroplitics\", \"Petroleum maturation\", \"Crude petroleum\", \"Petroleum\", \"Brend Blend\", \"Petroleum-based fuel\", \"Oil producing countries\", \"Petro-diesel\", \"Oil - Enviromental Impact\", \"Liquid petroleum\", \"Petroleum vehicle\", \"Vehicle fuel\", \"Petroleum generation\", \"Conventional vehicle\", \"Black gold (oil)\", \"Fossil-oil\", \"Petrolet\", \"Medium fuel oil\", \"Petroleum fuels\", \"Petrofuel\", \"Petrolium\", \"Petroleum accumulation\", \"World oil consumption\", \"Petroholic\", \"Petroleum fuel\", \"Gas distribution\", \"Petroleum car\", \"Crude oil\", \"Raw oil\", \"Pan-petroliferous\", \"All-petroleum vehicle\", \"Used Oil\", \"Petro-state\", \"Environmental effects of petroleum\", \"All-petroleum\", \"Formation of petroleum\", \"Black gold (liquid)\", \"Crude Oil\", \"Petroleum fuel vehicle\", \"Patrolium\", \"Conventional oil\", \"Raw petroleum\", \"Pampetro\", \"Petrol oil\", \"Petrostate\", \"Petrofree\", \"Fossil oil\", \"History of Petroleum\"]", "[\"Herbert George\"]", "[\"Gaetano Donizetti\", \"Operas by Gaetano Donizetti\", \"Donnizetti\", \"Gaetano donizetti\", \"Donizetti\", \"Domenico Gaetano Maria Donizetti\"]", "[\"Competitive jousting\", \"List (jousting)\", \"Jousting lance\", \"Jousts\", \"Jousting\", \"Joust\", \"List field\", \"Stechen\", \"Renaissance-era jousting\", \"Lists (jousting)\"]", "[\"Left superior pulmonary vein\", \"Pulmonary veins\", \"Right superior pulmonary vein\", \"Superior pulmonary vein\", \"Right pulmonary vein\", \"Ven\\u00e6 pulmonales\", \"Pulmonary vein\", \"Pulmonary Veins\", \"Left inferior pulmonary vein\", \"Venae pulmonales\", \"Superior pulmonary\", \"Right inferior pulmonary vein\", \"Pulmonary Vein\", \"Inferior pulmonary vein\", \"Inferior pulmonary\"]", "[\"The Getaway (disambiguation)\", \"The Getaway (Video Game)\", \"Getaway (video game)\", \"The getaway 3\", \"The Getaway Working Title\", \"The getaway\", \"The Getaway Working Tittle\", \"The Getaway\", \"The Getaway (series)\", \"The Getaway (film)\", \"The Getaway (game)\", \"The Getaway (cancelled video game)\", \"List of gangs in The Getaway\"]", "[\"The White Swan\", \"WHITE SWAN\", \"Vere Street Coterie\"]", "[\"The Banqueting House\", \"The Banqueting House (disambiguation)\"]", "[\"Antonio Fargas\"]", "[\"Okla.\", \"Oklahoma\", \"Oklahoma, United States\", \"Sooner State\", \"Forty-Sixth State\", \"Religion in Oklahoma\", \"Culture of Oklahoma\", \"46th State\", \"Oklahoma (U.S. state)\", \"Oklahoma, USA\", \"State of Oklahoma\", \"List of Oklahoma State Symbols\", \"Oaklahoma\", \"Oklaholma\", \"Transportation in Oklahoma\", \"US-OK\", \"Sports in Oklahoma\", \"Okla\", \"Oklahoman\", \"Oclahoma\", \"Education in Oklahoma\", \"Energy in Oklahoma\", \"Transport in Oklahoma\", \"Forty-sixth State\", \"Oklahoma (state)\", \"The Sooner State\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Samba4\", \"SAMBA\", \"NMBD\", \"Smb.conf\", \"Nmbd\", \"Samba Web Administration Tool\", \"Smbclient\", \"Samba configuration\", \"Libsmb\", \"Samba TNG software\", \"Smbmount\", \"Samba software\", \"Samba TNG\", \"Samba Configuration\", \"Samba (software)\", \"Smbd\", \"SMBD\", \"Samba 4\"]", "[\"Russia (1991-1993)\", \"\\u041e\\u0440\\u043e\\u0441\\u044b\\u043d \\u0425\\u043e\\u043b\\u0431\\u043e\\u043e\\u043d\\u044b \\u0423\\u043b\\u0441\", \"Etymology of Russia\", \"The Russian federation\", \"\\u0420\\u04d9\\u0441\\u04d9\\u0439\", \"ISO 3166-1:RU\", \"Russia (1990-1993)\", \"\\u0420\\u0435\\u0441\\u0435\\u0439\", \"Novaya russia\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0301\\u044f\", \"\\u0420\\u0430\\u04ab\\u04ab\\u0435\\u0439\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0439\\u0441\\u043a\\u0430\\u044f \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0446\\u0438\\u044f\", \"Poccnr\", \"\\u0420\\u043e\\u0441\\u0456\\u044f\", \"\\u041e\\u0440\\u043e\\u0434\\u043e\\u0439 \\u0425\\u043e\\u043b\\u0431\\u043e\\u043e\\u043d\\u043e\\u0439 \\u0423\\u043b\\u0430\\u0441\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0438\", \"The Russian Federation\", \"Russsia\", \"Russian (citizen)\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u0301\\u0439\\u0441\\u043a\\u0430\\u044f \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0301\\u0446\\u0438\\u044f\", \"\\u0423\\u0440\\u044b\\u0441\\u0435\\u0439\", \"\\u0410\\u0440\\u0430\\u0441\\u0441\\u044b\\u044b\\u0439\\u0430\", \"Rossiyskaya Federatsiya\", \"\\u041e\\u044c\\u0440\\u0441\\u0438\\u0439\\u043d \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0446\\u0438\\u0439\", \"Russian-born\", \"\\u0410\\u044c\\u0440\\u0430\\u0441\\u0430\\u0442\", \"Russia (Federation)\", \"POCCNR\", \"Northern Russia\", \"Federation of Russia\", \"Russia (country)\", \"\\u0420\\u043e\\u0447\\u043c\\u0443\", \"\\u0420\\u0435\\u0441\\u0435\\u0439 \\u0424\\u0435\\u0434\\u0435\\u0440\\u0430\\u0446\\u0438\\u044f\\u0441\\u044b\", \"Venaja\", \"\\u0420\\u0443\\u0441\\u0438\\u044f\", \"\\u0423\\u0440\\u044b\\u0441\\u0442\\u04d9\\u044b\\u043b\\u0430\", \"Resey\", \"\\u0420\\u043e\\u0441\\u0441\\u0438\\u044f\", \"Wildlife of Russia\", \"The Country Russia\", \"\\u0423\\u00e6\\u0440\\u00e6\\u0441\\u0435\", \"Venaejae\", \"Russian federation\", \"Russie\", \"Russia\", \"Rossijskaja Federatsija\", \"RUSSIA\", \"Ryssland\", \"Russian Federation\", \"Russiya\", \"\\u0420\\u0443\\u0441\\u0438\\u0458\\u0430\", \"RusSia\", \"\\u041e\\u0440\\u0441\\u0438\\u043d \\u041d\\u0438\\u0438\\u0446\\u04d9\\u043d\", \"Russland\", \"\\u0420\\u0443\\u0437\\u043c\\u0430\\u0441\\u0442\\u043e\\u0440\", \"RussiA\"]", "[\"Drinkable yogurt\", \"Yogurt Ice-cream\", \"Sweetened yogurt\", \"Yoghurd\", \"Maast\", \"Yogu\", \"Yogurt\", \"Yoghurt\", \"Joghourt\", \"Zabady\", \"Yoghourt\", \"Jogurt\", \"Yogurt maker\", \"Youghurt\", \"Yogourt\", \"Yougert\", \"Bulgarian yogurt (Kiselo mlyako)\", \"Yoghurt smoothie\", \"Yo\\u011furt\", \"Fruit bottom\", \"YOGHURT\", \"Yahourt\", \"Drinkable yoghurt\", \"Joghurt\", \"Yogurt smoothie\", \"Bulgarian yogurt\", \"Sweetened Yogurt\", \"Yaghourt\"]", "[\"M/S Explorer\", \"MV Explorer\", \"Ms explorer\", \"MS Explorer\", \"M/V Explorer\"]", "[\"Saccharidase\", \"Saliva\", \"Spittle\", \"George the Volcano\", \"Salivary proteins\", \"Salivate\", \"SALIVA\", \"Mouth water\", \"Salivation\", \"Ptysma\"]", "[\"Alternatives to petroleum\", \"Black gold (Oil)\", \"Petroplitics\", \"Petroleum maturation\", \"Crude petroleum\", \"Petroleum\", \"Brend Blend\", \"Petroleum-based fuel\", \"Oil producing countries\", \"Petro-diesel\", \"Oil - Enviromental Impact\", \"Liquid petroleum\", \"Petroleum vehicle\", \"Vehicle fuel\", \"Petroleum generation\", \"Conventional vehicle\", \"Black gold (oil)\", \"Fossil-oil\", \"Petrolet\", \"Medium fuel oil\", \"Petroleum fuels\", \"Petrofuel\", \"Petrolium\", \"Petroleum accumulation\", \"World oil consumption\", \"Petroholic\", \"Petroleum fuel\", \"Gas distribution\", \"Petroleum car\", \"Crude oil\", \"Raw oil\", \"Pan-petroliferous\", \"All-petroleum vehicle\", \"Used Oil\", \"Petro-state\", \"Environmental effects of petroleum\", \"All-petroleum\", \"Formation of petroleum\", \"Black gold (liquid)\", \"Crude Oil\", \"Petroleum fuel vehicle\", \"Patrolium\", \"Conventional oil\", \"Raw petroleum\", \"Pampetro\", \"Petrol oil\", \"Petrostate\", \"Petrofree\", \"Fossil oil\", \"History of Petroleum\"]", "[\"Herbert George\"]", "[\"Gaetano Donizetti\", \"Operas by Gaetano Donizetti\", \"Donnizetti\", \"Gaetano donizetti\", \"Donizetti\", \"Domenico Gaetano Maria Donizetti\"]", "[\"Competitive jousting\", \"List (jousting)\", \"Jousting lance\", \"Jousts\", \"Jousting\", \"Joust\", \"List field\", \"Stechen\", \"Renaissance-era jousting\", \"Lists (jousting)\"]", "[\"Left superior pulmonary vein\", \"Pulmonary veins\", \"Right superior pulmonary vein\", \"Superior pulmonary vein\", \"Right pulmonary vein\", \"Ven\\u00e6 pulmonales\", \"Pulmonary vein\", \"Pulmonary Veins\", \"Left inferior pulmonary vein\", \"Venae pulmonales\", \"Superior pulmonary\", \"Right inferior pulmonary vein\", \"Pulmonary Vein\", \"Inferior pulmonary vein\", \"Inferior pulmonary\"]", "[\"The Getaway (disambiguation)\", \"The Getaway (Video Game)\", \"Getaway (video game)\", \"The getaway 3\", \"The Getaway Working Title\", \"The getaway\", \"The Getaway Working Tittle\", \"The Getaway\", \"The Getaway (series)\", \"The Getaway (film)\", \"The Getaway (game)\", \"The Getaway (cancelled video game)\", \"List of gangs in The Getaway\"]", "[\"The White Swan\", \"WHITE SWAN\", \"Vere Street Coterie\"]", "[\"The Banqueting House\", \"The Banqueting House (disambiguation)\"]", "[\"Antonio Fargas\"]", "[\"Okla.\", \"Oklahoma\", \"Oklahoma, United States\", \"Sooner State\", \"Forty-Sixth State\", \"Religion in Oklahoma\", \"Culture of Oklahoma\", \"46th State\", \"Oklahoma (U.S. state)\", \"Oklahoma, USA\", \"State of Oklahoma\", \"List of Oklahoma State Symbols\", \"Oaklahoma\", \"Oklaholma\", \"Transportation in Oklahoma\", \"US-OK\", \"Sports in Oklahoma\", \"Okla\", \"Oklahoman\", \"Oclahoma\", \"Education in Oklahoma\", \"Energy in Oklahoma\", \"Transport in Oklahoma\", \"Forty-sixth State\", \"Oklahoma (state)\", \"The Sooner State\"]" ]
[ "The bossa nova is a type of what more generic dance?", "The 16th Century Battle of Molodi was fought in which country?", "\"What is the main ingredient in the Indian drink, \"\"lassi\"\"?\"", "Which cruise ship sank in the Antarctic in late 2007, after hitting an iceberg?", "In the human body, what is produced by the Parotid Gland?", "Bonny light, Forcados, Qua Ibo, and Brass River are types of what major Nigerian export commodity?", "What were the first names of English author H G Wells?", "Whose operatic works include Lucia di Lammermoor and Ann Boleyn?", "Henry VIII suffered a leg injury participating in what sport?", "Which is the only vein in the body to carry oxygenated blood?", "Which movie, starring Steve McQueen and Ali MacGraw, was remade with Alec Baldwin and Kim Basinger in the leading roles?", "Which bird features on the Buckinghamshire flag ?", "Outside of which building in Whitehall was King Charles I executed?", "What's the name of the actor who played 'Huggy Bear' in the Starsky and Hutch TV series?", "Which US state in 1907 was the last to declare Christmas a legal holiday?" ]
15
[ 61980, 61981, 61982, 61983, 61984, 61985, 61986, 61987, 61988, 61989, 61990, 61991, 61992, 61993, 61994 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Blunging, Fettling, Saggar and Wedging are all terms used in which craft?\nQuestion 2: Tony Stark is the real name of which super-hero featured in Marvel comics and later films?\nQuestion 3: Who was Desmond Lynam's co-presenter in the first series of How do They do That\nQuestion 4: In the 1960's, whose band was the 'All Stars'?\nQuestion 5: Who is Pip's secret benefactor in 'Great Expectations'?\nQuestion 6: In a 2010 film Percy Jackson is the son of which Greek God?\nQuestion 7: The Propylaea, which has now come to mean any gateway, was originally an entrance to what magnificent ancient construction?\nQuestion 8: Whose theme song was 'Minnie the Moocher'?\nQuestion 9: What was Rasputin's first name?\nQuestion 10: After whose father was Prince Edward Island named?\nQuestion 11: What is the maiden name of Samantha Cameron?\nQuestion 12: In which country was actress Audrey Hepburn born?\nQuestion 13: With which sport is Don Bradman associated?\nQuestion 14: What corrosive liquid makes up about 38% of the electrolyte in a car battery?\nQuestion 15: Fucus (pronounced 'fewcus') is a type of what?", "role": "user" } ]
["[\"Pots\", \"Pottery and porcelain\", \"Pottery maker\", \"Art ware\", \"Pottery-makers\", \"Pottery-maker\", \"Vase painting\", \"Fine art pot\", \"Clay pottery\", \"Ceramics\", \"Pottery\", \"Ceramicware\", \"Art pottery\", \"Painted vase\", \"Ceramic pot\", \"Ceramic ware\", \"Ceramics art\", \"Pot throwing\", \"Pottery-making\", \"Pottery making\", \"Ceramic paint\", \"Pottery makers\", \"Potterymaker\", \"Ceramicist\", \"Potterymaking\", \"Clay pot\", \"Pot\", \"Pottery manufacture\", \"Coil pot\", \"History of pottery\", \"Ceramic wares\", \"Potterymakers\", \"Making a pot\"]", "[\"Iron Man\", \"Stark-Fujikawa\", \"Iron man\", \"Tony Stark\", \"Iron Man (Comic Book)\", \"Captan Iron\", \"Tony Starks\", \"Iron Man (Marvel Comics)\", \"Iron-Man\", \"Anthony Edward Stark\", \"Anthony Edward %22Tony%22 Stark\", \"Stark, Tony\", \"IRON MAN\", \"Iron Man (comics)\", \"Tony Starck\", \"Iron Man: Director of S.H.I.E.L.D.\", \"Iron Man: Iron Protocols\", \"Circuits Maximus\", \"Iron Man (comic book)\", \"Marvel Iron Man\", \"Tony Edward Stark\", \"Iron man (comics)\", \"Iron Man: Titanium\"]", "[\"Hull\", \"Hull (disambiguation)\"]", "[\"Jnr. Walker & The All Stars\", \"Jr. Walker & the All-Stars\", \"Junior Walker & The All-Stars\", \"Jr. Walker's Allstars\", \"Junior Walker & the All-Stars\", \"Junior Walker and the All-Stars\", \"Junior Walker & The Allstars\", \"Junior Walker\", \"Jr. Walker & The All Stars\", \"Jr. Walker and the All Stars\", \"Junior Walker and the All Stars\", \"Jr walker\", \"Junior Walker & The All Stars\", \"Jr. Walker\", \"Jr. Walker & the All Stars\", \"Junior Walker & the All Stars\"]", "[\"Magwitch\", \"Abel Magwitch\", \"MAGWITCH\"]", "[\"Earth Shaker\", \"God Of The Seas\", \"Poseidon, The Sea King\", \"Mythology Neptune\", \"Neptune (Roman religion and mythology)\", \"Neptune Equester\", \"Aegaeus\", \"Posiden\", \"Poseidon facts\", \"Posidon\", \"Greek god of earthquakes\", \"Poseidons love for demeter\", \"Poseidon (mythology)\", \"Poseidon\", \"Poseidon Enosichthon\", \"Poseidone\", \"POSEIDON\", \"Poiseidon\", \"Clieto\", \"Posseidon\", \"Enosichthon\", \"Posedian\", \"Posiedon\"]", "[\"Acropolis in Athens\"]", "[\"CAB CALLOWAY\", \"Cabell Calloway III\", \"Cab Callaway\", \"Cab Calloway and His Cotton Club Orchestra\", \"Cabell %22Cab%22 Calloway\", \"Cab calloway\", \"Cab Calloway & His Orchestra\", \"Cab Calloway\", \"Cabell 'Cab' Calloway\", \"Cab Calloway Orchestra\", \"Cab Calloway and His Orchestra\", \"Cabell Calloway\"]", "[\"Grigory (disambiguation)\", \"Grigory\", \"Grigori (given name)\", \"Grigori\"]", "[\"Queen Victoria's Diamond Jubilee\", \"We are not amused\", \"Queen Victoria I of the United Kingdom\", \"Queen Victoria\", \"William Hamilton (criminal)\", \"Queen Victoria of England\", \"Victoria of Great Britain and Ireland\", \"Victoria of India\", \"Victoria Wettin\", \"Queen Victoria of the United Kingdom\", \"Victoria of the UK\", \"QUEEN VICTORIA\", \"Alexandrina Victoria von Wettin, nee Hanover\", \"Victoria I\", \"Victoria of United Kingdom\", \"Victoria (queen)\", \"List of titles and honours of Queen Victoria\", \"Alexandrina Victoria von Wettin, n\\u00e9e Hanover\", \"Victoria of England\", \"Alexandrina Victoria von Wettin\", \"Victoria of the United Kingdom (1819-1901)\", \"Victoria of the United Kingdom\", \"Victoria, Queen of England\", \"Alexandrina Victoria\", \"Victoria Regina\", \"Queen victoria\", \"Her Britannic Majesty Queen Victoria\", \"Wedding of Queen Victoria and Prince Albert of Saxe-Coburg and Gotha\", \"Victoria Queen\", \"Queen Victoria I\", \"Victoria of Great Britain\", \"Victoria I of the United Kingdom\", \"Diamond Jubilee of Queen Victoria\", \"Victoria of Britain\", \"Grandmother of Europe\", \"Victoria of Scotland\", \"Queen Victoria (died 1901)\", \"Queen Alexandrina Victoria\", \"Victoria, Queen of Great Britain\", \"Victoria, Queen of the United Kingdom\"]", "[\"County Borough of Sheffield\", \"Sheffield, England\", \"City of Sheffield\", \"Metropolitan Borough of Sheffield\", \"Sheffield\", \"Sheffield, U.K.\", \"UN/LOCODE:GBSHE\", \"Sheffield, UK\", \"Hucklow Primary School\", \"Sheffield england\", \"Sheffield (borough)\", \"SHEFFIELD\", \"Sheffield, Great Britain\", \"Sheffield, United Kingdom\", \"Shefield\", \"Sheffield (city)\", \"Sheffield (district)\"]", "[\"Belguim\", \"Koenigreich Belgien\", \"Belgium/Belgie\", \"Kingdom of Belgium\", \"Belgian\", \"Beljum\", \"K\\u00f6nigreich Belgien\", \"Belgique\", \"Belgium\", \"Beligum\", \"Kingdom of the Belgians\", \"Beljam\", \"Kingdom Of Belgium\", \"Belgum\", \"ISO 3166-1:BE\", \"Belgie\", \"Cockpit of Europe\", \"Koninkrijk Belgi\\u00eb\", \"Beldjike\", \"Blegium\", \"Belgio\", \"The Quebec of Europe\", \"Belgi\\u00eb\", \"Begium\", \"Royaume de Belgique\", \"Konigreich Belgien\", \"Koninkrijk Belgie\", \"People of Belgium\", \"Belgien\", \"Belgium/facts\", \"Administrative divisions of Belgium\", \"Belgium facts\"]", "[\"Cricket games\", \"Cricketeer\", \"Wicketkeeping\", \"Sport cricket\", \"Cricket team\", \"Cricket\", \"Cricket Clubs\", \"Cricketer\", \"Spirit of cricket\", \"Spirit of Cricket\", \"Amature cricket\", \"World Richest Cricketers\", \"Cricketed\", \"Coin toss (cricket)\", \"Scorecard (cricket)\", \"Cricket player\", \"Cricketplayer\", \"Cricket (sport)\", \"Kricket\", \"Sports cricket\", \"\\ud83c\\udfcf\", \"The toss\", \"Criket\", \"Cricketing\", \"Cricket club\", \"Amateur cricket\", \"Cricket as a social event\", \"Not in the spirit of cricket\", \"Creag\", \"Cricket (game)\", \"Cricketers\"]", "[\"Spirit of Vitriol\", \"Dihydrogen sulfate\", \"Battery Acid\", \"Sulfuric (VI) acid\", \"\\ud83d\\udf17\", \"\\ud83d\\udf16\", \"Sulphur Acid\", \"Dipping acid\", \"Vitriolic acid\", \"Vitreol\", \"H2o4s\", \"Fertiliser acid\", \"Battery acid\", \"E513\", \"Fertilizer acid\", \"Sulfur acid\", \"Chamber acid\", \"Sulfuric acid chemdata supplement\", \"Sulphuric Acid\", \"Spirit of sulfur\", \"Vitriolically\", \"Dihydrogen sulphate\", \"H\\u2082SO\\u2084\", \"Vitriolic\", \"Sulfuric(VI) acid\", \"Oil of vitriol\", \"H2S04\", \"Glover acid\", \"Sulfuric acid\", \"Hydrogen sulphate\", \"Sulphuri acid\", \"Sulphur acid\", \"Sulfuric Acid\", \"Spirit of sulphur\", \"Dilute sulfuric acid\", \"H2SO4\", \"SULPHURIC ACID\", \"H2So\", \"Oil of Vitriol\", \"Aqueous hydrogen sulfide\", \"Tower acid\", \"Vitriols\", \"Sulfuric acids\", \"Sulphuric acid\"]", "[\"Macroalgal\", \"Marine algae\", \"Seaweeds\", \"Macroalgae\", \"Sea weed\", \"Sea Weeds\", \"Seaweed\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Pots\", \"Pottery and porcelain\", \"Pottery maker\", \"Art ware\", \"Pottery-makers\", \"Pottery-maker\", \"Vase painting\", \"Fine art pot\", \"Clay pottery\", \"Ceramics\", \"Pottery\", \"Ceramicware\", \"Art pottery\", \"Painted vase\", \"Ceramic pot\", \"Ceramic ware\", \"Ceramics art\", \"Pot throwing\", \"Pottery-making\", \"Pottery making\", \"Ceramic paint\", \"Pottery makers\", \"Potterymaker\", \"Ceramicist\", \"Potterymaking\", \"Clay pot\", \"Pot\", \"Pottery manufacture\", \"Coil pot\", \"History of pottery\", \"Ceramic wares\", \"Potterymakers\", \"Making a pot\"]", "[\"Iron Man\", \"Stark-Fujikawa\", \"Iron man\", \"Tony Stark\", \"Iron Man (Comic Book)\", \"Captan Iron\", \"Tony Starks\", \"Iron Man (Marvel Comics)\", \"Iron-Man\", \"Anthony Edward Stark\", \"Anthony Edward %22Tony%22 Stark\", \"Stark, Tony\", \"IRON MAN\", \"Iron Man (comics)\", \"Tony Starck\", \"Iron Man: Director of S.H.I.E.L.D.\", \"Iron Man: Iron Protocols\", \"Circuits Maximus\", \"Iron Man (comic book)\", \"Marvel Iron Man\", \"Tony Edward Stark\", \"Iron man (comics)\", \"Iron Man: Titanium\"]", "[\"Hull\", \"Hull (disambiguation)\"]", "[\"Jnr. Walker & The All Stars\", \"Jr. Walker & the All-Stars\", \"Junior Walker & The All-Stars\", \"Jr. Walker's Allstars\", \"Junior Walker & the All-Stars\", \"Junior Walker and the All-Stars\", \"Junior Walker & The Allstars\", \"Junior Walker\", \"Jr. Walker & The All Stars\", \"Jr. Walker and the All Stars\", \"Junior Walker and the All Stars\", \"Jr walker\", \"Junior Walker & The All Stars\", \"Jr. Walker\", \"Jr. Walker & the All Stars\", \"Junior Walker & the All Stars\"]", "[\"Magwitch\", \"Abel Magwitch\", \"MAGWITCH\"]", "[\"Earth Shaker\", \"God Of The Seas\", \"Poseidon, The Sea King\", \"Mythology Neptune\", \"Neptune (Roman religion and mythology)\", \"Neptune Equester\", \"Aegaeus\", \"Posiden\", \"Poseidon facts\", \"Posidon\", \"Greek god of earthquakes\", \"Poseidons love for demeter\", \"Poseidon (mythology)\", \"Poseidon\", \"Poseidon Enosichthon\", \"Poseidone\", \"POSEIDON\", \"Poiseidon\", \"Clieto\", \"Posseidon\", \"Enosichthon\", \"Posedian\", \"Posiedon\"]", "[\"Acropolis in Athens\"]", "[\"CAB CALLOWAY\", \"Cabell Calloway III\", \"Cab Callaway\", \"Cab Calloway and His Cotton Club Orchestra\", \"Cabell %22Cab%22 Calloway\", \"Cab calloway\", \"Cab Calloway & His Orchestra\", \"Cab Calloway\", \"Cabell 'Cab' Calloway\", \"Cab Calloway Orchestra\", \"Cab Calloway and His Orchestra\", \"Cabell Calloway\"]", "[\"Grigory (disambiguation)\", \"Grigory\", \"Grigori (given name)\", \"Grigori\"]", "[\"Queen Victoria's Diamond Jubilee\", \"We are not amused\", \"Queen Victoria I of the United Kingdom\", \"Queen Victoria\", \"William Hamilton (criminal)\", \"Queen Victoria of England\", \"Victoria of Great Britain and Ireland\", \"Victoria of India\", \"Victoria Wettin\", \"Queen Victoria of the United Kingdom\", \"Victoria of the UK\", \"QUEEN VICTORIA\", \"Alexandrina Victoria von Wettin, nee Hanover\", \"Victoria I\", \"Victoria of United Kingdom\", \"Victoria (queen)\", \"List of titles and honours of Queen Victoria\", \"Alexandrina Victoria von Wettin, n\\u00e9e Hanover\", \"Victoria of England\", \"Alexandrina Victoria von Wettin\", \"Victoria of the United Kingdom (1819-1901)\", \"Victoria of the United Kingdom\", \"Victoria, Queen of England\", \"Alexandrina Victoria\", \"Victoria Regina\", \"Queen victoria\", \"Her Britannic Majesty Queen Victoria\", \"Wedding of Queen Victoria and Prince Albert of Saxe-Coburg and Gotha\", \"Victoria Queen\", \"Queen Victoria I\", \"Victoria of Great Britain\", \"Victoria I of the United Kingdom\", \"Diamond Jubilee of Queen Victoria\", \"Victoria of Britain\", \"Grandmother of Europe\", \"Victoria of Scotland\", \"Queen Victoria (died 1901)\", \"Queen Alexandrina Victoria\", \"Victoria, Queen of Great Britain\", \"Victoria, Queen of the United Kingdom\"]", "[\"County Borough of Sheffield\", \"Sheffield, England\", \"City of Sheffield\", \"Metropolitan Borough of Sheffield\", \"Sheffield\", \"Sheffield, U.K.\", \"UN/LOCODE:GBSHE\", \"Sheffield, UK\", \"Hucklow Primary School\", \"Sheffield england\", \"Sheffield (borough)\", \"SHEFFIELD\", \"Sheffield, Great Britain\", \"Sheffield, United Kingdom\", \"Shefield\", \"Sheffield (city)\", \"Sheffield (district)\"]", "[\"Belguim\", \"Koenigreich Belgien\", \"Belgium/Belgie\", \"Kingdom of Belgium\", \"Belgian\", \"Beljum\", \"K\\u00f6nigreich Belgien\", \"Belgique\", \"Belgium\", \"Beligum\", \"Kingdom of the Belgians\", \"Beljam\", \"Kingdom Of Belgium\", \"Belgum\", \"ISO 3166-1:BE\", \"Belgie\", \"Cockpit of Europe\", \"Koninkrijk Belgi\\u00eb\", \"Beldjike\", \"Blegium\", \"Belgio\", \"The Quebec of Europe\", \"Belgi\\u00eb\", \"Begium\", \"Royaume de Belgique\", \"Konigreich Belgien\", \"Koninkrijk Belgie\", \"People of Belgium\", \"Belgien\", \"Belgium/facts\", \"Administrative divisions of Belgium\", \"Belgium facts\"]", "[\"Cricket games\", \"Cricketeer\", \"Wicketkeeping\", \"Sport cricket\", \"Cricket team\", \"Cricket\", \"Cricket Clubs\", \"Cricketer\", \"Spirit of cricket\", \"Spirit of Cricket\", \"Amature cricket\", \"World Richest Cricketers\", \"Cricketed\", \"Coin toss (cricket)\", \"Scorecard (cricket)\", \"Cricket player\", \"Cricketplayer\", \"Cricket (sport)\", \"Kricket\", \"Sports cricket\", \"\\ud83c\\udfcf\", \"The toss\", \"Criket\", \"Cricketing\", \"Cricket club\", \"Amateur cricket\", \"Cricket as a social event\", \"Not in the spirit of cricket\", \"Creag\", \"Cricket (game)\", \"Cricketers\"]", "[\"Spirit of Vitriol\", \"Dihydrogen sulfate\", \"Battery Acid\", \"Sulfuric (VI) acid\", \"\\ud83d\\udf17\", \"\\ud83d\\udf16\", \"Sulphur Acid\", \"Dipping acid\", \"Vitriolic acid\", \"Vitreol\", \"H2o4s\", \"Fertiliser acid\", \"Battery acid\", \"E513\", \"Fertilizer acid\", \"Sulfur acid\", \"Chamber acid\", \"Sulfuric acid chemdata supplement\", \"Sulphuric Acid\", \"Spirit of sulfur\", \"Vitriolically\", \"Dihydrogen sulphate\", \"H\\u2082SO\\u2084\", \"Vitriolic\", \"Sulfuric(VI) acid\", \"Oil of vitriol\", \"H2S04\", \"Glover acid\", \"Sulfuric acid\", \"Hydrogen sulphate\", \"Sulphuri acid\", \"Sulphur acid\", \"Sulfuric Acid\", \"Spirit of sulphur\", \"Dilute sulfuric acid\", \"H2SO4\", \"SULPHURIC ACID\", \"H2So\", \"Oil of Vitriol\", \"Aqueous hydrogen sulfide\", \"Tower acid\", \"Vitriols\", \"Sulfuric acids\", \"Sulphuric acid\"]", "[\"Macroalgal\", \"Marine algae\", \"Seaweeds\", \"Macroalgae\", \"Sea weed\", \"Sea Weeds\", \"Seaweed\"]" ]
[ "Blunging, Fettling, Saggar and Wedging are all terms used in which craft?", "Tony Stark is the real name of which super-hero featured in Marvel comics and later films?", "Who was Desmond Lynam's co-presenter in the first series of How do They do That", "In the 1960's, whose band was the 'All Stars'?", "Who is Pip's secret benefactor in 'Great Expectations'?", "In a 2010 film Percy Jackson is the son of which Greek God?", "The Propylaea, which has now come to mean any gateway, was originally an entrance to what magnificent ancient construction?", "Whose theme song was 'Minnie the Moocher'?", "What was Rasputin's first name?", "After whose father was Prince Edward Island named?", "What is the maiden name of Samantha Cameron?", "In which country was actress Audrey Hepburn born?", "With which sport is Don Bradman associated?", "What corrosive liquid makes up about 38% of the electrolyte in a car battery?", "Fucus (pronounced 'fewcus') is a type of what?" ]
15
[ 42135, 42136, 42137, 42138, 42139, 42140, 42141, 42142, 42143, 42144, 42145, 42146, 42147, 42148, 42149 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: How many players are there in a rounders side?\nQuestion 2: Sine, cosine and tangent are the three most familiar functions in which branch of mathematics?\nQuestion 3: What famous event took place on December 16th, 1773?\nQuestion 4: What was the famous two word title that was given to Henry Stewart who was King Consort Of Scotland between 1565 and 1567 and was married to Mary Queen Of Scots ?\nQuestion 5: Banana cut, Dingle and Swingman are terms used in which sport?\nQuestion 6: Which Scottish border village lies at the northernmost end of the Pennine Way?\nQuestion 7: During World War II, the German 'Operation Hercules' was a plan to invade which island?\nQuestion 8: Which Indian novelist wrote 'The Man-Eater of Malgudi'?\nQuestion 9: In what country would you have found Robben Island prison?\nQuestion 10: In which war did the Battle of Ramillies take place?\nQuestion 11: Which was the first British football club to win the European Cup?\nQuestion 12: On which river does Hamburg stand?\nQuestion 13: In the human body, what is the 'Trachea more commonly known as?\nQuestion 14: Whom did George Entwistle succeed as Director General of the BBC in 2012?\nQuestion 15: Who married Tommy Lee and Kid Rock?", "role": "user" } ]
["[\"9\", \"nine\"]", "[\"SOH CAH TOA\", \"SOH-CAH-TOA\", \"Trigonometery\", \"Classical trigonometry\", \"Trignometry\", \"Tigonometry\", \"Sohcahtoa\", \"Allied angles\", \"Trigonometric Ratios\", \"Trigonometrist\", \"Trignonmetric Ratios\", \"Adjacent side\", \"Pretrigonometry\", \"Soh cah toa\", \"Trigonomy\", \"Choshacao\", \"Adjacent Side\", \"Sine squared\", \"SOHCAHTOA\", \"Trigometry\", \"Trigonometry\", \"Trig.\", \"Trig\", \"Trigonometric\", \"Triangle identities\"]", "[\"Boston Tea Party Ships and Museum\", \"Destruction of the tea\", \"Dartmouth (ship)\", \"Destruction of the Tea in Boston\", \"The Boston Tea Party\", \"The Destruction of the Tea in Boston\", \"BOSTON TEA PARTY\", \"Boston tea party\", \"Bostons tea party\", \"The destruction of the tea\", \"Boston Tea Party\", \"The Eleanor (ship)\", \"The Beaver (ship)\", \"Beaver (ship)\", \"The Destruction of the Tea\", \"Boston Tea-Party\", \"Eleanor (ship)\", \"The Dartmouth (ship)\", \"Boston tea\", \"The Boston Tea Party.\", \"Boston Tea party\"]", "[\"LORD DARNLEY\", \"Lord Darnley\"]", "[\"Basketball\", \"Basketball gear\", \"Bball\", \"Boy's Basketball\", \"B Ball\", \"Shoot hoops\", \"Basketball parity worldwide\", \"Men's Basketball\", \"High school basketball\", \"Basketball Worldwide\", \"Basketball club\", \"B-ball\", \"Basket-ball\", \"Basketball team\", \"\\ud83c\\udfc0\", \"Basketball rim\", \"Basketballer\", \"Rim (basketball)\", \"Basket ball\", \"Basketball net\", \"Baksetball\", \"Basketball player\", \"Basket-Ball\", \"Women's hoops\", \"Men's basketball\", \"BasketBall\", \"Basketball Parity Worldwide\", \"Basket Ball\", \"Baketball\", \"Basketball Player\", \"B ball\", \"Unicycle basketball\"]", "[\"Kirk Yetholm\", \"Yetholmshire\"]", "[\"MALTA\", \"Buret'\", \"Mal'ta-Buret' culture\", \"Mal'ta\", \"\\u041c\\u0430\\u043b\\u044c\\u0442\\u0430\"]", "[\"R. K. Narayan\", \"Rasipuram Narayan\", \"R.K.Narayanan\", \"R K Narayan\", \"R. Narayan\", \"Rasipuram Krishnaswami Ayyar Narayanaswami\", \"Narayan, R (asipuram)\", \"Narayan, R.K.\", \"Rasipuram Krishnaswami Narayan\", \"R Narayan (asipuram)\", \"R. K. NARAYAN\", \"R.K. Narayan\", \"R. K. (Rasipuram Krishnaswami) Narayan\", \"RK Narayan\", \"Narayan, R\", \"R.K.Narayan\", \"R.K. Naryan\"]", "[\"South africa\", \"South Africa's\", \"Southafrica\", \"Third Republic (South Africa)\", \"Republiek van Suid-Afrika\", \"Sou'frica\", \"Zuid Afrika\", \"Zuid-Afrika\", \"ISO 3166-1:ZA\", \"South-African\", \"S Africa\", \"Zuid Africa\", \"Mzansi\", \"Afrique du sud\", \"Zuidafrika\", \"Ningizimu Afrika\", \"Capital of South Africa\", \"Suid-Afrika\", \"South-Africa\", \"Rep. of SOUTH AFRICA\", \"The Republic of South Africa\", \"Suid Africa\", \"Azania/South Africa\", \"S Afr\", \"Saffa\", \"South African\", \"Seth efrika\", \"South Africa\", \"Soufrica\", \"Republic of south africa\", \"South Africa\\u00e0\", \"The Beloved Country\", \"S. Africa\", \"Rep. of South Africa\", \"South Africans\", \"Republic of South Africa\"]", "[\"War of the Spainish Succession\", \"Anglo-French War (1702\\u201313)\", \"Spanish War of Sucession\", \"Spanish Succession War\", \"Spanish War of Succession\", \"War Of The Spanish Succession\", \"War of the spanish succession\", \"The War of Spanish Succession\", \"Wars of the Spanish succession\", \"War of the Spanish succession\", \"War of Spainish Succession\", \"War of Spanish Succesion\", \"Spanish Succesion War\", \"The War Of The Spanish Succession\", \"Guerra de Sucesi\\u00f3n Espa\\u00f1ola\", \"Marlborough's Wars\", \"War of the Spanish Succession\", \"Guerra de Sucesion Espanola\", \"War of the Spanish Sucsession\", \"War of Spain Succession\", \"WAR of the SPANISH SUCCESSION\", \"Wars of Spanish Succession\", \"War of Spanish Succession\", \"The War Of Spanish Succession\"]", "[\"Celtic football\", \"Glasgow Celtic F.C.\", \"Celtic F. C.\", \"Celtic Reserves\", \"Glasgow Celtic\", \"Bhoy\", \"The tims\", \"The Bhoys\", \"Celtic F.C\", \"Bhoys\", \"Celtic Glasgow\", \"Celtic F C\", \"Celtc\", \"Celtic Football Club\", \"Celtic FC\", \"Glasgow Celtic FC\", \"Celtic f.c.\", \"Victory In Europe Cup\", \"The Celtic F.C.\", \"The Celtic A.F.C.\", \"Ferencvaros Vase\", \"Celtic F.C.\", \"The Celtic Football Club\", \"Celtic fc\"]", "[\"Elbe\", \"River Elbe\", \"Upper Elbe\", \"St\\u00f6r (Elbe)\", \"The Elbe\", \"Ferries across Elbe\", \"Elbe river\", \"Stor (Elbe)\", \"St\\u00f6r River\", \"Elbe River\", \"Labe River\", \"St\\u00f6r\"]", "[\"Tracheal diseases\", \"Vertebrate trachea\", \"Ligamenta anularia\", \"Tracheae\", \"Tracheal disease\", \"Annular ligaments of trachea\", \"Wind pipe\", \"Trachaea\", \"Ligamenta anularia tracheae\", \"Tracea\", \"Airpipe\", \"The Windpipe\", \"Tracheary\", \"Trachea transplant\", \"Air pipe\", \"Windwipe\", \"Windpipe\", \"Trachea\", \"Trachea (disambiguation)\", \"Windpipe (disambiguation)\", \"Invertebrate trachea\", \"Human trachea\"]", "[\"Mark Thompson (disambiguation)\", \"Mark Thompson\", \"MARK THOMPSON\"]", "[\"Pamela Anderson\", \"Pamela Lee\", \"Pamula Anderson\", \"Pam anderson\", \"Pam Anderson\", \"Pamela Denise Anderson\", \"Pamela Anderson Lee\", \"Pam Andreson\", \"Pamala anderson\", \"Pamela Lee Anderson\", \"Pamela anderson\", \"Pamela Anderson House\", \"Miss february 1990\", \"Pamela andersson\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"9\", \"nine\"]", "[\"SOH CAH TOA\", \"SOH-CAH-TOA\", \"Trigonometery\", \"Classical trigonometry\", \"Trignometry\", \"Tigonometry\", \"Sohcahtoa\", \"Allied angles\", \"Trigonometric Ratios\", \"Trigonometrist\", \"Trignonmetric Ratios\", \"Adjacent side\", \"Pretrigonometry\", \"Soh cah toa\", \"Trigonomy\", \"Choshacao\", \"Adjacent Side\", \"Sine squared\", \"SOHCAHTOA\", \"Trigometry\", \"Trigonometry\", \"Trig.\", \"Trig\", \"Trigonometric\", \"Triangle identities\"]", "[\"Boston Tea Party Ships and Museum\", \"Destruction of the tea\", \"Dartmouth (ship)\", \"Destruction of the Tea in Boston\", \"The Boston Tea Party\", \"The Destruction of the Tea in Boston\", \"BOSTON TEA PARTY\", \"Boston tea party\", \"Bostons tea party\", \"The destruction of the tea\", \"Boston Tea Party\", \"The Eleanor (ship)\", \"The Beaver (ship)\", \"Beaver (ship)\", \"The Destruction of the Tea\", \"Boston Tea-Party\", \"Eleanor (ship)\", \"The Dartmouth (ship)\", \"Boston tea\", \"The Boston Tea Party.\", \"Boston Tea party\"]", "[\"LORD DARNLEY\", \"Lord Darnley\"]", "[\"Basketball\", \"Basketball gear\", \"Bball\", \"Boy's Basketball\", \"B Ball\", \"Shoot hoops\", \"Basketball parity worldwide\", \"Men's Basketball\", \"High school basketball\", \"Basketball Worldwide\", \"Basketball club\", \"B-ball\", \"Basket-ball\", \"Basketball team\", \"\\ud83c\\udfc0\", \"Basketball rim\", \"Basketballer\", \"Rim (basketball)\", \"Basket ball\", \"Basketball net\", \"Baksetball\", \"Basketball player\", \"Basket-Ball\", \"Women's hoops\", \"Men's basketball\", \"BasketBall\", \"Basketball Parity Worldwide\", \"Basket Ball\", \"Baketball\", \"Basketball Player\", \"B ball\", \"Unicycle basketball\"]", "[\"Kirk Yetholm\", \"Yetholmshire\"]", "[\"MALTA\", \"Buret'\", \"Mal'ta-Buret' culture\", \"Mal'ta\", \"\\u041c\\u0430\\u043b\\u044c\\u0442\\u0430\"]", "[\"R. K. Narayan\", \"Rasipuram Narayan\", \"R.K.Narayanan\", \"R K Narayan\", \"R. Narayan\", \"Rasipuram Krishnaswami Ayyar Narayanaswami\", \"Narayan, R (asipuram)\", \"Narayan, R.K.\", \"Rasipuram Krishnaswami Narayan\", \"R Narayan (asipuram)\", \"R. K. NARAYAN\", \"R.K. Narayan\", \"R. K. (Rasipuram Krishnaswami) Narayan\", \"RK Narayan\", \"Narayan, R\", \"R.K.Narayan\", \"R.K. Naryan\"]", "[\"South africa\", \"South Africa's\", \"Southafrica\", \"Third Republic (South Africa)\", \"Republiek van Suid-Afrika\", \"Sou'frica\", \"Zuid Afrika\", \"Zuid-Afrika\", \"ISO 3166-1:ZA\", \"South-African\", \"S Africa\", \"Zuid Africa\", \"Mzansi\", \"Afrique du sud\", \"Zuidafrika\", \"Ningizimu Afrika\", \"Capital of South Africa\", \"Suid-Afrika\", \"South-Africa\", \"Rep. of SOUTH AFRICA\", \"The Republic of South Africa\", \"Suid Africa\", \"Azania/South Africa\", \"S Afr\", \"Saffa\", \"South African\", \"Seth efrika\", \"South Africa\", \"Soufrica\", \"Republic of south africa\", \"South Africa\\u00e0\", \"The Beloved Country\", \"S. Africa\", \"Rep. of South Africa\", \"South Africans\", \"Republic of South Africa\"]", "[\"War of the Spainish Succession\", \"Anglo-French War (1702\\u201313)\", \"Spanish War of Sucession\", \"Spanish Succession War\", \"Spanish War of Succession\", \"War Of The Spanish Succession\", \"War of the spanish succession\", \"The War of Spanish Succession\", \"Wars of the Spanish succession\", \"War of the Spanish succession\", \"War of Spainish Succession\", \"War of Spanish Succesion\", \"Spanish Succesion War\", \"The War Of The Spanish Succession\", \"Guerra de Sucesi\\u00f3n Espa\\u00f1ola\", \"Marlborough's Wars\", \"War of the Spanish Succession\", \"Guerra de Sucesion Espanola\", \"War of the Spanish Sucsession\", \"War of Spain Succession\", \"WAR of the SPANISH SUCCESSION\", \"Wars of Spanish Succession\", \"War of Spanish Succession\", \"The War Of Spanish Succession\"]", "[\"Celtic football\", \"Glasgow Celtic F.C.\", \"Celtic F. C.\", \"Celtic Reserves\", \"Glasgow Celtic\", \"Bhoy\", \"The tims\", \"The Bhoys\", \"Celtic F.C\", \"Bhoys\", \"Celtic Glasgow\", \"Celtic F C\", \"Celtc\", \"Celtic Football Club\", \"Celtic FC\", \"Glasgow Celtic FC\", \"Celtic f.c.\", \"Victory In Europe Cup\", \"The Celtic F.C.\", \"The Celtic A.F.C.\", \"Ferencvaros Vase\", \"Celtic F.C.\", \"The Celtic Football Club\", \"Celtic fc\"]", "[\"Elbe\", \"River Elbe\", \"Upper Elbe\", \"St\\u00f6r (Elbe)\", \"The Elbe\", \"Ferries across Elbe\", \"Elbe river\", \"Stor (Elbe)\", \"St\\u00f6r River\", \"Elbe River\", \"Labe River\", \"St\\u00f6r\"]", "[\"Tracheal diseases\", \"Vertebrate trachea\", \"Ligamenta anularia\", \"Tracheae\", \"Tracheal disease\", \"Annular ligaments of trachea\", \"Wind pipe\", \"Trachaea\", \"Ligamenta anularia tracheae\", \"Tracea\", \"Airpipe\", \"The Windpipe\", \"Tracheary\", \"Trachea transplant\", \"Air pipe\", \"Windwipe\", \"Windpipe\", \"Trachea\", \"Trachea (disambiguation)\", \"Windpipe (disambiguation)\", \"Invertebrate trachea\", \"Human trachea\"]", "[\"Mark Thompson (disambiguation)\", \"Mark Thompson\", \"MARK THOMPSON\"]", "[\"Pamela Anderson\", \"Pamela Lee\", \"Pamula Anderson\", \"Pam anderson\", \"Pam Anderson\", \"Pamela Denise Anderson\", \"Pamela Anderson Lee\", \"Pam Andreson\", \"Pamala anderson\", \"Pamela Lee Anderson\", \"Pamela anderson\", \"Pamela Anderson House\", \"Miss february 1990\", \"Pamela andersson\"]" ]
[ "How many players are there in a rounders side?", "Sine, cosine and tangent are the three most familiar functions in which branch of mathematics?", "What famous event took place on December 16th, 1773?", "What was the famous two word title that was given to Henry Stewart who was King Consort Of Scotland between 1565 and 1567 and was married to Mary Queen Of Scots ?", "Banana cut, Dingle and Swingman are terms used in which sport?", "Which Scottish border village lies at the northernmost end of the Pennine Way?", "During World War II, the German 'Operation Hercules' was a plan to invade which island?", "Which Indian novelist wrote 'The Man-Eater of Malgudi'?", "In what country would you have found Robben Island prison?", "In which war did the Battle of Ramillies take place?", "Which was the first British football club to win the European Cup?", "On which river does Hamburg stand?", "In the human body, what is the 'Trachea more commonly known as?", "Whom did George Entwistle succeed as Director General of the BBC in 2012?", "Who married Tommy Lee and Kid Rock?" ]
15
[ 15765, 15766, 15767, 15768, 15769, 15770, 15771, 15772, 15773, 15774, 15775, 15776, 15777, 15778, 15779 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Nov 20, 1945 saw the start of the trials in what German city in which 24 high ranking Nazis were indicted for participation in a common plan or conspiracy for the accomplishment of a crime against peace, planning, initiating and waging wars of aggression and other crimes against peace , war crimes, and crimes against humanity?\nQuestion 2: Which crime writer created the detectives Jimmy Perez and Vera Stanhope?\nQuestion 3: \"What theory, developed by Franz Joseph Gall, in which personality traits were determined by \"\"reading\"\" bumps and fissures in the skull, was once considered a science?\"\nQuestion 4: What is the first name of the woman that Tiger Woods married on 5 October 2004 and was officially divorced from on 23 August 2010?\nQuestion 5: \"What war was described as \"\"the equivalent of two bald men fighting over a comb\"\"?\"\nQuestion 6: \"Which Motor cycle company made \"\"The Manx\"\" and \"\"Commando\"\" models?\"\nQuestion 7: What is the name of needlework where pieces of fabric are sewn onto a fabric background?\nQuestion 8: Who commited suicide after she was abandoned by Aeneas?\nQuestion 9: ‘Songs My Mother Taught Me’ is a 1995 autobiography by which US actor?\nQuestion 10: What war was ended by the Treaty of Panmunjom on July 27, 1953?\nQuestion 11: Which Actress was the mother of the actress Janette Scott?\nQuestion 12: In which city were Jessica Ennis and Naseem Hamed born?\nQuestion 13: In the pantomime of the same name, who is 'Aladdin's' mother?\nQuestion 14: Stargazy Pie originated in which English county?\nQuestion 15: Which Indian City is known as the Silicon Valley of India?", "role": "user" } ]
["[\"Nurnburg\", \"Nuernberg, Germany\", \"Nuremberg, Germany\", \"Nuremberg\", \"UN/LOCODE:DENUE\", \"Neurenberg\", \"Nurnberg\", \"Norimberg\\u00e6\", \"Bombing of Nuremberg\", \"N\\u00fcrnburg\", \"N\\u00fcremberg\", \"Nurnberg, Germany\", \"N\\u00fcrnberg\", \"Nueremberg\", \"Neuremburg\", \"Nurumburg\", \"Nurenburg\", \"N\\u00fcrnberg displaced persons camp\", \"Nuernberg displaced persons camp\", \"Nuremberg (Germany)\", \"Nuremburg\", \"Nuremburg, Germany\", \"Nurenberg\", \"Fischbach UNRRA displaced persons camp\", \"Nuernburg\", \"N\\u00fcrnberg, Germany\", \"Nuernberg\"]", "[\"Ann Cleeves\", \"Vera Stanhope\"]", "[\"Bump of Locality\", \"Prenology\", \"Bumpology\", \"Phrenologists\", \"Phrenology\", \"Philoprogenitiveness\", \"Frenology\", \"Phrenologist\", \"Phrenological\"]", "[\"El\\u00edn (disambiguation)\", \"Elin\", \"El\\u00edn\"]", "[\"Falkland Islands conflict\", \"Falklands Conflict\", \"Malvinas War\", \"Falkland War\", \"Falkland Islands War\", \"The falklands war\", \"Falklands war\", \"Falklands/Malvinas War\", \"Operation Corporate\", \"Falkland Islands 1982\", \"Falklands Campaign\", \"1982 Invasion of the Falkland Islands\", \"Falkland war\", \"Casualties of the Bluff Cove disaster\", \"Falkland Conflict\", \"Falklands War\", \"Guerra del Atlantico Sur\", \"Falklands Task Force\", \"The Falklands War\", \"Casualties of the Battle of Bluff Cove\", \"Falklands conflict\", \"Thatcher's War\", \"Guerra de las Malvinas\", \"Operation CORPORATE\", \"Guerra del Atl\\u00e1ntico Sur\", \"South Atlantic War\"]", "[\"Nortonz\", \"Norton\", \"Norton (disambiguation)\"]", "[\"Applique (ceramics)\", \"Appliques\", \"Applique\", \"Appilque\", \"Appliqu\\u00e9\"]", "[\"Elissar\", \"Dido\", \"Dido of Carthage\", \"Queen of Carthage\", \"Dido (Queen)\", \"Dido (Queen of Carthage)\", \"DIDO\"]", "[\"Marlon Brando Jr.\", \"Marlon brando\", \"Marlon Brando Jr\", \"Marlin Brando\", \"Marlon Brando, Jr.\", \"Brandoesque\", \"Marlon Brando\", \"Brando family\"]", "[\"Chosun War\", \"The Korean War\", \"\\ud55c\\uad6d\\uc804\\uc7c1\", \"Invasion of South Korea\", \"Battle of South Corea\", \"Korean Police Action\", \"June 25th War\", \"Korean War casualties\", \"Joseon War\", \"First Phase Offensive\", \"Korean war\", \"Choson War\", \"Initial phase of the Korean War\", \"June 25 Incident\", \"War in Korea\", \"1953 Cease-Fire in Korea\", \"\\u97d3\\u570b\\u6230\\u722d\", \"\\u671d\\u9c9c\\u6218\\u4e89\", \"The Korean war\", \"North korean invasion of South Korea\", \"Koreakriget\", \"Invasion of North Korea\", \"\\u6297\\u7f8e\\u63f4\\u671d\\u6218\\u4e89\", \"Koreakrigen\", \"Korean civil war\", \"Korea War\", \"Battle of North Korea\", \"June 25th Incident\", \"War between North Korea And South Korea\", \"War to Resist America and Aid Korea\", \"Invasion of South Corea\", \"Koreakrieg\", \"War Between South Korea and North Korea\", \"Korean Conflict\", \"Korean War\", \"Corean Civil War\", \"Hanguk Jeonjaeng\", \"Battle of North Corea\", \"Korean police action\", \"Chinese intervention in Korea\", \"War to Resist U.S. Aggression and Aid Korea\", \"Great Fatherland Liberation War\", \"6:25\", \"6.25 war\", \"Kroean War\", \"Battles of the Korean War\", \"Battle of South Korea\", \"War to Resist US Aggression and Aid Korea\", \"\\u6297\\u7f8e\\u63f4\\u671d\\u6230\\u722d\", \"Fatherland Liberation War\", \"Corean War\", \"\\u671d\\u9bae\\u6230\\u722d\", \"Invasion of North Corea\", \"Korean Civil War\", \"North Korea's Invasion of South Korea\", \"June 25 War\", \"Korea, 1951\\u20131953\"]", "[\"Dame Thora Hird\", \"(Thora) Hird\", \"Thora Hird\"]", "[\"County Borough of Sheffield\", \"Sheffield, England\", \"City of Sheffield\", \"Metropolitan Borough of Sheffield\", \"Sheffield\", \"Sheffield, U.K.\", \"UN/LOCODE:GBSHE\", \"Sheffield, UK\", \"Hucklow Primary School\", \"Sheffield england\", \"Sheffield (borough)\", \"SHEFFIELD\", \"Sheffield, Great Britain\", \"Sheffield, United Kingdom\", \"Shefield\", \"Sheffield (city)\", \"Sheffield (district)\"]", "[\"Widow Twanky\", \"'WIDOW TWANKY'\", \"Twankey\", \"Mrs. Twankey\", \"Widow Twankey\", \"Wishy Washy\"]", "[\"Curnow\", \"Corn Wall\", \"Cornwall (County), England\", \"Cernyw\", \"Kernow\", \"West Wales (kingdom)\", \"Cerniw\", \"Cornwall\", \"Cornwall, England\", \"Cornuvia\", \"KERNOW\", \"Belerion\", \"Cornwall, UK\", \"Cornwall, United Kingdom\", \"Cornwall (England : County)\", \"Maps of Cornwall\"]", "[\"Banggalore\", \"Karnataka,Bengaluru\", \"Bongalore\", \"List of diplomatic missions in Bangalore\", \"Bangalooro\", \"Benga\\u1e37\\u016bru\", \"Bengaluru\", \"Garden City of India\", \"Banglore\", \"Diplomatic missions in Karnataka\", \"\\u0cac\\u0cc6\\u0c82\\u0c97\\u0cb3\\u0cc2\\u0cb0\\u0cc1\", \"IT Capital of India\", \"Bengulooru\", \"Bangalore statistics\", \"List of diplomatic missions in Karnataka\", \"Bengalore\", \"Bangalore, Karnataka\", \"Bangalore Tamils\", \"Bangalur\", \"Bangalore\", \"B'lore\", \"Bangalore (India)\", \"Bangalooru\", \"Bangalore Statistics\", \"Bangaluru\", \"Vidyaniketan Public School\", \"Bangalore, India\", \"Bangalore City\", \"BANGALORE\", \"Bengaluuru\", \"KSLTA Tennis Center\", \"Bangladore\", \"Bengal\\u016bru\", \"The Naming Of Bangalore\", \"Langford Road\", \"Bengalooro\", \"Diplomatic missions in karnataka\", \"Bangalore East\", \"Bengalooru\", \"UN/LOCODE:INBLR\", \"Bangalor\", \"Diplomatic Missions in Karnataka\", \"Bengaluru, India\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Nurnburg\", \"Nuernberg, Germany\", \"Nuremberg, Germany\", \"Nuremberg\", \"UN/LOCODE:DENUE\", \"Neurenberg\", \"Nurnberg\", \"Norimberg\\u00e6\", \"Bombing of Nuremberg\", \"N\\u00fcrnburg\", \"N\\u00fcremberg\", \"Nurnberg, Germany\", \"N\\u00fcrnberg\", \"Nueremberg\", \"Neuremburg\", \"Nurumburg\", \"Nurenburg\", \"N\\u00fcrnberg displaced persons camp\", \"Nuernberg displaced persons camp\", \"Nuremberg (Germany)\", \"Nuremburg\", \"Nuremburg, Germany\", \"Nurenberg\", \"Fischbach UNRRA displaced persons camp\", \"Nuernburg\", \"N\\u00fcrnberg, Germany\", \"Nuernberg\"]", "[\"Ann Cleeves\", \"Vera Stanhope\"]", "[\"Bump of Locality\", \"Prenology\", \"Bumpology\", \"Phrenologists\", \"Phrenology\", \"Philoprogenitiveness\", \"Frenology\", \"Phrenologist\", \"Phrenological\"]", "[\"El\\u00edn (disambiguation)\", \"Elin\", \"El\\u00edn\"]", "[\"Falkland Islands conflict\", \"Falklands Conflict\", \"Malvinas War\", \"Falkland War\", \"Falkland Islands War\", \"The falklands war\", \"Falklands war\", \"Falklands/Malvinas War\", \"Operation Corporate\", \"Falkland Islands 1982\", \"Falklands Campaign\", \"1982 Invasion of the Falkland Islands\", \"Falkland war\", \"Casualties of the Bluff Cove disaster\", \"Falkland Conflict\", \"Falklands War\", \"Guerra del Atlantico Sur\", \"Falklands Task Force\", \"The Falklands War\", \"Casualties of the Battle of Bluff Cove\", \"Falklands conflict\", \"Thatcher's War\", \"Guerra de las Malvinas\", \"Operation CORPORATE\", \"Guerra del Atl\\u00e1ntico Sur\", \"South Atlantic War\"]", "[\"Nortonz\", \"Norton\", \"Norton (disambiguation)\"]", "[\"Applique (ceramics)\", \"Appliques\", \"Applique\", \"Appilque\", \"Appliqu\\u00e9\"]", "[\"Elissar\", \"Dido\", \"Dido of Carthage\", \"Queen of Carthage\", \"Dido (Queen)\", \"Dido (Queen of Carthage)\", \"DIDO\"]", "[\"Marlon Brando Jr.\", \"Marlon brando\", \"Marlon Brando Jr\", \"Marlin Brando\", \"Marlon Brando, Jr.\", \"Brandoesque\", \"Marlon Brando\", \"Brando family\"]", "[\"Chosun War\", \"The Korean War\", \"\\ud55c\\uad6d\\uc804\\uc7c1\", \"Invasion of South Korea\", \"Battle of South Corea\", \"Korean Police Action\", \"June 25th War\", \"Korean War casualties\", \"Joseon War\", \"First Phase Offensive\", \"Korean war\", \"Choson War\", \"Initial phase of the Korean War\", \"June 25 Incident\", \"War in Korea\", \"1953 Cease-Fire in Korea\", \"\\u97d3\\u570b\\u6230\\u722d\", \"\\u671d\\u9c9c\\u6218\\u4e89\", \"The Korean war\", \"North korean invasion of South Korea\", \"Koreakriget\", \"Invasion of North Korea\", \"\\u6297\\u7f8e\\u63f4\\u671d\\u6218\\u4e89\", \"Koreakrigen\", \"Korean civil war\", \"Korea War\", \"Battle of North Korea\", \"June 25th Incident\", \"War between North Korea And South Korea\", \"War to Resist America and Aid Korea\", \"Invasion of South Corea\", \"Koreakrieg\", \"War Between South Korea and North Korea\", \"Korean Conflict\", \"Korean War\", \"Corean Civil War\", \"Hanguk Jeonjaeng\", \"Battle of North Corea\", \"Korean police action\", \"Chinese intervention in Korea\", \"War to Resist U.S. Aggression and Aid Korea\", \"Great Fatherland Liberation War\", \"6:25\", \"6.25 war\", \"Kroean War\", \"Battles of the Korean War\", \"Battle of South Korea\", \"War to Resist US Aggression and Aid Korea\", \"\\u6297\\u7f8e\\u63f4\\u671d\\u6230\\u722d\", \"Fatherland Liberation War\", \"Corean War\", \"\\u671d\\u9bae\\u6230\\u722d\", \"Invasion of North Corea\", \"Korean Civil War\", \"North Korea's Invasion of South Korea\", \"June 25 War\", \"Korea, 1951\\u20131953\"]", "[\"Dame Thora Hird\", \"(Thora) Hird\", \"Thora Hird\"]", "[\"County Borough of Sheffield\", \"Sheffield, England\", \"City of Sheffield\", \"Metropolitan Borough of Sheffield\", \"Sheffield\", \"Sheffield, U.K.\", \"UN/LOCODE:GBSHE\", \"Sheffield, UK\", \"Hucklow Primary School\", \"Sheffield england\", \"Sheffield (borough)\", \"SHEFFIELD\", \"Sheffield, Great Britain\", \"Sheffield, United Kingdom\", \"Shefield\", \"Sheffield (city)\", \"Sheffield (district)\"]", "[\"Widow Twanky\", \"'WIDOW TWANKY'\", \"Twankey\", \"Mrs. Twankey\", \"Widow Twankey\", \"Wishy Washy\"]", "[\"Curnow\", \"Corn Wall\", \"Cornwall (County), England\", \"Cernyw\", \"Kernow\", \"West Wales (kingdom)\", \"Cerniw\", \"Cornwall\", \"Cornwall, England\", \"Cornuvia\", \"KERNOW\", \"Belerion\", \"Cornwall, UK\", \"Cornwall, United Kingdom\", \"Cornwall (England : County)\", \"Maps of Cornwall\"]", "[\"Banggalore\", \"Karnataka,Bengaluru\", \"Bongalore\", \"List of diplomatic missions in Bangalore\", \"Bangalooro\", \"Benga\\u1e37\\u016bru\", \"Bengaluru\", \"Garden City of India\", \"Banglore\", \"Diplomatic missions in Karnataka\", \"\\u0cac\\u0cc6\\u0c82\\u0c97\\u0cb3\\u0cc2\\u0cb0\\u0cc1\", \"IT Capital of India\", \"Bengulooru\", \"Bangalore statistics\", \"List of diplomatic missions in Karnataka\", \"Bengalore\", \"Bangalore, Karnataka\", \"Bangalore Tamils\", \"Bangalur\", \"Bangalore\", \"B'lore\", \"Bangalore (India)\", \"Bangalooru\", \"Bangalore Statistics\", \"Bangaluru\", \"Vidyaniketan Public School\", \"Bangalore, India\", \"Bangalore City\", \"BANGALORE\", \"Bengaluuru\", \"KSLTA Tennis Center\", \"Bangladore\", \"Bengal\\u016bru\", \"The Naming Of Bangalore\", \"Langford Road\", \"Bengalooro\", \"Diplomatic missions in karnataka\", \"Bangalore East\", \"Bengalooru\", \"UN/LOCODE:INBLR\", \"Bangalor\", \"Diplomatic Missions in Karnataka\", \"Bengaluru, India\"]" ]
[ "Nov 20, 1945 saw the start of the trials in what German city in which 24 high ranking Nazis were indicted for participation in a common plan or conspiracy for the accomplishment of a crime against peace, planning, initiating and waging wars of aggression and other crimes against peace , war crimes, and crimes against humanity?", "Which crime writer created the detectives Jimmy Perez and Vera Stanhope?", "\"What theory, developed by Franz Joseph Gall, in which personality traits were determined by \"\"reading\"\" bumps and fissures in the skull, was once considered a science?\"", "What is the first name of the woman that Tiger Woods married on 5 October 2004 and was officially divorced from on 23 August 2010?", "\"What war was described as \"\"the equivalent of two bald men fighting over a comb\"\"?\"", "\"Which Motor cycle company made \"\"The Manx\"\" and \"\"Commando\"\" models?\"", "What is the name of needlework where pieces of fabric are sewn onto a fabric background?", "Who commited suicide after she was abandoned by Aeneas?", "‘Songs My Mother Taught Me’ is a 1995 autobiography by which US actor?", "What war was ended by the Treaty of Panmunjom on July 27, 1953?", "Which Actress was the mother of the actress Janette Scott?", "In which city were Jessica Ennis and Naseem Hamed born?", "In the pantomime of the same name, who is 'Aladdin's' mother?", "Stargazy Pie originated in which English county?", "Which Indian City is known as the Silicon Valley of India?" ]
15
[ 85110, 85111, 85112, 85113, 85114, 85115, 85116, 85117, 85118, 85119, 85120, 85121, 85122, 85123, 85124 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: How many Summer Olympic Games were held during the 1990’s?\nQuestion 2: David Vine, David Coleman and Sue Barker have all hosted which BBC television quiz show?\nQuestion 3: Which planet in the Solar System has diameter nearest to that of Earth?\nQuestion 4: Which eponymous Dickens hero is a simpleton?\nQuestion 5: In which fictional county were the novels of Thomas Hardy set\nQuestion 6: Who had a number one hit in June 2010 with 'Dirtee Disco'?\nQuestion 7: Which mainland African country has the longest coastline?\nQuestion 8: French actress Catherine Deneuve has been married once, from 1965 to 1972, to whom?\nQuestion 9: The TT on the Isle of Man, first run in 1905, is for what?\nQuestion 10: Vitamin B2 has what medical name?\nQuestion 11: Who created the children's book character the Gruffalo?\nQuestion 12: \"In the hit record \"\"Bohemian Rhapsody\"\", by Queen, who is asked to do the fandango?\"\nQuestion 13: Who is generally credited with having invented the telephone?\nQuestion 14: Called 'These Friends of Mine' for season one, which US sitcom centred on a neurotic bookstore owner?\nQuestion 15: In 2006, which British gymnast was the first ever to win a world title?", "role": "user" } ]
["[\"2\", \"Two\", \"two\"]", "[\"A Question of sport\", \"AQOS\", \"A Question of Sport\", \"Question of sport\", \"A Question Of Sport\"]", "[\"VENUS\"]", "[\"Mr. Haredale\", \"Barnaby Rudge\", \"Dolly Varden (character)\", \"Barnaby Rudge: A Tale of the Riots of 'Eighty\"]", "[\"Flag of Wessex\", \"West Saxon kingdom\", \"West Saxons\", \"Kingdom of Wessex\", \"Wessex (England)\", \"Wessex, England\", \"Hegemony of Wessex\", \"Wessex region\", \"Wessex\", \"Kingdom of the West Saxons\", \"Wessex hegemony\", \"West Sexaon dialect (Old English)\", \"The Kingdom of Wessex\"]", "[\"Dirtee Stank (UMG)\", \"Dizzy Rascal\", \"DIZZEE RASCAL\", \"Still Sittin' Here\", \"Dizzie Rascal\", \"Dizzee rascal\", \"Dylan Mills\", \"H Town (song)\", \"Dirtee Stank\", \"Dizzee\", \"Dizzee Rascal\"]", "[\"Somali National Salvation Committee\", \"Somolia\", \"Soomaaliya\", \"Somaila\", \"Republic of Somalia\", \"Somalia, Africa\", \"The Independent Somali State\", \"ISO 3166-1:SO\", \"\\u0627\\u0644\\u0635\\u0648\\u0645\\u0627\\u0644\", \"Coast of Somalia\", \"Somalia\", \"Somaliya\", \"Federal Republic of Somalia\", \"As-Sumal\", \"SOMALIA\"]", "[\"Photographer David Bailey\"]", "[\"Steel horse\", \"Auto bicycle\", \"Motercycle\", \"Motorbike\", \"Moterbike\", \"Motor cycle\", \"Motor-cycle\", \"Motercycles\", \"Motor Cycle\", \"Motor bicycle\", \"Motorcycles\", \"Motor bike\", \"Motor-bike\", \"Motorbiker\", \"Motorbikes\", \"Motorcycle\"]", "[\"Vitamin B\\u2082\", \"Vitaflavine\", \"Beflavine\", \"Ribovel\", \"Flavaxin\", \"Ovoflavin\", \"Ribotone\", \"Flavin Bb\", \"Riboflavin\", \"Vitamin B-2\", \"List of foods containing Vitamin G\", \"Vitamin B2 Deficiency\", \"Riboflavin metabolism\", \"Bisulase\", \"Vitasan B2\", \"Vitamin B2 deficiency\", \"Fiboflavin\", \"Flaxain\", \"Vitamin B2\", \"Ribipca\", \"Riboflavin deficiency\", \"ATC code A11HA04\", \"Lactoflavin\", \"HSDB 817\", \"ATCvet code QA11HA04\", \"Riboderm\", \"Ribosyn\", \"Hyflavin\", \"Hyre\", \"Vitamin G\", \"E101 (E number)\", \"Dermadram\", \"C17H20N4O6\", \"Beflavin\", \"Riboflavins\", \"Aqua-Flave\", \"Ribocrisina\", \"Riboflavin biosynthesis\", \"Ariboflavinosis\", \"Riboflavin phosphate sodium\", \"Lactobene\"]", "[\"Julia Catherine Donaldson\", \"Julia Donaldson\"]", "[\"Scaramuccia\", \"Scaramouch\", \"Skaramoosh\", \"SCARAMOUCHE\", \"Scaramouche\"]", "[\"Alexander gram bell\", \"Alexander Graham Bell\", \"The father of the deaf\", \"Aleck Bell\", \"Alexander graham bell\", \"Eliza Grace Symonds Bell\"]", "[\"ELLEN\", \"Ellen\", \"Ellen (given name)\"]", "[\"Elizabeth Kimberley Tweddle\", \"Elizabeth Tweddle\", \"Beth Tweddle\", \"Elizabeth Tweedle\", \"Elisabeth Tweddle\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"2\", \"Two\", \"two\"]", "[\"A Question of sport\", \"AQOS\", \"A Question of Sport\", \"Question of sport\", \"A Question Of Sport\"]", "[\"VENUS\"]", "[\"Mr. Haredale\", \"Barnaby Rudge\", \"Dolly Varden (character)\", \"Barnaby Rudge: A Tale of the Riots of 'Eighty\"]", "[\"Flag of Wessex\", \"West Saxon kingdom\", \"West Saxons\", \"Kingdom of Wessex\", \"Wessex (England)\", \"Wessex, England\", \"Hegemony of Wessex\", \"Wessex region\", \"Wessex\", \"Kingdom of the West Saxons\", \"Wessex hegemony\", \"West Sexaon dialect (Old English)\", \"The Kingdom of Wessex\"]", "[\"Dirtee Stank (UMG)\", \"Dizzy Rascal\", \"DIZZEE RASCAL\", \"Still Sittin' Here\", \"Dizzie Rascal\", \"Dizzee rascal\", \"Dylan Mills\", \"H Town (song)\", \"Dirtee Stank\", \"Dizzee\", \"Dizzee Rascal\"]", "[\"Somali National Salvation Committee\", \"Somolia\", \"Soomaaliya\", \"Somaila\", \"Republic of Somalia\", \"Somalia, Africa\", \"The Independent Somali State\", \"ISO 3166-1:SO\", \"\\u0627\\u0644\\u0635\\u0648\\u0645\\u0627\\u0644\", \"Coast of Somalia\", \"Somalia\", \"Somaliya\", \"Federal Republic of Somalia\", \"As-Sumal\", \"SOMALIA\"]", "[\"Photographer David Bailey\"]", "[\"Steel horse\", \"Auto bicycle\", \"Motercycle\", \"Motorbike\", \"Moterbike\", \"Motor cycle\", \"Motor-cycle\", \"Motercycles\", \"Motor Cycle\", \"Motor bicycle\", \"Motorcycles\", \"Motor bike\", \"Motor-bike\", \"Motorbiker\", \"Motorbikes\", \"Motorcycle\"]", "[\"Vitamin B\\u2082\", \"Vitaflavine\", \"Beflavine\", \"Ribovel\", \"Flavaxin\", \"Ovoflavin\", \"Ribotone\", \"Flavin Bb\", \"Riboflavin\", \"Vitamin B-2\", \"List of foods containing Vitamin G\", \"Vitamin B2 Deficiency\", \"Riboflavin metabolism\", \"Bisulase\", \"Vitasan B2\", \"Vitamin B2 deficiency\", \"Fiboflavin\", \"Flaxain\", \"Vitamin B2\", \"Ribipca\", \"Riboflavin deficiency\", \"ATC code A11HA04\", \"Lactoflavin\", \"HSDB 817\", \"ATCvet code QA11HA04\", \"Riboderm\", \"Ribosyn\", \"Hyflavin\", \"Hyre\", \"Vitamin G\", \"E101 (E number)\", \"Dermadram\", \"C17H20N4O6\", \"Beflavin\", \"Riboflavins\", \"Aqua-Flave\", \"Ribocrisina\", \"Riboflavin biosynthesis\", \"Ariboflavinosis\", \"Riboflavin phosphate sodium\", \"Lactobene\"]", "[\"Julia Catherine Donaldson\", \"Julia Donaldson\"]", "[\"Scaramuccia\", \"Scaramouch\", \"Skaramoosh\", \"SCARAMOUCHE\", \"Scaramouche\"]", "[\"Alexander gram bell\", \"Alexander Graham Bell\", \"The father of the deaf\", \"Aleck Bell\", \"Alexander graham bell\", \"Eliza Grace Symonds Bell\"]", "[\"ELLEN\", \"Ellen\", \"Ellen (given name)\"]", "[\"Elizabeth Kimberley Tweddle\", \"Elizabeth Tweddle\", \"Beth Tweddle\", \"Elizabeth Tweedle\", \"Elisabeth Tweddle\"]" ]
[ "How many Summer Olympic Games were held during the 1990’s?", "David Vine, David Coleman and Sue Barker have all hosted which BBC television quiz show?", "Which planet in the Solar System has diameter nearest to that of Earth?", "Which eponymous Dickens hero is a simpleton?", "In which fictional county were the novels of Thomas Hardy set", "Who had a number one hit in June 2010 with 'Dirtee Disco'?", "Which mainland African country has the longest coastline?", "French actress Catherine Deneuve has been married once, from 1965 to 1972, to whom?", "The TT on the Isle of Man, first run in 1905, is for what?", "Vitamin B2 has what medical name?", "Who created the children's book character the Gruffalo?", "\"In the hit record \"\"Bohemian Rhapsody\"\", by Queen, who is asked to do the fandango?\"", "Who is generally credited with having invented the telephone?", "Called 'These Friends of Mine' for season one, which US sitcom centred on a neurotic bookstore owner?", "In 2006, which British gymnast was the first ever to win a world title?" ]
15
[ 72150, 72151, 72152, 72153, 72154, 72155, 72156, 72157, 72158, 72159, 72160, 72161, 72162, 72163, 72164 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What type of gloves are made with the skin of young goats?\nQuestion 2: How many roods make an acre?\nQuestion 3: Which London theatre has a thatched roof?\nQuestion 4: Ronan Keating was a member of which band?\nQuestion 5: Featuring prominently in the new Pirates of the Caribbean movie, the pirate Edward Teach is better known by what name?\nQuestion 6: In which country was actress Audrey Hepburn born?\nQuestion 7: Which intelligence agency was founded in 1951 by Isser Harel who served as its director until 1963?\nQuestion 8: What is the oldest university in England?\nQuestion 9: Scientists announced in 2012 that more than 1,000 of what creatures (formica lugubris) had been fitted with tiny radio transmitters to study the species?\nQuestion 10: Pont Neuf is the oldest bridge in Paris. What does its name mean?\nQuestion 11: Who has been the editor of the Daily Mail since 1992?\nQuestion 12: Which of the Wise Men was said to have brought the gift of gold for the baby Jesus?\nQuestion 13: Which of the American Idol judges has been there for all 10 seasons?\nQuestion 14: Brimstone is an old word for which chemical element?\nQuestion 15: Where was the battle fought between the Royalist forces under Prince Rupert and Oliver Cromwell's men in June 1645 that was the key to the final downfall of Royalist forces a year later?", "role": "user" } ]
["[\"Kid gloves (disambiguation)\", \"Kid gloves\", \"Kid's gloves\", \"Kid Gloves\", \"Kit gloves\"]", "[\"four\", \"4\"]", "[\"Shakspeare theatre\", \"Shakespeare's globe theatre\", \"The 1st Globe Theatre\", \"Globe Theatre\", \"Shakespeare's Globe Exhibition\", \"Globe Theater\", \"Globe theatre\", \"The Globe Theatre\", \"Shakespeare Globe Theatre\", \"Shakespeare's Globe Theater\", \"Globe theater\", \"The Globe Theater\", \"Wooden O\", \"Shakespeare's Stage\"]", "[\"Boyzone...The Greatest Ever Collection: 1994-2010\", \"Love Me For A Reason: The B-Sides Collection\", \"Boyzone\", \"Boy zone\", \"BoyZone\"]", "[\"Ed teach\", \"Black Beard\", \"Teach, Edward\", \"Edward Teach\", \"Edward teach\", \"Captain Blackbeard\", \"Edward Thatch\", \"Blackbeard\"]", "[\"Belguim\", \"Koenigreich Belgien\", \"Belgium/Belgie\", \"Kingdom of Belgium\", \"Belgian\", \"Beljum\", \"K\\u00f6nigreich Belgien\", \"Belgique\", \"Belgium\", \"Beligum\", \"Kingdom of the Belgians\", \"Beljam\", \"Kingdom Of Belgium\", \"Belgum\", \"ISO 3166-1:BE\", \"Belgie\", \"Cockpit of Europe\", \"Koninkrijk Belgi\\u00eb\", \"Beldjike\", \"Blegium\", \"Belgio\", \"The Quebec of Europe\", \"Belgi\\u00eb\", \"Begium\", \"Royaume de Belgique\", \"Konigreich Belgien\", \"Koninkrijk Belgie\", \"People of Belgium\", \"Belgien\", \"Belgium/facts\", \"Administrative divisions of Belgium\", \"Belgium facts\"]", "[\"Mosaad\", \"Mossad\", \"The Mossad\", \"HaMossad leModi'in uleTafkidim Meyuhadim\", \"Institute for Intelligence and Special Operations\", \"MOSSAD\", \"Ha-Mossad le-Modiin ule-Tafkidim Meyuhadim\", \"Israeli intelligence\", \"The Institute for Intelligence and Special Operations\", \"Israel Secret Intelligence Service\", \"\\u05d4\\u05de\\u05d5\\u05e1\\u05d3 \\u05dc\\u05de\\u05d5\\u05d3\\u05d9\\u05e2\\u05d9\\u05df \\u05d5\\u05dc\\u05ea\\u05e4\\u05e7\\u05d9\\u05d3\\u05d9\\u05dd \\u05de\\u05d9\\u05d5\\u05d7\\u05d3\\u05d9\\u05dd\", \"Israeli Intelligence Agency\", \"Mosad\", \"Ha-Mossad le-Modiin u-le-Tafkidim Myukhadim\", \"Israeli secret service\", \"Mussad\", \"Israeli intelligence operatives\"]", "[\"Oxford, england\", \"Oxeford\", \"Lion Brewery (U.K.)\", \"Oxford, UK\", \"Oxford astrophysics\", \"City of Dreaming Spires\", \"Oxford, England\", \"Oxford (England)\", \"Oxford\", \"Oxford, Oxfordshire\", \"The Dreaming Spires\", \"City of Oxford\", \"UN/LOCODE:GBOXF\", \"OXFORD\", \"City of dreaming spires\", \"Ford of the Oxen\", \"County Borough of Oxford\", \"The weather in Oxford\", \"Oxford, United Kingdom\", \"Morrells brewery\", \"The city of dreaming spires\", \"Oxenaforda\"]", "[\"History of ants\", \"Giant ant\", \"Ant trail\", \"Worker ant\", \"Drone Ant\", \"Ants\", \"Formicidae\", \"Ant\", \"Ants communication\", \"Ergate\", \"Ant trails\", \"\\ud83d\\udc1c\"]", "[\"New Bridge (disambiguation)\", \"New Bridge\"]", "[\"PAUL DACRE\", \"Paul Dacre\"]", "[\"Melchior\", \"Melchiar\", \"Melchoir\"]", "[\"Randy Jackson (American Idol)\", \"Randy jackson\", \"Randy Jackson\", \"Randall Darius Jackson\", \"Randy darius jackson\"]", "[\"Sulpher\", \"Beta-sulfur\", \"Sulphurs\", \"Sulphurous\", \"Flower of sulfur\", \"\\ud83d\\udf0d\", \"Sulfurs\", \"Colloidal sulfur\", \"Sulfur compounds\", \"Brimstone (sulfur)\", \"Sulfur\", \"Sulfur/sulphur\", \"Sulphur compounds\", \"Sulvere\", \"Precipitated sulfur\", \"Beta-sulphur\", \"Sulphuric\", \"Liquid sulphur\", \"Sulfuric\", \"Sulfurically\", \"Sulphur\", \"Sulfur atom\", \"Sulphur compound\", \"ATC code D10AB02\", \"ATCvet code QD10AB02\", \"Sulfurous\", \"Sulfur isotope\", \"Sulphurously\", \"Sulphurically\", \"Purified sulfur\", \"Sublimed sulfur\", \"Wettable sulphur\", \"Sulpur\", \"Native sulfur\", \"Element 16\", \"Sulfur-bearing\", \"Sulfurously\", \"Sulfur (pharmacy)\", \"Sulfer\"]", "[\"Naseby\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Kid gloves (disambiguation)\", \"Kid gloves\", \"Kid's gloves\", \"Kid Gloves\", \"Kit gloves\"]", "[\"four\", \"4\"]", "[\"Shakspeare theatre\", \"Shakespeare's globe theatre\", \"The 1st Globe Theatre\", \"Globe Theatre\", \"Shakespeare's Globe Exhibition\", \"Globe Theater\", \"Globe theatre\", \"The Globe Theatre\", \"Shakespeare Globe Theatre\", \"Shakespeare's Globe Theater\", \"Globe theater\", \"The Globe Theater\", \"Wooden O\", \"Shakespeare's Stage\"]", "[\"Boyzone...The Greatest Ever Collection: 1994-2010\", \"Love Me For A Reason: The B-Sides Collection\", \"Boyzone\", \"Boy zone\", \"BoyZone\"]", "[\"Ed teach\", \"Black Beard\", \"Teach, Edward\", \"Edward Teach\", \"Edward teach\", \"Captain Blackbeard\", \"Edward Thatch\", \"Blackbeard\"]", "[\"Belguim\", \"Koenigreich Belgien\", \"Belgium/Belgie\", \"Kingdom of Belgium\", \"Belgian\", \"Beljum\", \"K\\u00f6nigreich Belgien\", \"Belgique\", \"Belgium\", \"Beligum\", \"Kingdom of the Belgians\", \"Beljam\", \"Kingdom Of Belgium\", \"Belgum\", \"ISO 3166-1:BE\", \"Belgie\", \"Cockpit of Europe\", \"Koninkrijk Belgi\\u00eb\", \"Beldjike\", \"Blegium\", \"Belgio\", \"The Quebec of Europe\", \"Belgi\\u00eb\", \"Begium\", \"Royaume de Belgique\", \"Konigreich Belgien\", \"Koninkrijk Belgie\", \"People of Belgium\", \"Belgien\", \"Belgium/facts\", \"Administrative divisions of Belgium\", \"Belgium facts\"]", "[\"Mosaad\", \"Mossad\", \"The Mossad\", \"HaMossad leModi'in uleTafkidim Meyuhadim\", \"Institute for Intelligence and Special Operations\", \"MOSSAD\", \"Ha-Mossad le-Modiin ule-Tafkidim Meyuhadim\", \"Israeli intelligence\", \"The Institute for Intelligence and Special Operations\", \"Israel Secret Intelligence Service\", \"\\u05d4\\u05de\\u05d5\\u05e1\\u05d3 \\u05dc\\u05de\\u05d5\\u05d3\\u05d9\\u05e2\\u05d9\\u05df \\u05d5\\u05dc\\u05ea\\u05e4\\u05e7\\u05d9\\u05d3\\u05d9\\u05dd \\u05de\\u05d9\\u05d5\\u05d7\\u05d3\\u05d9\\u05dd\", \"Israeli Intelligence Agency\", \"Mosad\", \"Ha-Mossad le-Modiin u-le-Tafkidim Myukhadim\", \"Israeli secret service\", \"Mussad\", \"Israeli intelligence operatives\"]", "[\"Oxford, england\", \"Oxeford\", \"Lion Brewery (U.K.)\", \"Oxford, UK\", \"Oxford astrophysics\", \"City of Dreaming Spires\", \"Oxford, England\", \"Oxford (England)\", \"Oxford\", \"Oxford, Oxfordshire\", \"The Dreaming Spires\", \"City of Oxford\", \"UN/LOCODE:GBOXF\", \"OXFORD\", \"City of dreaming spires\", \"Ford of the Oxen\", \"County Borough of Oxford\", \"The weather in Oxford\", \"Oxford, United Kingdom\", \"Morrells brewery\", \"The city of dreaming spires\", \"Oxenaforda\"]", "[\"History of ants\", \"Giant ant\", \"Ant trail\", \"Worker ant\", \"Drone Ant\", \"Ants\", \"Formicidae\", \"Ant\", \"Ants communication\", \"Ergate\", \"Ant trails\", \"\\ud83d\\udc1c\"]", "[\"New Bridge (disambiguation)\", \"New Bridge\"]", "[\"PAUL DACRE\", \"Paul Dacre\"]", "[\"Melchior\", \"Melchiar\", \"Melchoir\"]", "[\"Randy Jackson (American Idol)\", \"Randy jackson\", \"Randy Jackson\", \"Randall Darius Jackson\", \"Randy darius jackson\"]", "[\"Sulpher\", \"Beta-sulfur\", \"Sulphurs\", \"Sulphurous\", \"Flower of sulfur\", \"\\ud83d\\udf0d\", \"Sulfurs\", \"Colloidal sulfur\", \"Sulfur compounds\", \"Brimstone (sulfur)\", \"Sulfur\", \"Sulfur/sulphur\", \"Sulphur compounds\", \"Sulvere\", \"Precipitated sulfur\", \"Beta-sulphur\", \"Sulphuric\", \"Liquid sulphur\", \"Sulfuric\", \"Sulfurically\", \"Sulphur\", \"Sulfur atom\", \"Sulphur compound\", \"ATC code D10AB02\", \"ATCvet code QD10AB02\", \"Sulfurous\", \"Sulfur isotope\", \"Sulphurously\", \"Sulphurically\", \"Purified sulfur\", \"Sublimed sulfur\", \"Wettable sulphur\", \"Sulpur\", \"Native sulfur\", \"Element 16\", \"Sulfur-bearing\", \"Sulfurously\", \"Sulfur (pharmacy)\", \"Sulfer\"]", "[\"Naseby\"]" ]
[ "What type of gloves are made with the skin of young goats?", "How many roods make an acre?", "Which London theatre has a thatched roof?", "Ronan Keating was a member of which band?", "Featuring prominently in the new Pirates of the Caribbean movie, the pirate Edward Teach is better known by what name?", "In which country was actress Audrey Hepburn born?", "Which intelligence agency was founded in 1951 by Isser Harel who served as its director until 1963?", "What is the oldest university in England?", "Scientists announced in 2012 that more than 1,000 of what creatures (formica lugubris) had been fitted with tiny radio transmitters to study the species?", "Pont Neuf is the oldest bridge in Paris. What does its name mean?", "Who has been the editor of the Daily Mail since 1992?", "Which of the Wise Men was said to have brought the gift of gold for the baby Jesus?", "Which of the American Idol judges has been there for all 10 seasons?", "Brimstone is an old word for which chemical element?", "Where was the battle fought between the Royalist forces under Prince Rupert and Oliver Cromwell's men in June 1645 that was the key to the final downfall of Royalist forces a year later?" ]
15
[ 82365, 82366, 82367, 82368, 82369, 82370, 82371, 82372, 82373, 82374, 82375, 82376, 82377, 82378, 82379 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: In terms of population what is New Zealand's largest city?\nQuestion 2: What was the first sitcom where Mickey Rooney was not called Mickey?\nQuestion 3: Alan Ginsberg is credited with inventing what 60s phrase?\nQuestion 4: Whose catchphrase was 'Can you hear me Mother'?\nQuestion 5: In which London park does the annual Frieze Art Fair take place?\nQuestion 6: Harold Sakata won a silver medal in Olympic weightlifting but became more famous playing which villain in a James Bond film?\nQuestion 7: Which islands lie off the Northwest coast of Anglesey?\nQuestion 8: During which month does the Summer Solstice occur in the Southern Hemisphere?\nQuestion 9: What was Peter Andre's first top ten entry (1996)\nQuestion 10: \"From which Shakespeare play doesthe quotation, \"\"Lord what fools these mortals be\"\", come?\"\nQuestion 11: Name the only Quaker to be elected President of the United States?\nQuestion 12: Who wrote the opera Wozzeck in 1922?\nQuestion 13: The first passenger fare-paying railway service was established in which European country in 1807?\nQuestion 14: In 2005 Yulia Tymoshenko became the first female Prime Minister of which country?\nQuestion 15: John Ridd is the hero of which novel by R D Blackmore?", "role": "user" } ]
["[\"T\\u0101maki-makau-rau\", \"Aucklander\", \"Auckland, NZ\", \"Aucklnd\", \"Auckland New Zealand\", \"Auckland\", \"Auckland NZ\", \"Auckand\", \"Attractions and Landmarks in Auckland\", \"Auckland Metropolitan Area\", \"New Zealand Auckland\", \"Pacific/Auckland\", \"UN/LOCODE:NZAKL\", \"T\\u0101maki Makau Rau\", \"Auckland, New Zealand\", \"City of Sails\", \"Tamaki Makau Rau\"]", "[\"One of the Boys\", \"One of the boys\", \"One Of The Boys\", \"One of the Boys (album)\", \"One of the Boys (song)\", \"One of The Boys\", \"One of the Boys (disambiguation)\"]", "[\"Flower power\", \"Flower Power\"]", "[\"Sandy Powell (disambiguation)\", \"SANDY POWELL\", \"Sandy Powell\", \"Powell, Sandy\"]", "[\"Regent's Park\", \"Regent's park\", \"Regent's Park, London\", \"Queen Mary's Gardens\", \"Regents Park\", \"Regent\\u2019s Park\"]", "[\"Oddjob\", \"Oddjob (James Bond)\", \"Oddjob's hat\"]", "[\"Skerries (disambiguation)\", \"Skerry (disambiguation)\", \"The Skerries\", \"Skerries\"]", "[\"December\", \"\\u32cb\", \"Xber\", \"Dec.\", \"Decembre\"]", "[\"Mysterious Girl\"]", "[\"A midsummer night's dream\", \"A Midsummer Night's dream\", \"Demetrius (A Midsummer Night's Dream)\", \"A Midsummer Nights' Dream\", \"Lysander (Midsummer Night Dream)\", \"A midsummer's dream\", \"A mid summer night's dream\", \"Pease-blossom\", \"A Midsummer Night's Dream\", \"A Midsummernight's Dream\", \"Incidental Music to A Midsummer Night's Dream\", \"Peaseblossom\", \"AMND\", \"A Midsummer Night'S Dream\", \"Hermia and Helena\", \"Midsummer Night\\u2019s Dream\", \"A Midsummer Night\\u2019s Dream\", \"Midsummer Nights Dream\", \"Hippolyta (Shakespeare)\", \"Midsummer Night's Dream\", \"'A MIDSUMMER NIGHT'S DREAM'\", \"A Midsommer Nights Dreame\", \"A Midsummer Nights Dream\", \"Midsummer nights dream\", \"Lysander (Shakespeare)\", \"The Rude Mechanicals\", \"A Midsummer Night's Dream, Act IV\", \"Rude Mechanic\", \"A Midsummer's Night Dream\", \"Lysander (A Midsummer Night's Dream)\", \"A midsummernight's dream\", \"A Midsummer-Night's Dream\", \"Midsummer-Night's Dream\", \"A Mid\\u017fommer Nights Dreame\", \"Demetrius (Midsummer Night Dream)\", \"Midsummer night dream\", \"A Middsummer Night's Dream\", \"MSND\"]", "[\"I'm not a crook\", \"Richard nixon\", \"Nixson\", \"Richard Milhouse Nixon\", \"Richard Milhous Nixon\", \"Nixonian\", \"Richard Nixon\", \"Dick Nixon\", \"Nixonite\", \"Nixon, Richard\", \"37th President of the United States\", \"Resignation of Richard Nixon\", \"Richard Nickson\", \"Tricky Dick Nixon\", \"Nixon's\", \"Arthur Burdg Nixon\", \"Richard M. Nixon\", \"Tricky Dick\", \"Arthur Nixon\", \"Nixon\", \"Harold Samuel Nixon\", \"Richard M Nixon\", \"Harold Nixon\", \"RICHARD M NIXON\", \"Nixon, Richard Milhous\", \"Nixon, Richard M.\", \"Nichard rixon\"]", "[\"Alban Berg\", \"ALBAN BERG\", \"Alban berg\", \"Alben Berg\", \"Alban Maria Johannes Berg\"]", "[\"Welsh nation\", \"Climate of Wales\", \"Autonomous Province of Wales\", \"Cymru / wales\", \"Cyrmu\", \"Wales\", \"WALES\", \"Rain in Wales\", \"Welsh Nation\", \"Welsh Peninsula\", \"Wales, UK\", \"Etymology of Wales\", \"Cymru\", \"Wales, United Kingdom\", \"Pays de Galles\", \"Communications in Wales\", \"The Principality of Wales\", \"West of the Rhymney\", \"Wales, U.K.\", \"Cymru am byth\", \"Gymru\", \"Cymru / Wales\", \"Welsh mountains\", \"CYMRU\"]", "[\"Ukrainian territory\", \"Ukra\\u02c8jina\", \"Ukraine during World War II\", \"UKR\", \"Ukrayina\", \"Ukarine\", \"Ukraien\", \"The ukrane\", \"Ukrania\", \"Ukra'jina\", \"Kiev compromise\", \"Ucraine\", \"Ukraine\", \"Ukraina\", \"Ukrainia\", \"Ukrajina\", \"ISO 3166-1:UA\", \"Ukrane\", \"Ykpaiha\", \"Ukriane\", \"\\u0423\\u043a\\u0440\\u0430\\u0438\\u043d\\u0430\", \"The Ukraine\", \"Ukra\\u00efne\", \"\\u0423\\u043a\\u0440\\u0430\\u0457\\u043d\\u0430\"]", "[\"Lorna Doon\", \"Lorna Doone\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"T\\u0101maki-makau-rau\", \"Aucklander\", \"Auckland, NZ\", \"Aucklnd\", \"Auckland New Zealand\", \"Auckland\", \"Auckland NZ\", \"Auckand\", \"Attractions and Landmarks in Auckland\", \"Auckland Metropolitan Area\", \"New Zealand Auckland\", \"Pacific/Auckland\", \"UN/LOCODE:NZAKL\", \"T\\u0101maki Makau Rau\", \"Auckland, New Zealand\", \"City of Sails\", \"Tamaki Makau Rau\"]", "[\"One of the Boys\", \"One of the boys\", \"One Of The Boys\", \"One of the Boys (album)\", \"One of the Boys (song)\", \"One of The Boys\", \"One of the Boys (disambiguation)\"]", "[\"Flower power\", \"Flower Power\"]", "[\"Sandy Powell (disambiguation)\", \"SANDY POWELL\", \"Sandy Powell\", \"Powell, Sandy\"]", "[\"Regent's Park\", \"Regent's park\", \"Regent's Park, London\", \"Queen Mary's Gardens\", \"Regents Park\", \"Regent\\u2019s Park\"]", "[\"Oddjob\", \"Oddjob (James Bond)\", \"Oddjob's hat\"]", "[\"Skerries (disambiguation)\", \"Skerry (disambiguation)\", \"The Skerries\", \"Skerries\"]", "[\"December\", \"\\u32cb\", \"Xber\", \"Dec.\", \"Decembre\"]", "[\"Mysterious Girl\"]", "[\"A midsummer night's dream\", \"A Midsummer Night's dream\", \"Demetrius (A Midsummer Night's Dream)\", \"A Midsummer Nights' Dream\", \"Lysander (Midsummer Night Dream)\", \"A midsummer's dream\", \"A mid summer night's dream\", \"Pease-blossom\", \"A Midsummer Night's Dream\", \"A Midsummernight's Dream\", \"Incidental Music to A Midsummer Night's Dream\", \"Peaseblossom\", \"AMND\", \"A Midsummer Night'S Dream\", \"Hermia and Helena\", \"Midsummer Night\\u2019s Dream\", \"A Midsummer Night\\u2019s Dream\", \"Midsummer Nights Dream\", \"Hippolyta (Shakespeare)\", \"Midsummer Night's Dream\", \"'A MIDSUMMER NIGHT'S DREAM'\", \"A Midsommer Nights Dreame\", \"A Midsummer Nights Dream\", \"Midsummer nights dream\", \"Lysander (Shakespeare)\", \"The Rude Mechanicals\", \"A Midsummer Night's Dream, Act IV\", \"Rude Mechanic\", \"A Midsummer's Night Dream\", \"Lysander (A Midsummer Night's Dream)\", \"A midsummernight's dream\", \"A Midsummer-Night's Dream\", \"Midsummer-Night's Dream\", \"A Mid\\u017fommer Nights Dreame\", \"Demetrius (Midsummer Night Dream)\", \"Midsummer night dream\", \"A Middsummer Night's Dream\", \"MSND\"]", "[\"I'm not a crook\", \"Richard nixon\", \"Nixson\", \"Richard Milhouse Nixon\", \"Richard Milhous Nixon\", \"Nixonian\", \"Richard Nixon\", \"Dick Nixon\", \"Nixonite\", \"Nixon, Richard\", \"37th President of the United States\", \"Resignation of Richard Nixon\", \"Richard Nickson\", \"Tricky Dick Nixon\", \"Nixon's\", \"Arthur Burdg Nixon\", \"Richard M. Nixon\", \"Tricky Dick\", \"Arthur Nixon\", \"Nixon\", \"Harold Samuel Nixon\", \"Richard M Nixon\", \"Harold Nixon\", \"RICHARD M NIXON\", \"Nixon, Richard Milhous\", \"Nixon, Richard M.\", \"Nichard rixon\"]", "[\"Alban Berg\", \"ALBAN BERG\", \"Alban berg\", \"Alben Berg\", \"Alban Maria Johannes Berg\"]", "[\"Welsh nation\", \"Climate of Wales\", \"Autonomous Province of Wales\", \"Cymru / wales\", \"Cyrmu\", \"Wales\", \"WALES\", \"Rain in Wales\", \"Welsh Nation\", \"Welsh Peninsula\", \"Wales, UK\", \"Etymology of Wales\", \"Cymru\", \"Wales, United Kingdom\", \"Pays de Galles\", \"Communications in Wales\", \"The Principality of Wales\", \"West of the Rhymney\", \"Wales, U.K.\", \"Cymru am byth\", \"Gymru\", \"Cymru / Wales\", \"Welsh mountains\", \"CYMRU\"]", "[\"Ukrainian territory\", \"Ukra\\u02c8jina\", \"Ukraine during World War II\", \"UKR\", \"Ukrayina\", \"Ukarine\", \"Ukraien\", \"The ukrane\", \"Ukrania\", \"Ukra'jina\", \"Kiev compromise\", \"Ucraine\", \"Ukraine\", \"Ukraina\", \"Ukrainia\", \"Ukrajina\", \"ISO 3166-1:UA\", \"Ukrane\", \"Ykpaiha\", \"Ukriane\", \"\\u0423\\u043a\\u0440\\u0430\\u0438\\u043d\\u0430\", \"The Ukraine\", \"Ukra\\u00efne\", \"\\u0423\\u043a\\u0440\\u0430\\u0457\\u043d\\u0430\"]", "[\"Lorna Doon\", \"Lorna Doone\"]" ]
[ "In terms of population what is New Zealand's largest city?", "What was the first sitcom where Mickey Rooney was not called Mickey?", "Alan Ginsberg is credited with inventing what 60s phrase?", "Whose catchphrase was 'Can you hear me Mother'?", "In which London park does the annual Frieze Art Fair take place?", "Harold Sakata won a silver medal in Olympic weightlifting but became more famous playing which villain in a James Bond film?", "Which islands lie off the Northwest coast of Anglesey?", "During which month does the Summer Solstice occur in the Southern Hemisphere?", "What was Peter Andre's first top ten entry (1996)", "\"From which Shakespeare play doesthe quotation, \"\"Lord what fools these mortals be\"\", come?\"", "Name the only Quaker to be elected President of the United States?", "Who wrote the opera Wozzeck in 1922?", "The first passenger fare-paying railway service was established in which European country in 1807?", "In 2005 Yulia Tymoshenko became the first female Prime Minister of which country?", "John Ridd is the hero of which novel by R D Blackmore?" ]
15
[ 85410, 85411, 85412, 85413, 85414, 85415, 85416, 85417, 85418, 85419, 85420, 85421, 85422, 85423, 85424 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What type of implement is an Indonesian kris ?\nQuestion 2: \"\"\"Peggy\"\" is a shortened version of what name?\"\nQuestion 3: Which fish is known in the British fishing industry as 'Silver Darlings'?\nQuestion 4: What word, also linked to President Kennedy's liking for a Broadway musical, was used for the first time in a 1963 Life magazine article to describe a 60's era?\nQuestion 5: How many different hats does Madonna wear in Evita?\nQuestion 6: Who hosted the 2010 ICC World Twenty20 Tournament?\nQuestion 7: What is a pluviometer used to measure?\nQuestion 8: On this day in 1993 (4th Aug.), two Los Angeles police officers were sentenced to jail for their brutal assault of which African-American motorist?\nQuestion 9: Anthony Hopkins and Emma Thompson play the head butler and housekeeper in which 1993 film?\nQuestion 10: Which geographical location was the first word spoken on the moon?\nQuestion 11: Which of the nine counties of Ulster has the shortest name?\nQuestion 12: Which golfer sank a six foot putt to retain the Ryder Cup for Europe in 2012?\nQuestion 13: \"Where is \"\"The Royal Tennis Court\"\", a \"\"real tennis\"\" court built for Henry VIII of England who played there from 1528, that is still home to an active \"\"real tennis\"\" club?\"\nQuestion 14: The writing system of Elder Futhark (that was later simplified to Younger Futhark) is the oldest form of what alphabet?\nQuestion 15: Which vegetable is traditionally the main ingredient in a Spanish omelette?", "role": "user" } ]
["[\"Nozh\", \"DAGGER\", \"The Dagger (disambiguation)\", \"\\u041d\\u043e\\u0436\", \"The Dagger\"]", "[\"Margrete\", \"Margaret (name)\", \"Margarete\", \"Margaret film\", \"Margaret (film)\", \"Margaret movie\", \"Margaret Christina\", \"Margaret\", \"Marketta\", \"\\u039c\\u03b1\\u03c1\\u03b3\\u03b1\\u03c1\\u03af\\u03c4\\u03b1\"]", "[\"White herring\", \"Str\\u00f6mming\", \"Herring fishery\", \"Two-eyed steak\", \"Two Eyed Steak\", \"Two eyed steak\", \"Sild\", \"Stromming\", \"Herring\", \"Stroemming\"]", "[\"Camelot\", \"'Camelot'\"]", "[\"39\", \"thirty-nine\"]", "[\"West indies\", \"West indes\", \"West Indies\", \"WEST INDIES\"]", "[\"Rainfall\", \"Rainy\", \"Pissing it Down\", \"Rainiest\", \"\\ud83c\\udf27\", \"Raining\", \"Rains\", \"Wettest spot on Earth\", \"\\u26c6\", \"Intensity frequency and duration\", \"Rain\", \"Heavy rain (meteorology)\", \"Rain measurement\", \"Rained\", \"Rainstorm\", \"Torrential rain\", \"Pissing it down\", \"Hyetal\", \"Rainwater\", \"Rain storm\", \"Pluviophile\"]", "[\"George Holliday (witness)\", \"Beating of Rodney King\", \"Straight Alta-Pazz Recording Company\", \"Can't we all just get along%3F\", \"Glen King\", \"Rodney King case\", \"Why can't we all just get along\", \"Rodney king beatings\", \"King, Rodney\", \"Rodney King beating\", \"Rodney G. King\", \"Can't we all just get along\", \"RODNEY KING\", \"Rodney King incident\", \"Rodney King\", \"Rodney Glen King\"]", "[\"The Remains of the Day\", \"The remains of the day\", \"Remains of the Day\", \"Remains of the day\", \"The Remains Of The Day\"]", "[\"Houstonians\", \"Houston, Texas\", \"The City of Houston\", \"Houstan, TX\", \"Houston texas\", \"City of Houston\", \"Media of Houston\", \"Houston city\", \"Houstan, Texas\", \"Houston, Texas, USA\", \"Ciudadehouston.org\", \"Media in Houston\", \"Houston Texas\", \"Houston, Texas (redir)\", \"Houston, USA\", \"The Energy Capital of the World\", \"Houston, United States\", \"Houston, Texas, U.S.A.\", \"Houston, Texas, U.S.\", \"Houstontx.gov\", \"Houston, TX, USA\", \"Houston, US-TX\", \"Hoston\", \"UN/LOCODE:USHOU\", \"Houston, Texas, United States\", \"Houston, Tx\", \"Houston\", \"Houston, texas\", \"Houston,Texas\", \"Houston, Tex.\", \"Houstan\", \"Houston (TX)\", \"Houston TX\", \"Houston,TX\", \"City of Houston, Texas\", \"Houston, TX\", \"Houston,Texas, United States\"]", "[\"DOWN\", \"Down (constituency)\", \"Down (album)\", \"Down\", \"Down (disambiguation)\", \"Down (song)\"]", "[\"Martin Kymer\", \"Martin Kaymer\", \"MARTIN KAYMER\"]", "[\"Hampton Court Palace Maze\", \"Hampton Court Palace\", \"Hampton Court\", \"Chapel Royal (Hampton Court Palace)\", \"Hampton Court Gardens\"]", "[\"Runic script\", \"Runes\", \"Runic alphabets\", \"Futharc\", \"Germanic rune\", \"Futhark\", \"Runic (script)\", \"Urzu\", \"Germanic runes\", \"Scandinavian alphabet\", \"Runes and their meanings\", \"Gothic Rune\", \"Germanic script\", \"Runekjevle\", \"Marcomannic runes\", \"Runr\", \"ISO 15924:Runr\", \"Runr (script)\", \"Teutonic alphabet\", \"Rune language\", \"Rune\", \"Futhark language\", \"Runic alphabet\", \"Runic letters\", \"Germanic alphabet\", \"Futhark alphabet\", \"Runic\", \"Rune writing\", \"Runic language\", \"Fu\\u00feark\"]", "[\"Idaho potato\", \"Potato farmer\", \"Potatos\", \"Cooking potatoes\", \"Boiled Potatoes\", \"Potato, Irish\", \"Pottato\", \"Tattie\", \"New potatoes\", \"Pomme Terre\", \"Pratie\", \"Patatoes\", \"Potato farm\", \"German Butterball\", \"Poetato\", \"Spud\", \"History of Potatoes\", \"Solanum tuberosum\", \"Roast potato\", \"Potato (northern)\", \"Red potato\", \"White potatoes\", \"Potato\", \"White potato\", \"Potatoes\", \"Super tuber\", \"Boiled potatos\", \"New potato\", \"Potato industry\", \"Kerris Pink\", \"Irish potato\", \"Boiled potato\", \"Potater\", \"Purple potato\", \"Tatey\", \"Alu (tuber)\", \"History of potatoes\", \"Red Potato\", \"Maris Peer\", \"Potatoe\", \"Potato farmers\", \"Idaho Potato\", \"Solanum tuberosum tuberosum\", \"Culture of potato\", \"Pateeto\", \"Red potatoes\", \"Poetatoe\", \"Boiled potatoes\", \"Tatties\", \"Blue potato\", \"Potato skin\", \"Spuds\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Nozh\", \"DAGGER\", \"The Dagger (disambiguation)\", \"\\u041d\\u043e\\u0436\", \"The Dagger\"]", "[\"Margrete\", \"Margaret (name)\", \"Margarete\", \"Margaret film\", \"Margaret (film)\", \"Margaret movie\", \"Margaret Christina\", \"Margaret\", \"Marketta\", \"\\u039c\\u03b1\\u03c1\\u03b3\\u03b1\\u03c1\\u03af\\u03c4\\u03b1\"]", "[\"White herring\", \"Str\\u00f6mming\", \"Herring fishery\", \"Two-eyed steak\", \"Two Eyed Steak\", \"Two eyed steak\", \"Sild\", \"Stromming\", \"Herring\", \"Stroemming\"]", "[\"Camelot\", \"'Camelot'\"]", "[\"39\", \"thirty-nine\"]", "[\"West indies\", \"West indes\", \"West Indies\", \"WEST INDIES\"]", "[\"Rainfall\", \"Rainy\", \"Pissing it Down\", \"Rainiest\", \"\\ud83c\\udf27\", \"Raining\", \"Rains\", \"Wettest spot on Earth\", \"\\u26c6\", \"Intensity frequency and duration\", \"Rain\", \"Heavy rain (meteorology)\", \"Rain measurement\", \"Rained\", \"Rainstorm\", \"Torrential rain\", \"Pissing it down\", \"Hyetal\", \"Rainwater\", \"Rain storm\", \"Pluviophile\"]", "[\"George Holliday (witness)\", \"Beating of Rodney King\", \"Straight Alta-Pazz Recording Company\", \"Can't we all just get along%3F\", \"Glen King\", \"Rodney King case\", \"Why can't we all just get along\", \"Rodney king beatings\", \"King, Rodney\", \"Rodney King beating\", \"Rodney G. King\", \"Can't we all just get along\", \"RODNEY KING\", \"Rodney King incident\", \"Rodney King\", \"Rodney Glen King\"]", "[\"The Remains of the Day\", \"The remains of the day\", \"Remains of the Day\", \"Remains of the day\", \"The Remains Of The Day\"]", "[\"Houstonians\", \"Houston, Texas\", \"The City of Houston\", \"Houstan, TX\", \"Houston texas\", \"City of Houston\", \"Media of Houston\", \"Houston city\", \"Houstan, Texas\", \"Houston, Texas, USA\", \"Ciudadehouston.org\", \"Media in Houston\", \"Houston Texas\", \"Houston, Texas (redir)\", \"Houston, USA\", \"The Energy Capital of the World\", \"Houston, United States\", \"Houston, Texas, U.S.A.\", \"Houston, Texas, U.S.\", \"Houstontx.gov\", \"Houston, TX, USA\", \"Houston, US-TX\", \"Hoston\", \"UN/LOCODE:USHOU\", \"Houston, Texas, United States\", \"Houston, Tx\", \"Houston\", \"Houston, texas\", \"Houston,Texas\", \"Houston, Tex.\", \"Houstan\", \"Houston (TX)\", \"Houston TX\", \"Houston,TX\", \"City of Houston, Texas\", \"Houston, TX\", \"Houston,Texas, United States\"]", "[\"DOWN\", \"Down (constituency)\", \"Down (album)\", \"Down\", \"Down (disambiguation)\", \"Down (song)\"]", "[\"Martin Kymer\", \"Martin Kaymer\", \"MARTIN KAYMER\"]", "[\"Hampton Court Palace Maze\", \"Hampton Court Palace\", \"Hampton Court\", \"Chapel Royal (Hampton Court Palace)\", \"Hampton Court Gardens\"]", "[\"Runic script\", \"Runes\", \"Runic alphabets\", \"Futharc\", \"Germanic rune\", \"Futhark\", \"Runic (script)\", \"Urzu\", \"Germanic runes\", \"Scandinavian alphabet\", \"Runes and their meanings\", \"Gothic Rune\", \"Germanic script\", \"Runekjevle\", \"Marcomannic runes\", \"Runr\", \"ISO 15924:Runr\", \"Runr (script)\", \"Teutonic alphabet\", \"Rune language\", \"Rune\", \"Futhark language\", \"Runic alphabet\", \"Runic letters\", \"Germanic alphabet\", \"Futhark alphabet\", \"Runic\", \"Rune writing\", \"Runic language\", \"Fu\\u00feark\"]", "[\"Idaho potato\", \"Potato farmer\", \"Potatos\", \"Cooking potatoes\", \"Boiled Potatoes\", \"Potato, Irish\", \"Pottato\", \"Tattie\", \"New potatoes\", \"Pomme Terre\", \"Pratie\", \"Patatoes\", \"Potato farm\", \"German Butterball\", \"Poetato\", \"Spud\", \"History of Potatoes\", \"Solanum tuberosum\", \"Roast potato\", \"Potato (northern)\", \"Red potato\", \"White potatoes\", \"Potato\", \"White potato\", \"Potatoes\", \"Super tuber\", \"Boiled potatos\", \"New potato\", \"Potato industry\", \"Kerris Pink\", \"Irish potato\", \"Boiled potato\", \"Potater\", \"Purple potato\", \"Tatey\", \"Alu (tuber)\", \"History of potatoes\", \"Red Potato\", \"Maris Peer\", \"Potatoe\", \"Potato farmers\", \"Idaho Potato\", \"Solanum tuberosum tuberosum\", \"Culture of potato\", \"Pateeto\", \"Red potatoes\", \"Poetatoe\", \"Boiled potatoes\", \"Tatties\", \"Blue potato\", \"Potato skin\", \"Spuds\"]" ]
[ "What type of implement is an Indonesian kris ?", "\"\"\"Peggy\"\" is a shortened version of what name?\"", "Which fish is known in the British fishing industry as 'Silver Darlings'?", "What word, also linked to President Kennedy's liking for a Broadway musical, was used for the first time in a 1963 Life magazine article to describe a 60's era?", "How many different hats does Madonna wear in Evita?", "Who hosted the 2010 ICC World Twenty20 Tournament?", "What is a pluviometer used to measure?", "On this day in 1993 (4th Aug.), two Los Angeles police officers were sentenced to jail for their brutal assault of which African-American motorist?", "Anthony Hopkins and Emma Thompson play the head butler and housekeeper in which 1993 film?", "Which geographical location was the first word spoken on the moon?", "Which of the nine counties of Ulster has the shortest name?", "Which golfer sank a six foot putt to retain the Ryder Cup for Europe in 2012?", "\"Where is \"\"The Royal Tennis Court\"\", a \"\"real tennis\"\" court built for Henry VIII of England who played there from 1528, that is still home to an active \"\"real tennis\"\" club?\"", "The writing system of Elder Futhark (that was later simplified to Younger Futhark) is the oldest form of what alphabet?", "Which vegetable is traditionally the main ingredient in a Spanish omelette?" ]
15
[ 8940, 8941, 8942, 8943, 8944, 8945, 8946, 8947, 8948, 8949, 8950, 8951, 8952, 8953, 8954 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: \"Which Cornish engineer demonstrated one of the first steam locomotives called \"\"Catch Me If You Can\"\" giving rides on a circular track near Bloomsbury in 1808 ?\"\nQuestion 2: In what ancient country did Zoroastrianism originate?\nQuestion 3: In Greek mythology, Hypnos was the god of what?\nQuestion 4: Give the surname of the British father and son who shared the Nobel Prize for Physics in 1915?\nQuestion 5: Who helped Theseus escape from the Labyrinth?\nQuestion 6: A courgette is a small variety of what?\nQuestion 7: With an atomic number of 86, what element, the heaviest of the noble gasses, uses the symbol Rn?\nQuestion 8: The Basque country is centred mainly around which mountain range?\nQuestion 9: The Kaizer Chiefs is a premier league football team in which country?\nQuestion 10: Who according to a song by Ian Dury was a charmer, as a writer he was brahma. velvet jackets and pyjamas, the gay divorcee and other dramas?\nQuestion 11: What nationality is Justine Henin, winner of 7 Grand Slam singles titles and an Olympic gold medal, who retired from professional tennis in 2008 when ranked World No. 1 and returned in 2010?\nQuestion 12: Which English singer was described as ‘The barefoot pop princess of the 1960’s’?\nQuestion 13: Which predominantly American grape variety is genetically identical to the southern Italian grape Primitivo?\nQuestion 14: Which English city has districts called 'Manningham', 'Great Horton'and 'Heaton'?\nQuestion 15: What is the process of gathering fabric by means of drawn or elasticated threads in parallel rows?", "role": "user" } ]
["[\"Puffing Devil\", \"The Puffing Devil\", \"Pen-y-Darren (locomotive)\", \"RICHARD TREVITHICK\", \"Richard Trevethick\", \"Richard Trevithick\", \"Trevethick\", \"High pressure engine\"]", "[\"Ir\\u0101n\", \"Historical names of Iran\", \"Persia (Iran)\", \"Iran (Islamic Republic of)\", \"Iran, Islamic Republic of\", \"ISO 3166-1:IR\", \"Shi'ite Republic of Iran\", \"Jomh\\u016br\\u012b-ye Esl\\u0101m\\u012b-ye \\u012ar\\u0101n\", \"Iran blockade\", \"Iran consumption expenditure\", \"IRan\", \"Naval blockade of iran\", \"The Islamic Republic of Iran\", \"Jomhuri Ye Islami Ye Iran\", \"Ir\\u00e3n\", \"\\u062c\\u0645\\u0647\\u0648\\u0631\\u06cc \\u0627\\u0633\\u0644\\u0627\\u0645\\u06cc \\u0627\\u064a\\u0631\\u0627\\u0646\", \"Ir\\u00e1n\", \"Historical Names of Iran\", \"Iran (Persia)\", \"Iranian Republic\", \"La Perse\", \"Islamic Republic of Persia\", \"\\u0625\\u064a\\u0631\\u0627\\u0646\", \"\\u0627\\u06cc\\u0631\\u0627\\u0646\", \"Islamic State of Iran\", \"Ira\\u00f1\", \"IRAN\", \"Ir\\u00e2n\", \"Jomhuri-ye Eslami-ye Iran\", \"\\u062c\\u0645\\u0647\\u0648\\u0631\\u06cc \\u0627\\u0633\\u0644\\u0627\\u0645\\u06cc \\u0627\\u06cc\\u0631\\u0627\\u0646\", \"I.R. of Iran\", \"PERSIA\", \"Islamic republic of Iran\", \"IR of Iran\", \"Persia\", \"Iran\", \"What language do they speak in Persia%3F\", \"Persian State of Iran\", \"Shia Republic of Iran\", \"I.R.Iran\", \"Jomhuri-ye Esl\\u0101mi-ye Ir\\u0101n\", \"IR Iran\", \"Persian Region\", \"I.R. Iran\", \"Islamic Republic of Iran\", \"Republic of Iran\", \"Islamic Iran\", \"Islamic Govermnet of Iran\"]", "[\"Snoozing\", \"Slept\", \"Nocturnal post absorptive catabolism\", \"Sleep demand\", \"Sleep requirement\", \"Active sleep\", \"Sleep patterns\", \"\\ud83d\\udca4\", \"Good sleep in bedroom\", \"Asleep\", \"Sleep pattern\", \"Waking up\", \"Human sleep\", \"Slumber\", \"Schlaf\", \"Sleep (human)\", \"Sleep stage\", \"A\\u017fleep\", \"Sleeping place\", \"Sleeps\", \"SLumber\", \"Sleeping\", \"Sleep\", \"Stages of sleep\", \"Active Sleep\", \"Sleep stages\", \"Neuro-homeostatic recuperation\"]", "[\"Bragg\", \"Bragg (disambiguation)\"]", "[\"Ariadne's string\", \"Arladne\", \"Euanthes\", \"Ariadne's thread\", \"Areatha\", \"Ariadne\"]", "[\"Marrows\", \"Marrow (TCM)\", \"Marrow\", \"Marrow (disambiguation)\"]", "[\"Thoron\", \"Niton (element)\", \"Radon (Rn)\", \"Radium emanation\", \"Element 86\", \"Radon\", \"Radon gas\", \"Household radon\", \"Emanation (chemistry)\", \"Radon poisoning\", \"Radon (element)\", \"Actinon\"]", "[\"Pyrenaean\", \"Pyranees\", \"Pyr\\u00e9n\\u00e9es Mountains\", \"Pyrenaei Montes\", \"Pyr\\u00e9n\\u00e9es\", \"Pyreneans\", \"Pyrenee Mountains\", \"Pyrenees Mountains\", \"Pyrenees\", \"Pirineos\", \"Pyren\\u00e9es\", \"The Pyrenees\", \"Pyreenes\", \"Pirineus\", \"Pireneus\", \"High Pyrenees\"]", "[\"South africa\", \"South Africa's\", \"Southafrica\", \"Third Republic (South Africa)\", \"Republiek van Suid-Afrika\", \"Sou'frica\", \"Zuid Afrika\", \"Zuid-Afrika\", \"ISO 3166-1:ZA\", \"South-African\", \"S Africa\", \"Zuid Africa\", \"Mzansi\", \"Afrique du sud\", \"Zuidafrika\", \"Ningizimu Afrika\", \"Capital of South Africa\", \"Suid-Afrika\", \"South-Africa\", \"Rep. of SOUTH AFRICA\", \"The Republic of South Africa\", \"Suid Africa\", \"Azania/South Africa\", \"S Afr\", \"Saffa\", \"South African\", \"Seth efrika\", \"South Africa\", \"Soufrica\", \"Republic of south africa\", \"South Africa\\u00e0\", \"The Beloved Country\", \"S. Africa\", \"Rep. of South Africa\", \"South Africans\", \"Republic of South Africa\"]", "[\"Sir No\\u00ebl Peirce Coward\", \"N\\u00f6el Coward\", \"Noeel Coward\", \"Noel Coward\", \"Hernia Whittlebot\", \"No\\u00ebl Coward\", \"Sir No\\u00ebl Pierce Coward\", \"No\\u00ebl Peirce Coward\", \"Cowardesque\", \"Noel Peirce Coward\", \"The Queen Was in Her Parlour\", \"Coward, Sir No\\u00ebl Peirce\", \"Cowardian\", \"Sir Noel Pierce Coward\", \"Star Quality (short story)\", \"The Marquise\", \"Sir Noel Coward\", \"Star Quality (play)\", \"No\\u00ebl Pierce Coward\", \"Sir No\\u00ebl Coward\", \"Coward, Sir Noel Pierce\", \"Sir Noel Peirce Coward\"]", "[\"Belguim\", \"Koenigreich Belgien\", \"Belgium/Belgie\", \"Kingdom of Belgium\", \"Belgian\", \"Beljum\", \"K\\u00f6nigreich Belgien\", \"Belgique\", \"Belgium\", \"Beligum\", \"Kingdom of the Belgians\", \"Beljam\", \"Kingdom Of Belgium\", \"Belgum\", \"ISO 3166-1:BE\", \"Belgie\", \"Cockpit of Europe\", \"Koninkrijk Belgi\\u00eb\", \"Beldjike\", \"Blegium\", \"Belgio\", \"The Quebec of Europe\", \"Belgi\\u00eb\", \"Begium\", \"Royaume de Belgique\", \"Konigreich Belgien\", \"Koninkrijk Belgie\", \"People of Belgium\", \"Belgien\", \"Belgium/facts\", \"Administrative divisions of Belgium\", \"Belgium facts\"]", "[\"Just A Disillusion\", \"Just a Disillusion\", \"Tonight in Tokyo\", \"Tonight In Tokyo\", \"Today (Chris Andrews song)\", \"Run (Sandie Shaw song)\", \"Tomorrow (Sandie Shaw song)\", \"Sandie Shaw\", \"Don't Run Away (Sandie Shaw song)\", \"I Don't Need Anything\", \"I'll Stop at Nothing\", \"How Can You Tell\", \"As Long as You're Happy Baby\", \"Sandi Shaw\", \"Nothing Comes Easy (song)\", \"I'll Stop At Nothing\", \"Sandra Goodrich\", \"Today (Sandie Shaw song)\", \"As Long As You're Happy Baby\", \"Show Me (Sandie Shaw song)\"]", "[\"Crljenak kastelanksi\", \"Zinfindel\", \"Primitivo\", \"Black St. Peters\", \"Zinfandel\", \"Zeinfandall\", \"Zinfandal\", \"Crljenak Kastelanski\", \"Zinfardell\", \"Tribidrag\", \"Crljenak Ka\\u0161telanski\", \"Kastelanski\"]", "[\"Bradford\", \"Bowling, Yorkshire\", \"New Victoria Theatre (Bradford)\", \"Bradistan\", \"Bradford, England\", \"Bradford, Yorkshire\", \"Girlington\", \"Bradford Beck\", \"Central Bradford\", \"Worstedopolis\", \"BRADFORD\", \"Bradford City Centre\", \"County Borough of Bradford\", \"Bradford, West Yorkshire\", \"Bradford city centre\", \"Pakiford\"]", "[\"Shirring\", \"Shirred\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Puffing Devil\", \"The Puffing Devil\", \"Pen-y-Darren (locomotive)\", \"RICHARD TREVITHICK\", \"Richard Trevethick\", \"Richard Trevithick\", \"Trevethick\", \"High pressure engine\"]", "[\"Ir\\u0101n\", \"Historical names of Iran\", \"Persia (Iran)\", \"Iran (Islamic Republic of)\", \"Iran, Islamic Republic of\", \"ISO 3166-1:IR\", \"Shi'ite Republic of Iran\", \"Jomh\\u016br\\u012b-ye Esl\\u0101m\\u012b-ye \\u012ar\\u0101n\", \"Iran blockade\", \"Iran consumption expenditure\", \"IRan\", \"Naval blockade of iran\", \"The Islamic Republic of Iran\", \"Jomhuri Ye Islami Ye Iran\", \"Ir\\u00e3n\", \"\\u062c\\u0645\\u0647\\u0648\\u0631\\u06cc \\u0627\\u0633\\u0644\\u0627\\u0645\\u06cc \\u0627\\u064a\\u0631\\u0627\\u0646\", \"Ir\\u00e1n\", \"Historical Names of Iran\", \"Iran (Persia)\", \"Iranian Republic\", \"La Perse\", \"Islamic Republic of Persia\", \"\\u0625\\u064a\\u0631\\u0627\\u0646\", \"\\u0627\\u06cc\\u0631\\u0627\\u0646\", \"Islamic State of Iran\", \"Ira\\u00f1\", \"IRAN\", \"Ir\\u00e2n\", \"Jomhuri-ye Eslami-ye Iran\", \"\\u062c\\u0645\\u0647\\u0648\\u0631\\u06cc \\u0627\\u0633\\u0644\\u0627\\u0645\\u06cc \\u0627\\u06cc\\u0631\\u0627\\u0646\", \"I.R. of Iran\", \"PERSIA\", \"Islamic republic of Iran\", \"IR of Iran\", \"Persia\", \"Iran\", \"What language do they speak in Persia%3F\", \"Persian State of Iran\", \"Shia Republic of Iran\", \"I.R.Iran\", \"Jomhuri-ye Esl\\u0101mi-ye Ir\\u0101n\", \"IR Iran\", \"Persian Region\", \"I.R. Iran\", \"Islamic Republic of Iran\", \"Republic of Iran\", \"Islamic Iran\", \"Islamic Govermnet of Iran\"]", "[\"Snoozing\", \"Slept\", \"Nocturnal post absorptive catabolism\", \"Sleep demand\", \"Sleep requirement\", \"Active sleep\", \"Sleep patterns\", \"\\ud83d\\udca4\", \"Good sleep in bedroom\", \"Asleep\", \"Sleep pattern\", \"Waking up\", \"Human sleep\", \"Slumber\", \"Schlaf\", \"Sleep (human)\", \"Sleep stage\", \"A\\u017fleep\", \"Sleeping place\", \"Sleeps\", \"SLumber\", \"Sleeping\", \"Sleep\", \"Stages of sleep\", \"Active Sleep\", \"Sleep stages\", \"Neuro-homeostatic recuperation\"]", "[\"Bragg\", \"Bragg (disambiguation)\"]", "[\"Ariadne's string\", \"Arladne\", \"Euanthes\", \"Ariadne's thread\", \"Areatha\", \"Ariadne\"]", "[\"Marrows\", \"Marrow (TCM)\", \"Marrow\", \"Marrow (disambiguation)\"]", "[\"Thoron\", \"Niton (element)\", \"Radon (Rn)\", \"Radium emanation\", \"Element 86\", \"Radon\", \"Radon gas\", \"Household radon\", \"Emanation (chemistry)\", \"Radon poisoning\", \"Radon (element)\", \"Actinon\"]", "[\"Pyrenaean\", \"Pyranees\", \"Pyr\\u00e9n\\u00e9es Mountains\", \"Pyrenaei Montes\", \"Pyr\\u00e9n\\u00e9es\", \"Pyreneans\", \"Pyrenee Mountains\", \"Pyrenees Mountains\", \"Pyrenees\", \"Pirineos\", \"Pyren\\u00e9es\", \"The Pyrenees\", \"Pyreenes\", \"Pirineus\", \"Pireneus\", \"High Pyrenees\"]", "[\"South africa\", \"South Africa's\", \"Southafrica\", \"Third Republic (South Africa)\", \"Republiek van Suid-Afrika\", \"Sou'frica\", \"Zuid Afrika\", \"Zuid-Afrika\", \"ISO 3166-1:ZA\", \"South-African\", \"S Africa\", \"Zuid Africa\", \"Mzansi\", \"Afrique du sud\", \"Zuidafrika\", \"Ningizimu Afrika\", \"Capital of South Africa\", \"Suid-Afrika\", \"South-Africa\", \"Rep. of SOUTH AFRICA\", \"The Republic of South Africa\", \"Suid Africa\", \"Azania/South Africa\", \"S Afr\", \"Saffa\", \"South African\", \"Seth efrika\", \"South Africa\", \"Soufrica\", \"Republic of south africa\", \"South Africa\\u00e0\", \"The Beloved Country\", \"S. Africa\", \"Rep. of South Africa\", \"South Africans\", \"Republic of South Africa\"]", "[\"Sir No\\u00ebl Peirce Coward\", \"N\\u00f6el Coward\", \"Noeel Coward\", \"Noel Coward\", \"Hernia Whittlebot\", \"No\\u00ebl Coward\", \"Sir No\\u00ebl Pierce Coward\", \"No\\u00ebl Peirce Coward\", \"Cowardesque\", \"Noel Peirce Coward\", \"The Queen Was in Her Parlour\", \"Coward, Sir No\\u00ebl Peirce\", \"Cowardian\", \"Sir Noel Pierce Coward\", \"Star Quality (short story)\", \"The Marquise\", \"Sir Noel Coward\", \"Star Quality (play)\", \"No\\u00ebl Pierce Coward\", \"Sir No\\u00ebl Coward\", \"Coward, Sir Noel Pierce\", \"Sir Noel Peirce Coward\"]", "[\"Belguim\", \"Koenigreich Belgien\", \"Belgium/Belgie\", \"Kingdom of Belgium\", \"Belgian\", \"Beljum\", \"K\\u00f6nigreich Belgien\", \"Belgique\", \"Belgium\", \"Beligum\", \"Kingdom of the Belgians\", \"Beljam\", \"Kingdom Of Belgium\", \"Belgum\", \"ISO 3166-1:BE\", \"Belgie\", \"Cockpit of Europe\", \"Koninkrijk Belgi\\u00eb\", \"Beldjike\", \"Blegium\", \"Belgio\", \"The Quebec of Europe\", \"Belgi\\u00eb\", \"Begium\", \"Royaume de Belgique\", \"Konigreich Belgien\", \"Koninkrijk Belgie\", \"People of Belgium\", \"Belgien\", \"Belgium/facts\", \"Administrative divisions of Belgium\", \"Belgium facts\"]", "[\"Just A Disillusion\", \"Just a Disillusion\", \"Tonight in Tokyo\", \"Tonight In Tokyo\", \"Today (Chris Andrews song)\", \"Run (Sandie Shaw song)\", \"Tomorrow (Sandie Shaw song)\", \"Sandie Shaw\", \"Don't Run Away (Sandie Shaw song)\", \"I Don't Need Anything\", \"I'll Stop at Nothing\", \"How Can You Tell\", \"As Long as You're Happy Baby\", \"Sandi Shaw\", \"Nothing Comes Easy (song)\", \"I'll Stop At Nothing\", \"Sandra Goodrich\", \"Today (Sandie Shaw song)\", \"As Long As You're Happy Baby\", \"Show Me (Sandie Shaw song)\"]", "[\"Crljenak kastelanksi\", \"Zinfindel\", \"Primitivo\", \"Black St. Peters\", \"Zinfandel\", \"Zeinfandall\", \"Zinfandal\", \"Crljenak Kastelanski\", \"Zinfardell\", \"Tribidrag\", \"Crljenak Ka\\u0161telanski\", \"Kastelanski\"]", "[\"Bradford\", \"Bowling, Yorkshire\", \"New Victoria Theatre (Bradford)\", \"Bradistan\", \"Bradford, England\", \"Bradford, Yorkshire\", \"Girlington\", \"Bradford Beck\", \"Central Bradford\", \"Worstedopolis\", \"BRADFORD\", \"Bradford City Centre\", \"County Borough of Bradford\", \"Bradford, West Yorkshire\", \"Bradford city centre\", \"Pakiford\"]", "[\"Shirring\", \"Shirred\"]" ]
[ "\"Which Cornish engineer demonstrated one of the first steam locomotives called \"\"Catch Me If You Can\"\" giving rides on a circular track near Bloomsbury in 1808 ?\"", "In what ancient country did Zoroastrianism originate?", "In Greek mythology, Hypnos was the god of what?", "Give the surname of the British father and son who shared the Nobel Prize for Physics in 1915?", "Who helped Theseus escape from the Labyrinth?", "A courgette is a small variety of what?", "With an atomic number of 86, what element, the heaviest of the noble gasses, uses the symbol Rn?", "The Basque country is centred mainly around which mountain range?", "The Kaizer Chiefs is a premier league football team in which country?", "Who according to a song by Ian Dury was a charmer, as a writer he was brahma. velvet jackets and pyjamas, the gay divorcee and other dramas?", "What nationality is Justine Henin, winner of 7 Grand Slam singles titles and an Olympic gold medal, who retired from professional tennis in 2008 when ranked World No. 1 and returned in 2010?", "Which English singer was described as ‘The barefoot pop princess of the 1960’s’?", "Which predominantly American grape variety is genetically identical to the southern Italian grape Primitivo?", "Which English city has districts called 'Manningham', 'Great Horton'and 'Heaton'?", "What is the process of gathering fabric by means of drawn or elasticated threads in parallel rows?" ]
15
[ 106095, 106096, 106097, 106098, 106099, 106100, 106101, 106102, 106103, 106104, 106105, 106106, 106107, 106108, 106109 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What letter is The Scarlet Letter in Nathaniel Hawthorne's novel of the same name?\nQuestion 2: Which Norwegian prince delivers the closing lines of Hamlet?\nQuestion 3: Who was banned from baseball in 1989?\nQuestion 4: Who wrote the 'Cadfael' series of novels?\nQuestion 5: Eric Arthur Blair was the real name of which famous novelist?\nQuestion 6: Which English football club won the 1994 FA Cup?\nQuestion 7: \"On what island did the term \"\"Mafia\"\" originate?\"\nQuestion 8: In which famous film was Frank Miller coming to kill Will Kane?\nQuestion 9: What type of food is Nori, which is often seen around sushi?\nQuestion 10: Who won the FIFA World Cup for Association Football in Germany in 2006?\nQuestion 11: Who played Aunt Renee in The Frogs Legacy?\nQuestion 12: Britain's second-longest-running TV serial has been running, as at the end of 2015, for how many years?\nQuestion 13: Who shared the 1909 Nobel Prize in Physics with German inventor Karl Ferdinand Braun in recognition of their contribution to the development of wireless telegraphy?\nQuestion 14: Which fashion designer was responsible for the trend of slogan-bearing T-shirts in the 1980's?\nQuestion 15: Which is the wold's largest rodent?", "role": "user" } ]
["[\"A\", \"\\uff21\", \"A (letter)\", \"\\ud83c\\udd30\", \"\\ud83c\\udd10\", \"U+0043\", \"\\ud83c\\udd50\", \"LetterA\", \"\\u249c\", \"The Letter A\"]", "[\"Fortinbras of Norway\", \"Fortinbras\"]", "[\"Charlie Hustle\", \"Peter E. Rose\", \"Pete Rose: An American Dilemma\", \"Charlie hustle\", \"4,256\", \"Peter Edward Rose\", \"Rose, Pete\", \"Pete Rose\", \"4256\"]", "[\"Peter Benedict\", \"Edith Pargeter\", \"Ellis Peters\", \"John Redfern\", \"Jolyon Carr\"]", "[\"Geoge orwell\", \"Arthur Blair\", \"GEORGE ORWELL\", \"Eric A. Blair\", \"George Orwell\", \"Eric Arthur Blair\", \"Eric Blair\", \"George (Eric Blair) Orwell\", \"G. Orwell\", \"P. S. Burton\", \"George orwell\", \"E.A. Blair\", \"Orwell, George\", \"Orwell Day\"]", "[\"Manchester Utd.\", \"Manchester United\", \"Donald Love\", \"Manchester U\", \"Manchester Red Devils\", \"Man UTD\", \"Manchester unted\", \"Manc united\", \"Manchester Utd FC\", \"Manchester United Football Club\", \"Manchester United F.C.\", \"Manchester united\", \"Kieran O'Hara\", \"F.c. man utd\", \"Manchester United F. C.\", \"Manchester United FC\", \"Manchester+United\", \"Man. United\", \"Man. u\", \"Newton Heath L&YR F.C.\", \"Manchester united squad\", \"Manchester United F C\", \"Manchester Utd\", \"Manutd\", \"Man u\", \"Manchester United F.C\", \"Newton Heath F.C.\", \"Manchester united F.C.\", \"ManYoo\", \"Man Utd\", \"Fc man utd\", \"Mufc\", \"Newton Heath LYR F.C.\", \"Man-U\", \"Manchester United Football Squad\", \"M.U.F.C.\", \"Manchester United plc\", \"Newton Heath L&YR FC\", \"ManU\", \"ManUtd\", \"Man Yoo\", \"Man U\", \"Man utd\", \"MUFC\", \"Man United\", \"Machester United\"]", "[\"Trinacrian\", \"Jewel of the Mediterranean\", \"Sicily, Italy\", \"Sicily\", \"Sicilia\", \"Sicilly\", \"Island of Sicily\", \"Sicily (Italy)\"]", "[\"High noon\", \"High Noon (film)\", \"High Noon (1952 film)\", \"High Noon\", \"High Noon (movie)\"]", "[\"Macroalgal\", \"Marine algae\", \"Seaweeds\", \"Macroalgae\", \"Sea weed\", \"Sea Weeds\", \"Seaweed\"]", "[\"Environment of Italy\", \"Itali\\u00ebn\", \"Subdivisions of Italy\", \"Republic of Italy\", \"ItalY\", \"ISO 3166-1:IT\", \"Etymology of Italy\", \"Itali\", \"Pollution in Italy\", \"Administrative divisions of Italy\", \"Austrian Empire (Italy)\", \"Italija\", \"Italie\", \"Italia\", \"Italian Republic\", \"Second Italian Republic\", \"Italy\", \"Italio\", \"Repubblica Italiana\", \"It\\u00e0lia\", \"The Italian republic\"]", "[\"Joan Sims\"]", "[\"forty-three\", \"43\"]", "[\"Marconi Wireless Stations\", \"American Marconi Wireless Corporation\", \"Marconi Wireless\", \"Marchese Guglielmo Marconi\", \"G Marconi\", \"Guglielmo Marconi\", \"Guglielmo Marchese Marconi\", \"Marconigram\", \"G. Marconi\", \"Marchese Gugliemo Marconi\", \"Marchese Marconi Guglielmo\", \"Marconi\", \"Marchese Marconi, Guglielmo\", \"William Marconi\"]", "[\"Katharine Hamnett\", \"Katherine Hamnett\", \"KATHERINE HAMNETT\"]", "[\"Water pig\", \"Chig\\u00fciro\", \"Capybara\", \"Capivara\", \"Capy\", \"Capybera\", \"Hydrochaeris\", \"Carpincho\", \"Water Hog\", \"Capibara\", \"Chigueiro\", \"Hydrochaeris hydrochaeris\", \"Hydrochoerus capybara\", \"Capybura\", \"Capabarra\", \"Cappabara\", \"Chiguiro\", \"The Largest Rodent in the world\", \"Capybaras\", \"Hydrochaerus hydrochaeris\", \"CAPYBARA\", \"Hydrochaeridae\", \"Hydrochoerus hydrochaeris\", \"Capabara\", \"Capyberra\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"A\", \"\\uff21\", \"A (letter)\", \"\\ud83c\\udd30\", \"\\ud83c\\udd10\", \"U+0043\", \"\\ud83c\\udd50\", \"LetterA\", \"\\u249c\", \"The Letter A\"]", "[\"Fortinbras of Norway\", \"Fortinbras\"]", "[\"Charlie Hustle\", \"Peter E. Rose\", \"Pete Rose: An American Dilemma\", \"Charlie hustle\", \"4,256\", \"Peter Edward Rose\", \"Rose, Pete\", \"Pete Rose\", \"4256\"]", "[\"Peter Benedict\", \"Edith Pargeter\", \"Ellis Peters\", \"John Redfern\", \"Jolyon Carr\"]", "[\"Geoge orwell\", \"Arthur Blair\", \"GEORGE ORWELL\", \"Eric A. Blair\", \"George Orwell\", \"Eric Arthur Blair\", \"Eric Blair\", \"George (Eric Blair) Orwell\", \"G. Orwell\", \"P. S. Burton\", \"George orwell\", \"E.A. Blair\", \"Orwell, George\", \"Orwell Day\"]", "[\"Manchester Utd.\", \"Manchester United\", \"Donald Love\", \"Manchester U\", \"Manchester Red Devils\", \"Man UTD\", \"Manchester unted\", \"Manc united\", \"Manchester Utd FC\", \"Manchester United Football Club\", \"Manchester United F.C.\", \"Manchester united\", \"Kieran O'Hara\", \"F.c. man utd\", \"Manchester United F. C.\", \"Manchester United FC\", \"Manchester+United\", \"Man. United\", \"Man. u\", \"Newton Heath L&YR F.C.\", \"Manchester united squad\", \"Manchester United F C\", \"Manchester Utd\", \"Manutd\", \"Man u\", \"Manchester United F.C\", \"Newton Heath F.C.\", \"Manchester united F.C.\", \"ManYoo\", \"Man Utd\", \"Fc man utd\", \"Mufc\", \"Newton Heath LYR F.C.\", \"Man-U\", \"Manchester United Football Squad\", \"M.U.F.C.\", \"Manchester United plc\", \"Newton Heath L&YR FC\", \"ManU\", \"ManUtd\", \"Man Yoo\", \"Man U\", \"Man utd\", \"MUFC\", \"Man United\", \"Machester United\"]", "[\"Trinacrian\", \"Jewel of the Mediterranean\", \"Sicily, Italy\", \"Sicily\", \"Sicilia\", \"Sicilly\", \"Island of Sicily\", \"Sicily (Italy)\"]", "[\"High noon\", \"High Noon (film)\", \"High Noon (1952 film)\", \"High Noon\", \"High Noon (movie)\"]", "[\"Macroalgal\", \"Marine algae\", \"Seaweeds\", \"Macroalgae\", \"Sea weed\", \"Sea Weeds\", \"Seaweed\"]", "[\"Environment of Italy\", \"Itali\\u00ebn\", \"Subdivisions of Italy\", \"Republic of Italy\", \"ItalY\", \"ISO 3166-1:IT\", \"Etymology of Italy\", \"Itali\", \"Pollution in Italy\", \"Administrative divisions of Italy\", \"Austrian Empire (Italy)\", \"Italija\", \"Italie\", \"Italia\", \"Italian Republic\", \"Second Italian Republic\", \"Italy\", \"Italio\", \"Repubblica Italiana\", \"It\\u00e0lia\", \"The Italian republic\"]", "[\"Joan Sims\"]", "[\"forty-three\", \"43\"]", "[\"Marconi Wireless Stations\", \"American Marconi Wireless Corporation\", \"Marconi Wireless\", \"Marchese Guglielmo Marconi\", \"G Marconi\", \"Guglielmo Marconi\", \"Guglielmo Marchese Marconi\", \"Marconigram\", \"G. Marconi\", \"Marchese Gugliemo Marconi\", \"Marchese Marconi Guglielmo\", \"Marconi\", \"Marchese Marconi, Guglielmo\", \"William Marconi\"]", "[\"Katharine Hamnett\", \"Katherine Hamnett\", \"KATHERINE HAMNETT\"]", "[\"Water pig\", \"Chig\\u00fciro\", \"Capybara\", \"Capivara\", \"Capy\", \"Capybera\", \"Hydrochaeris\", \"Carpincho\", \"Water Hog\", \"Capibara\", \"Chigueiro\", \"Hydrochaeris hydrochaeris\", \"Hydrochoerus capybara\", \"Capybura\", \"Capabarra\", \"Cappabara\", \"Chiguiro\", \"The Largest Rodent in the world\", \"Capybaras\", \"Hydrochaerus hydrochaeris\", \"CAPYBARA\", \"Hydrochaeridae\", \"Hydrochoerus hydrochaeris\", \"Capabara\", \"Capyberra\"]" ]
[ "What letter is The Scarlet Letter in Nathaniel Hawthorne's novel of the same name?", "Which Norwegian prince delivers the closing lines of Hamlet?", "Who was banned from baseball in 1989?", "Who wrote the 'Cadfael' series of novels?", "Eric Arthur Blair was the real name of which famous novelist?", "Which English football club won the 1994 FA Cup?", "\"On what island did the term \"\"Mafia\"\" originate?\"", "In which famous film was Frank Miller coming to kill Will Kane?", "What type of food is Nori, which is often seen around sushi?", "Who won the FIFA World Cup for Association Football in Germany in 2006?", "Who played Aunt Renee in The Frogs Legacy?", "Britain's second-longest-running TV serial has been running, as at the end of 2015, for how many years?", "Who shared the 1909 Nobel Prize in Physics with German inventor Karl Ferdinand Braun in recognition of their contribution to the development of wireless telegraphy?", "Which fashion designer was responsible for the trend of slogan-bearing T-shirts in the 1980's?", "Which is the wold's largest rodent?" ]
15
[ 93765, 93766, 93767, 93768, 93769, 93770, 93771, 93772, 93773, 93774, 93775, 93776, 93777, 93778, 93779 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: \"Whose theme song was \"\"Thanks For The Memory\"\"?\"\nQuestion 2: A pastel version of what artwork sold at a New York auction for a record $120m?\nQuestion 3: What is the generic title of a series of French comic strips that follows the exploits of a village of ancient Gauls as they resist Roman occupation by means of a magic potion brewed by their druid, which gives them superhuman strength?\nQuestion 4: What cereal mascot’s motto is “They’re grrrreat!”?\nQuestion 5: Tonsure refers to removal of hair from the?\nQuestion 6: What was the nickname for a 1913 British Act of Parliament that enabled suffragettes on hunger strike to be released from prison when they became ill?\nQuestion 7: Which fashion designer was sacked by Dior in 2011 after being found guilty of making anti-Semitic comments?\nQuestion 8: What Neptunes producer and N*E*R*D member became a popular solo artist?\nQuestion 9: in which country is the most westerly point of mainland South America?\nQuestion 10: Who partnered George Michael in the group 'Wham'?\nQuestion 11: The deeply inaccessible lakes Vostok, Whillans, and Ellsworth are in the?\nQuestion 12: Which city was the Russian capital during the 11'th century ?\nQuestion 13: What was the previous occupation of actor Clint Eastwood?\nQuestion 14: What ancient instrument did Orpheus play to charm creatures, rivers, and Hades in the Underworld?\nQuestion 15: On a traditional Monopoly board, Marylebone, King's Cross and Liverpool Street are three of the stations, name the fourth.", "role": "user" } ]
["[\"Bob Hope\", \"William Henry Hope\", \"Bob Hope's short subjects\", \"Leslie Townes Hope\", \"Hope, Bob\", \"Bob hope\", \"Sir Bob Hope\", \"Avis Townes\", \"Packy East\"]", "[\"Skrik\", \"The Scream!\", \"Munch Scream\", \"Scream (painting)\", \"The Scream\", \"The Scream (painting)\", \"The scream\", \"Der Schrei\"]", "[\"The Mirror World Asterix exhibition\", \"Ast\\u00e9rix\", \"Asterix\", \"Asterix comics\", \"Humour in Asterix\", \"Soora Pappa\", \"Asterix Comics\", \"Asterix and Obelix\", \"The Adventures of Asterix\", \"List of Asterix products\", \"Asterix comic\", \"Asterix (comics)\", \"Ast\\u00e9rix and Ob\\u00e9lix\"]", "[\"Tigre To\\u00f1o\", \"Tony the Tiger\", \"Tony the Tiger (mascot)\", \"They\\u2019re Great!\", \"El Tigre To\\u00f1o\", \"Tony The Tiger\"]", "[\"Head\", \"Kephalikos\", \"Heads\", \"Head (anatomy)\", \"Noddles\", \"Cephalic\", \"Cephalique\", \"Kepala\"]", "[\"Prisoners (Temporary Discharge for Ill Health) Act 1913\", \"Cat and mouse act\", \"The Cat and Mouse Act\", \"Prisoner's Temporary Discharge of Ill Health Act\", \"Cat and Mouse Act\"]", "[\"John Galliano\", \"Miss Dior Cherie\", \"JOHN GALLIANO\"]", "[\"Pharrel Williams\", \"Pharrell willaims\", \"Pharrell\", \"Pharrel\", \"Pharell\", \"Skateboard P\", \"Pharel\", \"Skateboard P.\", \"Helen Lasichanh\", \"Pharrell Williams\", \"Pharell Williams\", \"Pharrell william\", \"Bapesta\", \"Sk8brd\", \"Pharel Williams\"]", "[\"Lower Peru\", \"Name of Peru\", \"Republic of Peru\", \"Etymology of Peru\", \"ISO 3166-1:PE\", \"Piruw\", \"Peruano\", \"Rep\\u00fablica del Per\\u00fa\", \"El Per\\u00fa\", \"Republic of Per\\u00fa\", \"Peruvian Republic\", \"Peru\", \"Peruvian\", \"P\\u00e9ru\", \"Piruw Ripuwlika\", \"El Peru\", \"Per\\u00fa\", \"Per\\u00f9\", \"Piruw Suyu\", \"P\\u00e9rou\", \"Peruvia\"]", "[\"The other guy from Wham!\", \"Andrew Ridgeley\", \"Andrew Ridgely\", \"The other guy from Wham\"]", "[\"Geographic south pole\", \"Ceremonial South Pole\", \"Terrestrial South Pole\", \"The South Pole\", \"90 degrees south\", \"90th parallel south\", \"South Terrestrial Pole\", \"South Pole\", \"Southpole\", \"Latitude 90 degrees S\", \"Geographic South Pole\", \"South pole\"]", "[\"KIEV\", \"KIEV (disambiguation)\"]", "[\"SWIMMING INSTRUCTOR\"]", "[\"Lyres\", \"Lyrate\", \"Lyre\", \"Liar (instrument)\"]", "[\"Fenchurch Street (street)\", \"Fenchurch Street\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Bob Hope\", \"William Henry Hope\", \"Bob Hope's short subjects\", \"Leslie Townes Hope\", \"Hope, Bob\", \"Bob hope\", \"Sir Bob Hope\", \"Avis Townes\", \"Packy East\"]", "[\"Skrik\", \"The Scream!\", \"Munch Scream\", \"Scream (painting)\", \"The Scream\", \"The Scream (painting)\", \"The scream\", \"Der Schrei\"]", "[\"The Mirror World Asterix exhibition\", \"Ast\\u00e9rix\", \"Asterix\", \"Asterix comics\", \"Humour in Asterix\", \"Soora Pappa\", \"Asterix Comics\", \"Asterix and Obelix\", \"The Adventures of Asterix\", \"List of Asterix products\", \"Asterix comic\", \"Asterix (comics)\", \"Ast\\u00e9rix and Ob\\u00e9lix\"]", "[\"Tigre To\\u00f1o\", \"Tony the Tiger\", \"Tony the Tiger (mascot)\", \"They\\u2019re Great!\", \"El Tigre To\\u00f1o\", \"Tony The Tiger\"]", "[\"Head\", \"Kephalikos\", \"Heads\", \"Head (anatomy)\", \"Noddles\", \"Cephalic\", \"Cephalique\", \"Kepala\"]", "[\"Prisoners (Temporary Discharge for Ill Health) Act 1913\", \"Cat and mouse act\", \"The Cat and Mouse Act\", \"Prisoner's Temporary Discharge of Ill Health Act\", \"Cat and Mouse Act\"]", "[\"John Galliano\", \"Miss Dior Cherie\", \"JOHN GALLIANO\"]", "[\"Pharrel Williams\", \"Pharrell willaims\", \"Pharrell\", \"Pharrel\", \"Pharell\", \"Skateboard P\", \"Pharel\", \"Skateboard P.\", \"Helen Lasichanh\", \"Pharrell Williams\", \"Pharell Williams\", \"Pharrell william\", \"Bapesta\", \"Sk8brd\", \"Pharel Williams\"]", "[\"Lower Peru\", \"Name of Peru\", \"Republic of Peru\", \"Etymology of Peru\", \"ISO 3166-1:PE\", \"Piruw\", \"Peruano\", \"Rep\\u00fablica del Per\\u00fa\", \"El Per\\u00fa\", \"Republic of Per\\u00fa\", \"Peruvian Republic\", \"Peru\", \"Peruvian\", \"P\\u00e9ru\", \"Piruw Ripuwlika\", \"El Peru\", \"Per\\u00fa\", \"Per\\u00f9\", \"Piruw Suyu\", \"P\\u00e9rou\", \"Peruvia\"]", "[\"The other guy from Wham!\", \"Andrew Ridgeley\", \"Andrew Ridgely\", \"The other guy from Wham\"]", "[\"Geographic south pole\", \"Ceremonial South Pole\", \"Terrestrial South Pole\", \"The South Pole\", \"90 degrees south\", \"90th parallel south\", \"South Terrestrial Pole\", \"South Pole\", \"Southpole\", \"Latitude 90 degrees S\", \"Geographic South Pole\", \"South pole\"]", "[\"KIEV\", \"KIEV (disambiguation)\"]", "[\"SWIMMING INSTRUCTOR\"]", "[\"Lyres\", \"Lyrate\", \"Lyre\", \"Liar (instrument)\"]", "[\"Fenchurch Street (street)\", \"Fenchurch Street\"]" ]
[ "\"Whose theme song was \"\"Thanks For The Memory\"\"?\"", "A pastel version of what artwork sold at a New York auction for a record $120m?", "What is the generic title of a series of French comic strips that follows the exploits of a village of ancient Gauls as they resist Roman occupation by means of a magic potion brewed by their druid, which gives them superhuman strength?", "What cereal mascot’s motto is “They’re grrrreat!”?", "Tonsure refers to removal of hair from the?", "What was the nickname for a 1913 British Act of Parliament that enabled suffragettes on hunger strike to be released from prison when they became ill?", "Which fashion designer was sacked by Dior in 2011 after being found guilty of making anti-Semitic comments?", "What Neptunes producer and N*E*R*D member became a popular solo artist?", "in which country is the most westerly point of mainland South America?", "Who partnered George Michael in the group 'Wham'?", "The deeply inaccessible lakes Vostok, Whillans, and Ellsworth are in the?", "Which city was the Russian capital during the 11'th century ?", "What was the previous occupation of actor Clint Eastwood?", "What ancient instrument did Orpheus play to charm creatures, rivers, and Hades in the Underworld?", "On a traditional Monopoly board, Marylebone, King's Cross and Liverpool Street are three of the stations, name the fourth." ]
15
[ 78315, 78316, 78317, 78318, 78319, 78320, 78321, 78322, 78323, 78324, 78325, 78326, 78327, 78328, 78329 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: What city's mayor, Rob Ford, admitted to smoking crack while in a drunken stupor?\nQuestion 2: The Earl of Warwick, known as the 'kingmaker' was killed at which battle in 1471?\nQuestion 3: Who, in June 1963, became the first woman to go into space?\nQuestion 4: Who was US Secretary of State during the 'war' against Afghanistan?\nQuestion 5: The HP-35, launched in 1972, was Hewlett-Packard’s first what?\nQuestion 6: \"\"\"Written by office boys, for office boys\"\" was the dismissive verdict of Lord Salisbury on which national newspaper, at the time of its foundation in 1896?\"\nQuestion 7: \"Name the popular 1970s Kenner Products' 15\"\" toy body-builder figure of latex rubber filled with corn syrup, elastic to c.five feet?\"\nQuestion 8: Who published a regular newspaper column from 1936 onwards?\nQuestion 9: A mouflon is a Coriscan wild species of what domesticated creature?\nQuestion 10: The city of Kolkata lies on which river?\nQuestion 11: English sportswoman Laura Davies is associated with which sport?\nQuestion 12: Which fictional family lived at 1313 Mockingbird Lane, Mockingbird Heights, California?\nQuestion 13: Where did Scottish patriot William Wallace lead soldiers to a defeat of the English in 1297?\nQuestion 14: What is the capital of Bulgaria\nQuestion 15: Who won the 2009 German Formula One Grand Prix?", "role": "user" } ]
["[\"Torontonians\", \"City of Toronto, Ontario\", \"Issues in Toronto, Ontario\", \"Toronto, ON\", \"Toronto (Canada)\", \"Toronto, On\", \"The big tee oh\", \"Toronto, Ontario Part 2\", \"Torontonian\", \"Trawna\", \"Tornonto, Ont.\", \"Issues of Toronto\", \"Toronto, Ontario, Canada\", \"Torotno\", \"Toronto Municipality, Ontario\", \"Toronto Canada\", \"Torontorian\", \"Toronto Division\", \"Toronto, ontario Part 2\", \"Toronto\", \"Toronto (Ont.)\", \"The big to\", \"Tdot\", \"Toironto\", \"Toronto List of MPs and MPPs\", \"List of Toronto MPs and MPPs\", \"Toronto, Canada\", \"Highways within Greater Toronto Area\", \"Toronto, Ontario.\", \"The weather in Toronto\", \"List of City of Toronto Issues\", \"Accordion City\", \"City of Toronto\", \"Toronto, Canada.\", \"Toronto, Ont.\", \"Toronto, CA\", \"UN/LOCODE:CATOR\", \"Toronto Ontario\", \"Toronto (ON)\", \"History of crime in Toronto\", \"Toronto, Ontario\"]", "[\"Barnet (disambiguation)\", \"Barnet, United Kingdom\", \"Barn\\u00e9t\", \"Barnet\", \"Barnet Town\"]", "[\"Valentina Teresjkova\", \"Valentina Vladimirovna Nikolayeva Tereshkova\", \"Tereshkova\", \"First woman in space\", \"Tereshkova, Valentina Vladimirovna\", \"Tereshkova, Valentina\", \"First woman into space\", \"Valentina Vladimirovna Tereshkova\", \"Valentina Tereshkova\", \"Valentina V. Tereshkova\"]", "[\"Colon Powell\", \"COLIN POWELL\", \"Collin Powell\", \"Secretary powell\", \"Coat of Arms of Colin Powell\", \"Colin L. Powell\", \"General Colin Powell\", \"Colin L Powell\", \"General Powell\", \"Balloonfoot\", \"Colin Luther Powell\", \"Colin Powel\", \"EMILY J. MILLER\", \"Colin Powell\", \"Colonel Powell\"]", "[\"Math calculators\", \"Pocket calculator\", \"Bowmar Brain\", \"Pocket calculators\", \"Fraction to Decimals\", \"Online calculator\", \"Calculating device\", \"Division key\", \"Equals button\", \"Kalkulator\", \"Minus key\", \"Electronic calculating machine\", \"Electronic Calculator\", \"\\ud83d\\udda9\", \"Printing Calculator\", \"Plus key\", \"Desk calculators\", \"Automatic calculator\", \"Minus button\", \"Desk calculator\", \"Equals key\", \"Caculator\", \"Electronic calculator\", \"Multiplication key\", \"Plus button\", \"Calculators\", \"Desktop calculator\", \"Calculater\", \"Claculator\", \"Digital calculator\", \"Multiplication button\", \"Division button\", \"Calculator\", \"Handheld calculator\", \"Math calculator\"]", "[\"Daily Mail Year Book\", \"Daily Fail\", \"Dailymail\", \"The Daily Mail\", \"The Daily Mail (UK)\", \"Daily Mail UK\", \"Daily Mail and Empire\", \"Daily Mail.com\", \"Daily Mail reader\", \"Daily mail\", \"DailyMail\", \"Mail on Sunday (song)\", \"Scottish Daily Mail\", \"Daily Mail (UK)\", \"The Strip Show\", \"Daliy Mail\", \"The daily mail\", \"Daily Wail\", \"Hurrah for the Blackshirts!\", \"DAILY MAIL\", \"Daily Mail\", \"DailyMail.com\"]", "[\"Stretch Armstrong\", \"Stretch Serpent\", \"Stretch Armstrong (toy)\", \"Stretch Armstrong (film)\"]", "[\"Eleanor Roosevelt\", \"Elenor Roosevelt\", \"Eleonore Roosevelt\", \"Eleanor: The Lonely Years\", \"Eleanor roosevelt\", \"Eleonor Roosevelt\", \"Anna Eleanor Roosevelt, Sr.\", \"Anna Eleanor Roosevelt Roosevelt\", \"Anna Eleanor %22Eleanor%22 Roosevelt\", \"Anna Eleanor Roosevelt\", \"Elanor roosevelt\", \"Eleanore Roosevelt\"]", "[\"Sheep\", \"Ovis aries\", \"Domestic ram\", \"Yorkshire Leicester\", \"Persian Lamb\", \"\\ud83d\\udc0f\", \"\\ud83d\\udc11\", \"Bleat\", \"Domesticated sheep\", \"Ovine\", \"Domestic ewe\", \"Domestic sheep\", \"Sheeps\", \"Agnine\", \"Feral sheep\", \"Domestic Sheep\", \"Ovis orientalis aries\", \"Sheep sounds\", \"Sheep description\", \"Ram (sheep)\", \"Yowe\", \"Sheep, domestic\"]", "[\"HOOGHLY\", \"Hugli\", \"Hoogly\", \"Hooghly (disambiguation)\", \"Hooghly\", \"Hughli\", \"Hugly\", \"Hoogli\"]", "[\"Scramble (golf)\", \"GOLF\", \"Golf Conditioning\", \"Men's Golf\", \"\\ud83c\\udfcc\", \"Golf Tournament\", \"Golf\", \"Duffed\", \"Scotch foursomes\", \"Texas scramble\", \"Golfing\", \"Golf tournament\", \"Golf (Sport)\", \"Golf technology\", \"Golfer\", \"Golf conditioning\", \"The Development of Golf Technology\", \"Duffs\"]", "[\"The munsters\", \"The Munsters (film)\", \"The Munsters\", \"Munsters, The\", \"Munsters\"]", "[\"Stirling Bridge\", \"Battle of stirling bridge\", \"Battle of Stirling Bridge\", \"The Battle of Sterling Bridge\", \"Battle at Stirling Bridge\", \"Battle of Sterling Bridge\", \"William Wallace and the Battle of Stirling Bridge\", \"The Battle of Stirling Bridge\"]", "[\"Europe/Sofia\", \"City of Sofia\", \"Sofiya\", \"\\u0421\\u043e\\u0444\\u0456\\u044f\", \"Sofija\", \"\\u0421\\u043e\\u0444\\u0438\\u044f\", \"Capital of Bulgaria\", \"Sofia\", \"Sophia, Bulgaria\", \"Sofia City\", \"UN/LOCODE:BGSOF\", \"Sofia city\", \"Sof\\u00eda, B\\u00falgaria\", \"Sofia, Bulgaria\", \"\\u0421\\u043e\\u0444\\u0438\\u0458\\u0430\"]", "[\"Mark Webber\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Torontonians\", \"City of Toronto, Ontario\", \"Issues in Toronto, Ontario\", \"Toronto, ON\", \"Toronto (Canada)\", \"Toronto, On\", \"The big tee oh\", \"Toronto, Ontario Part 2\", \"Torontonian\", \"Trawna\", \"Tornonto, Ont.\", \"Issues of Toronto\", \"Toronto, Ontario, Canada\", \"Torotno\", \"Toronto Municipality, Ontario\", \"Toronto Canada\", \"Torontorian\", \"Toronto Division\", \"Toronto, ontario Part 2\", \"Toronto\", \"Toronto (Ont.)\", \"The big to\", \"Tdot\", \"Toironto\", \"Toronto List of MPs and MPPs\", \"List of Toronto MPs and MPPs\", \"Toronto, Canada\", \"Highways within Greater Toronto Area\", \"Toronto, Ontario.\", \"The weather in Toronto\", \"List of City of Toronto Issues\", \"Accordion City\", \"City of Toronto\", \"Toronto, Canada.\", \"Toronto, Ont.\", \"Toronto, CA\", \"UN/LOCODE:CATOR\", \"Toronto Ontario\", \"Toronto (ON)\", \"History of crime in Toronto\", \"Toronto, Ontario\"]", "[\"Barnet (disambiguation)\", \"Barnet, United Kingdom\", \"Barn\\u00e9t\", \"Barnet\", \"Barnet Town\"]", "[\"Valentina Teresjkova\", \"Valentina Vladimirovna Nikolayeva Tereshkova\", \"Tereshkova\", \"First woman in space\", \"Tereshkova, Valentina Vladimirovna\", \"Tereshkova, Valentina\", \"First woman into space\", \"Valentina Vladimirovna Tereshkova\", \"Valentina Tereshkova\", \"Valentina V. Tereshkova\"]", "[\"Colon Powell\", \"COLIN POWELL\", \"Collin Powell\", \"Secretary powell\", \"Coat of Arms of Colin Powell\", \"Colin L. Powell\", \"General Colin Powell\", \"Colin L Powell\", \"General Powell\", \"Balloonfoot\", \"Colin Luther Powell\", \"Colin Powel\", \"EMILY J. MILLER\", \"Colin Powell\", \"Colonel Powell\"]", "[\"Math calculators\", \"Pocket calculator\", \"Bowmar Brain\", \"Pocket calculators\", \"Fraction to Decimals\", \"Online calculator\", \"Calculating device\", \"Division key\", \"Equals button\", \"Kalkulator\", \"Minus key\", \"Electronic calculating machine\", \"Electronic Calculator\", \"\\ud83d\\udda9\", \"Printing Calculator\", \"Plus key\", \"Desk calculators\", \"Automatic calculator\", \"Minus button\", \"Desk calculator\", \"Equals key\", \"Caculator\", \"Electronic calculator\", \"Multiplication key\", \"Plus button\", \"Calculators\", \"Desktop calculator\", \"Calculater\", \"Claculator\", \"Digital calculator\", \"Multiplication button\", \"Division button\", \"Calculator\", \"Handheld calculator\", \"Math calculator\"]", "[\"Daily Mail Year Book\", \"Daily Fail\", \"Dailymail\", \"The Daily Mail\", \"The Daily Mail (UK)\", \"Daily Mail UK\", \"Daily Mail and Empire\", \"Daily Mail.com\", \"Daily Mail reader\", \"Daily mail\", \"DailyMail\", \"Mail on Sunday (song)\", \"Scottish Daily Mail\", \"Daily Mail (UK)\", \"The Strip Show\", \"Daliy Mail\", \"The daily mail\", \"Daily Wail\", \"Hurrah for the Blackshirts!\", \"DAILY MAIL\", \"Daily Mail\", \"DailyMail.com\"]", "[\"Stretch Armstrong\", \"Stretch Serpent\", \"Stretch Armstrong (toy)\", \"Stretch Armstrong (film)\"]", "[\"Eleanor Roosevelt\", \"Elenor Roosevelt\", \"Eleonore Roosevelt\", \"Eleanor: The Lonely Years\", \"Eleanor roosevelt\", \"Eleonor Roosevelt\", \"Anna Eleanor Roosevelt, Sr.\", \"Anna Eleanor Roosevelt Roosevelt\", \"Anna Eleanor %22Eleanor%22 Roosevelt\", \"Anna Eleanor Roosevelt\", \"Elanor roosevelt\", \"Eleanore Roosevelt\"]", "[\"Sheep\", \"Ovis aries\", \"Domestic ram\", \"Yorkshire Leicester\", \"Persian Lamb\", \"\\ud83d\\udc0f\", \"\\ud83d\\udc11\", \"Bleat\", \"Domesticated sheep\", \"Ovine\", \"Domestic ewe\", \"Domestic sheep\", \"Sheeps\", \"Agnine\", \"Feral sheep\", \"Domestic Sheep\", \"Ovis orientalis aries\", \"Sheep sounds\", \"Sheep description\", \"Ram (sheep)\", \"Yowe\", \"Sheep, domestic\"]", "[\"HOOGHLY\", \"Hugli\", \"Hoogly\", \"Hooghly (disambiguation)\", \"Hooghly\", \"Hughli\", \"Hugly\", \"Hoogli\"]", "[\"Scramble (golf)\", \"GOLF\", \"Golf Conditioning\", \"Men's Golf\", \"\\ud83c\\udfcc\", \"Golf Tournament\", \"Golf\", \"Duffed\", \"Scotch foursomes\", \"Texas scramble\", \"Golfing\", \"Golf tournament\", \"Golf (Sport)\", \"Golf technology\", \"Golfer\", \"Golf conditioning\", \"The Development of Golf Technology\", \"Duffs\"]", "[\"The munsters\", \"The Munsters (film)\", \"The Munsters\", \"Munsters, The\", \"Munsters\"]", "[\"Stirling Bridge\", \"Battle of stirling bridge\", \"Battle of Stirling Bridge\", \"The Battle of Sterling Bridge\", \"Battle at Stirling Bridge\", \"Battle of Sterling Bridge\", \"William Wallace and the Battle of Stirling Bridge\", \"The Battle of Stirling Bridge\"]", "[\"Europe/Sofia\", \"City of Sofia\", \"Sofiya\", \"\\u0421\\u043e\\u0444\\u0456\\u044f\", \"Sofija\", \"\\u0421\\u043e\\u0444\\u0438\\u044f\", \"Capital of Bulgaria\", \"Sofia\", \"Sophia, Bulgaria\", \"Sofia City\", \"UN/LOCODE:BGSOF\", \"Sofia city\", \"Sof\\u00eda, B\\u00falgaria\", \"Sofia, Bulgaria\", \"\\u0421\\u043e\\u0444\\u0438\\u0458\\u0430\"]", "[\"Mark Webber\"]" ]
[ "What city's mayor, Rob Ford, admitted to smoking crack while in a drunken stupor?", "The Earl of Warwick, known as the 'kingmaker' was killed at which battle in 1471?", "Who, in June 1963, became the first woman to go into space?", "Who was US Secretary of State during the 'war' against Afghanistan?", "The HP-35, launched in 1972, was Hewlett-Packard’s first what?", "\"\"\"Written by office boys, for office boys\"\" was the dismissive verdict of Lord Salisbury on which national newspaper, at the time of its foundation in 1896?\"", "\"Name the popular 1970s Kenner Products' 15\"\" toy body-builder figure of latex rubber filled with corn syrup, elastic to c.five feet?\"", "Who published a regular newspaper column from 1936 onwards?", "A mouflon is a Coriscan wild species of what domesticated creature?", "The city of Kolkata lies on which river?", "English sportswoman Laura Davies is associated with which sport?", "Which fictional family lived at 1313 Mockingbird Lane, Mockingbird Heights, California?", "Where did Scottish patriot William Wallace lead soldiers to a defeat of the English in 1297?", "What is the capital of Bulgaria", "Who won the 2009 German Formula One Grand Prix?" ]
15
[ 123450, 123451, 123452, 123453, 123454, 123455, 123456, 123457, 123458, 123459, 123460, 123461, 123462, 123463, 123464 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Otology is the study of which part of the body?\nQuestion 2: Which famous Greek wine is flavoured with pine resin?\nQuestion 3: GBJ is the international vehicle registration for where?\nQuestion 4: The scientific principle which explains that in fluid flow an increase in velocity is associated with a decrease in pressure is named after which family of mathematicians and physicists?\nQuestion 5: Which English king founded Eton College in 1440?\nQuestion 6: What colour does red litmus paper turn when in contact with alkaline?\nQuestion 7: Who wrote the much filmed novel The Invisible Man\nQuestion 8: The Jordanian capital Amman formerly had the same name as which American city?\nQuestion 9: During World War I, which Belgian city that was the centre of intense battles was nicknamed 'wipers'?\nQuestion 10: How is Joan Molinsky better known?\nQuestion 11: Which actor has played the policeman Nick Rowan in the UK TV retro soap ‘Heartbeat'?\nQuestion 12: Acetylsalicylic acid (ASA), first identified in willow bark by Hippocrates c.400BC, is better known as what a genericized trademark?\nQuestion 13: On October 1st of which year did Ford put its first Model T on sale ? Was it 1898, 1908 or 1918 ?\nQuestion 14: Jos Santos Zelaya, William Walker, Adolfo Daz, Emiliano Chamorro, Juan Bautista Sacasa, Anastasio Somoza Garca, Luis Somoza, Violeta Chamorro, Enrique Bolaos and Daniel Ortega are associated with the politics of which country?\nQuestion 15: \"Which comic strip created by Rudolph Dirks that first appeared in 1897 in the \"\"American Humorist\"\", the Sunday supplement of the New York Journal, is still distributed, making it the oldest comic strip still in syndication?\"", "role": "user" } ]
["[\"\\ud83d\\udc42\", \"Ear diseases\", \"Ear\", \"Human ear\", \"Ear (vertebrate)\", \"Ears\"]", "[\"Retsina\", \"RETSINA\"]", "[\"Bailliage d\\u00e9 J\\u00e8rri\", \"Jersey bibliography\", \"Isle of Jersey\", \"Jersey\", \"Jersey, Channel Islands\", \"Channel Islands/Jersey\", \"J\\u00e8rri\", \"GBJ\", \"Jersey/Military\", \"Jersey Film Festival\", \"Bailiwick of Jersey\", \"Channel Islands (Jersey)\", \"Old Jersey\", \"ISO 3166-1:JE\", \"Jerzenez\", \"Bailliage de Jersey\", \"Europe/Jersey\", \"Island of Jersey\", \"Angia\"]", "[\"Bernoulli\", \"Bernuli\", \"Bernouilli\", \"Bernoulli (disambiguation)\"]", "[\"Hendrik VI\", \"Heindrik VI\", \"Henry vi\", \"Henry the Sixth\", \"Henry 6\", \"Henry VI (disambiguation)\", \"Henry VI\"]", "[\"Blue\", \"Rgb(0, 0, 255)\", \"Orphan blue\", \"Slate Blue (color)\", \"Bluishness\", \"Dark Blue (color)\", \"Pale Blue\", \"Blue in human culture\", \"Blue (color)\", \"Police car blue\", \"Blue (Colour)\", \"Blueishness\", \"List of terms associated with the color blue\", \"Caspian blue\", \"Blue (colour)\", \"Light-blue\", \"Bluest\", \"Bluish\", \"Bluishly\", \"(0, 0, 255)\", \"Blueishly\", \"Bluer\", \"Blae\", \"Blueness\"]", "[\"Septimus Browne\", \"Herbert G. Wells\", \"Sosthenes Smith\", \"Reginald Bliss\", \"H.G. Wells\", \"H G Wells\", \"Wells, Herbert George, B.Sc., Etc.\", \"Herbet wells\", \"Wells, Herbert George\", \"H. G. (Herbert George) Wells\", \"H. G. Wells\", \"Herbert George Wells\", \"H.G.Wells\", \"H.G Wells\", \"H. G. Wheels\", \"HG Wells\", \"Hg wells\", \"H.g. wells\", \"H. G. Welles\", \"Walker Glockenhammer\", \"Charles Wells (fictional)\"]", "[\"Philedelphia\", \"City of brotherly love\", \"City of Brotherly Love\", \"The Quaker City\", \"Philadelphia\", \"Philadelphia, Pennsylvania\", \"Philadelphia, Pennsylvania, U.S.A.\", \"Philadelphia, Pa.\", \"List of nicknames for Philadelphia\", \"Philidalphia\", \"Philadelphia, United States\", \"Philadelphia, Pennsylvania, U.S.\", \"Philadelphia PA\", \"Philadelphia Suburban Rail\", \"Philadelphi\", \"Philadelphia, U.S.\", \"Philadelphia Regional Rail\", \"The City of Brotherly Love\", \"City of Philadelphia\", \"Philadelphia (Pennsylvania)\", \"Wiccacoa\", \"Philadelpia, Pennsylvania\", \"Philadelphia, USA\", \"Philadelphia, Philadelphia County, Pennsylvania\", \"Government of Philadelphia\", \"Philadelphia (PA)\", \"Philadelphia, Pennsylvania, USA\", \"Philadelphia (City)\", \"UN/LOCODE:USPHL\", \"The City That Loves You Back\", \"Philadelphia (Pa.)\", \"Phila.\", \"The Cradle of Liberty\", \"The city of brotherly love\", \"Philadelphia (city, Pennsylvania)\", \"Philidelphia\", \"Philadelphia, Pennsylvania, US\", \"Philadelphia Commuter Rail\", \"The City and County of Philadelphia, Pennsylvania\", \"Philadephia, Pennsylvania\", \"Philadelphia City\", \"Philadelphia Pennsylvania\", \"Philadelphia City Controller\", \"Philladelphia\", \"Political families of Philadelphia\", \"Philadelphia, Pa\", \"Philadelphia, PA\", \"The Birthplace of America\", \"Philadelpia, PA\"]", "[\"Brielen\", \"Wieltje\", \"Ieper\", \"Ypern\", \"Ypres, Belgium\", \"Zuidschote\", \"Voormezele\", \"Dikkebus\", \"Ypres\", \"Leper, Belgium\", \"Ieper, Belgium\", \"Vlamertinge\", \"Iper\", \"Ypers\", \"Sint-Jan\"]", "[\"Queen of Comedy\", \"Heidi Abromowitz\", \"Joan Rivers (TV) Show\", \"Joan Alexandra Molinsky\", \"Diary of a Mad Diva\", \"Joan rivers\", \"Heidi abromowitz\", \"Joan River\", \"Joan Rivers Show\", \"Joan Rivers\"]", "[\"Nick Berry\"]", "[\"Idragin\", \"Aspalon\", \"Baby aspirin\", \"Acetisal\", \"Aspirin\", \"Dolopirin\", \"Aspirine\", \"Junior aspirin\", \"Salacetin\", \"Acylpyrin\", \"8-Hour Bayer\", \"Rheumintabletten\", \"ATCvet code QB01AC06\", \"Acetylsalicylic Acid\", \"Contrheuma retard\", \"Saletin\", \"Endydol\", \"Asparin\", \"Extren\", \"Premaspin\", \"ZORprin\", \"Aspirdrops\", \"Bi-prin\", \"Novid\", \"Caprin\", \"Enterophen\", \"Dolean pH 8\", \"Magnyl\", \"Enterosarein\", \"Acetyl salicylic acid\", \"A.S.A. Empirin\", \"Solfrin\", \"Aceticyl\", \"Ecolen\", \"Rhodine\", \"Nu-seals\", \"Cemirit\", \"Yasta\", \"Entericin\", \"Salcetogen\", \"ATC code B01AC06\", \"Aspec\", \"Acetosal\", \"Asp\\u00e9gic\", \"Claradin\", \"Spira-Dine\", \"Genacote\", \"Triple-sal\", \"Acetonyl\", \"81mg\", \"Kardegic\", \"Colfarit\", \"2-Ethanoylbenzenecarboxylic acid\", \"Measurin\", \"Solprin\", \"Ecotrin\", \"Entrophen\", \"Temperal\", \"Acetylsalicyclic acid\", \"Bialpirina\", \"Rhonal\", \"Low dose aspirin\", \"Polopiryna\", \"Acetylsalicylic\", \"Fasprin\", \"8-hour Bayer\", \"Asteric\", \"Myoprin\", \"Asagran\", \"2-acetyloxybenzoic acid\", \"Acimetten\", \"Persistin\", \"Micristin\", \"Acisal\", \"Tasprin\", \"ATCvet code QN02BA01\", \"Nu-seals aspirin\", \"Bialpirinia\", \"Solprin acid\", \"Asatard\", \"Neuronika\", \"Levius\", \"Easprin\", \"ATCvet code QA01AD05\", \"Acetophen\", \"Solpyron\", \"Delgesic\", \"Ascoden-30\", \"ATC code A01AD05\", \"Acetosalin\", \"Bufferin\", \"Monoacetic acid ester of salicylic acid\", \"Acesal\", \"Adiro\", \"Aspirin allergy\", \"Benaspir\", \"Enterosarine\", \"Triaminicin\", \"Globentyl\", \"Halfprin\", \"Supac\", \"Sedergine\", \"Trombyl\", \"Empirin\", \"Calcium acetylsalicylate\", \"Acetylosalicylic acid\", \"Acetylsal\", \"Acetylsalicylic acid\", \"Acetylin\", \"Pirseal\", \"Acetylsalicylate\", \"Pharmacin\", \"ATC code N02BA01\", \"Acetyl salicilic acid\", \"Decaten\", \"Acenterine\", \"Clariprin\", \"Aspirin synthesis\"]", "[\"one thousand, nine hundred and eight\", \"1908\"]", "[\"Nicarugua\", \"Nicuragua\", \"Administrative divisions of Nicaragua\", \"Bibliography of nicaragua\", \"Subdivisions of Nicaragua\", \"Health in Nicaragua\", \"Republica De Nicaragua\", \"Etymology of Nicaragua\", \"Rep\\u00fablica de Nicaragua\", \"Sport in Nicaragua\", \"ISO 3166-1:NI\", \"Republic of Nicaragua\", \"The Republic of Nicaragua\", \"Nicaraguan\", \"Nicaragua\", \"Nicaragua, Central America\"]", "[\"The Captain & The Kids\", \"Captain and the Kids\", \"Hans und Fritz\", \"Katzenjammer Kids\", \"The Captain and the Kids\", \"Katzenjammers\", \"Hans and Fritz\", \"The Katzenjammer Kids\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"\\ud83d\\udc42\", \"Ear diseases\", \"Ear\", \"Human ear\", \"Ear (vertebrate)\", \"Ears\"]", "[\"Retsina\", \"RETSINA\"]", "[\"Bailliage d\\u00e9 J\\u00e8rri\", \"Jersey bibliography\", \"Isle of Jersey\", \"Jersey\", \"Jersey, Channel Islands\", \"Channel Islands/Jersey\", \"J\\u00e8rri\", \"GBJ\", \"Jersey/Military\", \"Jersey Film Festival\", \"Bailiwick of Jersey\", \"Channel Islands (Jersey)\", \"Old Jersey\", \"ISO 3166-1:JE\", \"Jerzenez\", \"Bailliage de Jersey\", \"Europe/Jersey\", \"Island of Jersey\", \"Angia\"]", "[\"Bernoulli\", \"Bernuli\", \"Bernouilli\", \"Bernoulli (disambiguation)\"]", "[\"Hendrik VI\", \"Heindrik VI\", \"Henry vi\", \"Henry the Sixth\", \"Henry 6\", \"Henry VI (disambiguation)\", \"Henry VI\"]", "[\"Blue\", \"Rgb(0, 0, 255)\", \"Orphan blue\", \"Slate Blue (color)\", \"Bluishness\", \"Dark Blue (color)\", \"Pale Blue\", \"Blue in human culture\", \"Blue (color)\", \"Police car blue\", \"Blue (Colour)\", \"Blueishness\", \"List of terms associated with the color blue\", \"Caspian blue\", \"Blue (colour)\", \"Light-blue\", \"Bluest\", \"Bluish\", \"Bluishly\", \"(0, 0, 255)\", \"Blueishly\", \"Bluer\", \"Blae\", \"Blueness\"]", "[\"Septimus Browne\", \"Herbert G. Wells\", \"Sosthenes Smith\", \"Reginald Bliss\", \"H.G. Wells\", \"H G Wells\", \"Wells, Herbert George, B.Sc., Etc.\", \"Herbet wells\", \"Wells, Herbert George\", \"H. G. (Herbert George) Wells\", \"H. G. Wells\", \"Herbert George Wells\", \"H.G.Wells\", \"H.G Wells\", \"H. G. Wheels\", \"HG Wells\", \"Hg wells\", \"H.g. wells\", \"H. G. Welles\", \"Walker Glockenhammer\", \"Charles Wells (fictional)\"]", "[\"Philedelphia\", \"City of brotherly love\", \"City of Brotherly Love\", \"The Quaker City\", \"Philadelphia\", \"Philadelphia, Pennsylvania\", \"Philadelphia, Pennsylvania, U.S.A.\", \"Philadelphia, Pa.\", \"List of nicknames for Philadelphia\", \"Philidalphia\", \"Philadelphia, United States\", \"Philadelphia, Pennsylvania, U.S.\", \"Philadelphia PA\", \"Philadelphia Suburban Rail\", \"Philadelphi\", \"Philadelphia, U.S.\", \"Philadelphia Regional Rail\", \"The City of Brotherly Love\", \"City of Philadelphia\", \"Philadelphia (Pennsylvania)\", \"Wiccacoa\", \"Philadelpia, Pennsylvania\", \"Philadelphia, USA\", \"Philadelphia, Philadelphia County, Pennsylvania\", \"Government of Philadelphia\", \"Philadelphia (PA)\", \"Philadelphia, Pennsylvania, USA\", \"Philadelphia (City)\", \"UN/LOCODE:USPHL\", \"The City That Loves You Back\", \"Philadelphia (Pa.)\", \"Phila.\", \"The Cradle of Liberty\", \"The city of brotherly love\", \"Philadelphia (city, Pennsylvania)\", \"Philidelphia\", \"Philadelphia, Pennsylvania, US\", \"Philadelphia Commuter Rail\", \"The City and County of Philadelphia, Pennsylvania\", \"Philadephia, Pennsylvania\", \"Philadelphia City\", \"Philadelphia Pennsylvania\", \"Philadelphia City Controller\", \"Philladelphia\", \"Political families of Philadelphia\", \"Philadelphia, Pa\", \"Philadelphia, PA\", \"The Birthplace of America\", \"Philadelpia, PA\"]", "[\"Brielen\", \"Wieltje\", \"Ieper\", \"Ypern\", \"Ypres, Belgium\", \"Zuidschote\", \"Voormezele\", \"Dikkebus\", \"Ypres\", \"Leper, Belgium\", \"Ieper, Belgium\", \"Vlamertinge\", \"Iper\", \"Ypers\", \"Sint-Jan\"]", "[\"Queen of Comedy\", \"Heidi Abromowitz\", \"Joan Rivers (TV) Show\", \"Joan Alexandra Molinsky\", \"Diary of a Mad Diva\", \"Joan rivers\", \"Heidi abromowitz\", \"Joan River\", \"Joan Rivers Show\", \"Joan Rivers\"]", "[\"Nick Berry\"]", "[\"Idragin\", \"Aspalon\", \"Baby aspirin\", \"Acetisal\", \"Aspirin\", \"Dolopirin\", \"Aspirine\", \"Junior aspirin\", \"Salacetin\", \"Acylpyrin\", \"8-Hour Bayer\", \"Rheumintabletten\", \"ATCvet code QB01AC06\", \"Acetylsalicylic Acid\", \"Contrheuma retard\", \"Saletin\", \"Endydol\", \"Asparin\", \"Extren\", \"Premaspin\", \"ZORprin\", \"Aspirdrops\", \"Bi-prin\", \"Novid\", \"Caprin\", \"Enterophen\", \"Dolean pH 8\", \"Magnyl\", \"Enterosarein\", \"Acetyl salicylic acid\", \"A.S.A. Empirin\", \"Solfrin\", \"Aceticyl\", \"Ecolen\", \"Rhodine\", \"Nu-seals\", \"Cemirit\", \"Yasta\", \"Entericin\", \"Salcetogen\", \"ATC code B01AC06\", \"Aspec\", \"Acetosal\", \"Asp\\u00e9gic\", \"Claradin\", \"Spira-Dine\", \"Genacote\", \"Triple-sal\", \"Acetonyl\", \"81mg\", \"Kardegic\", \"Colfarit\", \"2-Ethanoylbenzenecarboxylic acid\", \"Measurin\", \"Solprin\", \"Ecotrin\", \"Entrophen\", \"Temperal\", \"Acetylsalicyclic acid\", \"Bialpirina\", \"Rhonal\", \"Low dose aspirin\", \"Polopiryna\", \"Acetylsalicylic\", \"Fasprin\", \"8-hour Bayer\", \"Asteric\", \"Myoprin\", \"Asagran\", \"2-acetyloxybenzoic acid\", \"Acimetten\", \"Persistin\", \"Micristin\", \"Acisal\", \"Tasprin\", \"ATCvet code QN02BA01\", \"Nu-seals aspirin\", \"Bialpirinia\", \"Solprin acid\", \"Asatard\", \"Neuronika\", \"Levius\", \"Easprin\", \"ATCvet code QA01AD05\", \"Acetophen\", \"Solpyron\", \"Delgesic\", \"Ascoden-30\", \"ATC code A01AD05\", \"Acetosalin\", \"Bufferin\", \"Monoacetic acid ester of salicylic acid\", \"Acesal\", \"Adiro\", \"Aspirin allergy\", \"Benaspir\", \"Enterosarine\", \"Triaminicin\", \"Globentyl\", \"Halfprin\", \"Supac\", \"Sedergine\", \"Trombyl\", \"Empirin\", \"Calcium acetylsalicylate\", \"Acetylosalicylic acid\", \"Acetylsal\", \"Acetylsalicylic acid\", \"Acetylin\", \"Pirseal\", \"Acetylsalicylate\", \"Pharmacin\", \"ATC code N02BA01\", \"Acetyl salicilic acid\", \"Decaten\", \"Acenterine\", \"Clariprin\", \"Aspirin synthesis\"]", "[\"one thousand, nine hundred and eight\", \"1908\"]", "[\"Nicarugua\", \"Nicuragua\", \"Administrative divisions of Nicaragua\", \"Bibliography of nicaragua\", \"Subdivisions of Nicaragua\", \"Health in Nicaragua\", \"Republica De Nicaragua\", \"Etymology of Nicaragua\", \"Rep\\u00fablica de Nicaragua\", \"Sport in Nicaragua\", \"ISO 3166-1:NI\", \"Republic of Nicaragua\", \"The Republic of Nicaragua\", \"Nicaraguan\", \"Nicaragua\", \"Nicaragua, Central America\"]", "[\"The Captain & The Kids\", \"Captain and the Kids\", \"Hans und Fritz\", \"Katzenjammer Kids\", \"The Captain and the Kids\", \"Katzenjammers\", \"Hans and Fritz\", \"The Katzenjammer Kids\"]" ]
[ "Otology is the study of which part of the body?", "Which famous Greek wine is flavoured with pine resin?", "GBJ is the international vehicle registration for where?", "The scientific principle which explains that in fluid flow an increase in velocity is associated with a decrease in pressure is named after which family of mathematicians and physicists?", "Which English king founded Eton College in 1440?", "What colour does red litmus paper turn when in contact with alkaline?", "Who wrote the much filmed novel The Invisible Man", "The Jordanian capital Amman formerly had the same name as which American city?", "During World War I, which Belgian city that was the centre of intense battles was nicknamed 'wipers'?", "How is Joan Molinsky better known?", "Which actor has played the policeman Nick Rowan in the UK TV retro soap ‘Heartbeat'?", "Acetylsalicylic acid (ASA), first identified in willow bark by Hippocrates c.400BC, is better known as what a genericized trademark?", "On October 1st of which year did Ford put its first Model T on sale ? Was it 1898, 1908 or 1918 ?", "Jos Santos Zelaya, William Walker, Adolfo Daz, Emiliano Chamorro, Juan Bautista Sacasa, Anastasio Somoza Garca, Luis Somoza, Violeta Chamorro, Enrique Bolaos and Daniel Ortega are associated with the politics of which country?", "\"Which comic strip created by Rudolph Dirks that first appeared in 1897 in the \"\"American Humorist\"\", the Sunday supplement of the New York Journal, is still distributed, making it the oldest comic strip still in syndication?\"" ]
15
[ 51405, 51406, 51407, 51408, 51409, 51410, 51411, 51412, 51413, 51414, 51415, 51416, 51417, 51418, 51419 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Who in 1968 founded the electronics company Amstrad?\nQuestion 2: Famous for one best-selling novel, which American writer also wrote a series of novels featuring the Glass family?\nQuestion 3: What is the most populous urban area in Africa?\nQuestion 4: 'Lager' beer is named from German meaning?\nQuestion 5: According to the Bible, which ‘A’ was the last battle between good and evil before the Day of Judgement?\nQuestion 6: The German word ahnentafel is a term for a numbering system used in what particular field? (hint: using it eliminates the need to draw a tree)\nQuestion 7: Which chemical element is named after the old name for Copenhagen?\nQuestion 8: In the human body, what is produced by the islets of langerhans in the pancreas?\nQuestion 9: \"Who along with Mel Hausner, Lloyd S. Shapley and Martin Shubik invented a board game called \"\"So Long Sucker\"\" in 1950 which involves game theory strategies?\"\nQuestion 10: What substance are feathers, fingernails and hair made of?\nQuestion 11: \"\"\"She has a lovely face; God in his mercy lend her grace, The Lady of Shalot\"\" is spoken by which Arthurian Knight at the end of Tennyson's poem?\"\nQuestion 12: According to the Bible, Nebuchadnezzar was the King of which region or empire?\nQuestion 13: Olibanum is the medieval Latin alternative English word for which Biblical aromatic resin?\nQuestion 14: In which English county would you find the towns of Saffron Walden, Great Dunmow and Waltham Abbey?\nQuestion 15: Julius Nyerere was the first president of which African country?", "role": "user" } ]
["[\"Alan Michael Sugar\", \"Alan Sugar\", \"Alan Sugar, Baron Sugar\", \"Barron sugar of clapton\", \"The Lord Sugar\", \"Sir Alan Sugar, Baron Sugar\", \"Sir Alan Sugar\", \"Suralan\", \"Alan Michael Sugar, Baron Sugar\", \"Lord Sugar\", \"Baron Sugar of Clapton\", \"Barron sugar of Clapton\", \"Sir alan\", \"Barron Sugar\", \"Amsair\", \"Sir Alan Michael Sugar\", \"Barron Sugar of Clapton\", \"Sir Alan\", \"Baron Sugar\", \"ALAN SUGAR\", \"Alan Sugar, Baron Sugar of Hackney\", \"Lord Alan Sugar\", \"Amscreen\", \"Barron Sugar of clapton\"]", "[\"Salingerian\", \"Jd salinger\", \"Salinger, J. D.\", \"J D Salinger\", \"J. D. Salinger\", \"J.D. Salinger's\", \"Jerome salinger\", \"J. D. Sallinger\", \"J.D. Sallinger\", \"Jerome David Salinger\", \"Jerome Salinger\", \"JD Salinger\", \"Margaret Salinger\", \"J.D. Salinger\", \"J.D.Salinger\"]", "[\"Lagos city\", \"Lagos, Lagos State, Nigeria\", \"Lagos, Lagos\", \"Las Gidi\", \"Lagosian\", \"Lagos, Nigeria\", \"Lagos, Lagos, Nigeria\", \"Lagos, Lagos State\", \"Lasgidi\", \"Lagos\", \"Lagos (city)\", \"Lagaos\", \"City of Lagos\", \"Lagos (Nigeria)\"]", "[\"Storehouse (disambiguation)\", \"Storehouse\"]", "[\"Amargeddon\", \"Armageddon theology\", \"Armaggedon\", \"Armegeddon\", \"Battle of Armageddon\", \"Armagedon\", \"Armaggeddon\", \"Armagideon\", \"Har-Magedon\", \"Armageddon\", \"Armogeddon\", \"Mount Armageddon\"]", "[\"Genealogics\", \"Genealogy chart\", \"Genealogists\", \"Genealogy\", \"Family genealogist\", \"Genealogies\", \"Genealogical\", \"Family History\", \"Genealogist\", \"Family history\", \"Genealogic\", \"Geneology\", \"Gen\\u00e6ology\", \"Geneaology\", \"Family histories\"]", "[\"Hafnium\", \"Halfnium\", \"Norium\", \"Jargonium\", \"HAFNIUM\", \"Norwegium\", \"Celtium\", \"Element 72\"]", "[\"Insulin antagonists\", \"Human Mixtard\", \"Insulin recombinant purified human\", \"INS (gene)\", \"Insulin Human\", \"C65R\", \"Insulin recombinant human\", \"C257H383N65O77S6\", \"Insulin purified pork\", \"Actraphane\", \"Insulin zinc susp recombinant human\", \"Insuline\", \"Insulin zinc susp prompt beef\", \"INSULIN\", \"Insullin\", \"Insulin zinc susp semisynthetic purified human\", \"Insulin aspart recombinant\", \"B10H\", \"Insulin purified beef\", \"Insulin gene\", \"Insulin zinc susp extended recombinant human\", \"Aktrapid\", \"Oral insulin\", \"Insulin zinc susp purified pork\", \"Human mixtard\", \"Insulin zinc susp extended beef\", \"Insulin zinc susp extended purified beef\", \"Insulin release\", \"Insulin zinc susp purified beef\", \"Actrapid\", \"Insulin glargine recombinant\", \"Insulin zinc susp prompt purified pork\", \"Insulin pork\", \"Iletin i (beef-pork)\", \"Iletin II\", \"Insulin zinc susp beef\", \"Mixtard\", \"Insulin, porcine\", \"Insulin\"]", "[\"Nashian\", \"John Forbes Nash Junior\", \"John Forbes Nash Jr\", \"John Forbes Nash\", \"John Forbes Nash Jr.\", \"John Forbes Nash, Jr\", \"John F. Nash, Jr.\", \"John Forbes Nash Jr. (mathematician)\", \"John Nash (Mathematician)\", \"John Forbes Nash, Jr.\", \"John Charles Martin Nash\", \"John Nash (mathematician)\", \"John F. Nash\", \"John F. Nash Jr.\"]", "[\"Keratin\", \"Keretin\", \"Keratin wax\", \"Keratinized\", \"Keratinopathy\", \"Cornification\", \"Kerotin\", \"Keratins\", \"Ceratin\", \"Keratinous tissue\", \"Cornified\", \"KERATIN\", \"Hornification\", \"Keratine\", \"Keratinization\", \"Neurokeratin\", \"Kereton\", \"Keratinisation\", \"Keratinous\"]", "[\"Lancelot du Lac\", \"Chevalier mal fet\", \"Evaine\", \"Lancelot of the Lake\", \"Sir launcelot du lake\", \"Aroundight\", \"Arondight\", \"Sir Lancelot\", \"Sir Lancelot Du Lac\", \"Lancelot\", \"Llenlleawg\", \"Joyousgard\", \"Sir Launcelot\", \"Sir lancealot\", \"'LANCELOT'\", \"Joyous Gard\", \"Llwch Llenlleawg\", \"Launcelot\", \"Joyous Guard\", \"Launcelot du Lac\", \"Joyous Garde\"]", "[\"Babylon (city)\", \"Babalyon\", \"Babilu\", \"Bablyon\", \"Babylon (Iraq)\", \"Ka Dingir\", \"Babylon, Iraq\", \"History of Babylon\", \"Ancient Babylon\", \"City of Babylon\", \"Babylon\"]", "[\"Frankinsense\", \"Frankincence\", \"Frankinsence\", \"Franckincense\", \"Resina olibanum\", \"Frankincense\", \"Olibanum Oil\", \"Frakensense\", \"Olibanum\", \"Francincense\"]", "[\"Wright's Green\", \"Essex lion\", \"County of Essex\", \"Essex calf\", \"Essex\", \"Willow Green\", \"Wimbish Green\", \"Fawbert and Barnard's School\", \"Essex, England\", \"Essex (England)\", \"Willows Green\", \"Essex, United Kingdom\"]", "[\"Tanzanian\", \"United Republic of Tanzania\", \"Tanzania, United Republic of\", \"Jamhuri ya Muungano wa Tanzania\", \"Tanzania\", \"Tansania\", \"Tanzanie\", \"United Republic of Tanganyika and Zanzibar\", \"ISO 3166-1:TZ\", \"Republic of Tanzania\", \"Tanganyika and Zanzibar\", \"The United Republic of Tanzania\", \"TNZ\", \"Tanznia\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Alan Michael Sugar\", \"Alan Sugar\", \"Alan Sugar, Baron Sugar\", \"Barron sugar of clapton\", \"The Lord Sugar\", \"Sir Alan Sugar, Baron Sugar\", \"Sir Alan Sugar\", \"Suralan\", \"Alan Michael Sugar, Baron Sugar\", \"Lord Sugar\", \"Baron Sugar of Clapton\", \"Barron sugar of Clapton\", \"Sir alan\", \"Barron Sugar\", \"Amsair\", \"Sir Alan Michael Sugar\", \"Barron Sugar of Clapton\", \"Sir Alan\", \"Baron Sugar\", \"ALAN SUGAR\", \"Alan Sugar, Baron Sugar of Hackney\", \"Lord Alan Sugar\", \"Amscreen\", \"Barron Sugar of clapton\"]", "[\"Salingerian\", \"Jd salinger\", \"Salinger, J. D.\", \"J D Salinger\", \"J. D. Salinger\", \"J.D. Salinger's\", \"Jerome salinger\", \"J. D. Sallinger\", \"J.D. Sallinger\", \"Jerome David Salinger\", \"Jerome Salinger\", \"JD Salinger\", \"Margaret Salinger\", \"J.D. Salinger\", \"J.D.Salinger\"]", "[\"Lagos city\", \"Lagos, Lagos State, Nigeria\", \"Lagos, Lagos\", \"Las Gidi\", \"Lagosian\", \"Lagos, Nigeria\", \"Lagos, Lagos, Nigeria\", \"Lagos, Lagos State\", \"Lasgidi\", \"Lagos\", \"Lagos (city)\", \"Lagaos\", \"City of Lagos\", \"Lagos (Nigeria)\"]", "[\"Storehouse (disambiguation)\", \"Storehouse\"]", "[\"Amargeddon\", \"Armageddon theology\", \"Armaggedon\", \"Armegeddon\", \"Battle of Armageddon\", \"Armagedon\", \"Armaggeddon\", \"Armagideon\", \"Har-Magedon\", \"Armageddon\", \"Armogeddon\", \"Mount Armageddon\"]", "[\"Genealogics\", \"Genealogy chart\", \"Genealogists\", \"Genealogy\", \"Family genealogist\", \"Genealogies\", \"Genealogical\", \"Family History\", \"Genealogist\", \"Family history\", \"Genealogic\", \"Geneology\", \"Gen\\u00e6ology\", \"Geneaology\", \"Family histories\"]", "[\"Hafnium\", \"Halfnium\", \"Norium\", \"Jargonium\", \"HAFNIUM\", \"Norwegium\", \"Celtium\", \"Element 72\"]", "[\"Insulin antagonists\", \"Human Mixtard\", \"Insulin recombinant purified human\", \"INS (gene)\", \"Insulin Human\", \"C65R\", \"Insulin recombinant human\", \"C257H383N65O77S6\", \"Insulin purified pork\", \"Actraphane\", \"Insulin zinc susp recombinant human\", \"Insuline\", \"Insulin zinc susp prompt beef\", \"INSULIN\", \"Insullin\", \"Insulin zinc susp semisynthetic purified human\", \"Insulin aspart recombinant\", \"B10H\", \"Insulin purified beef\", \"Insulin gene\", \"Insulin zinc susp extended recombinant human\", \"Aktrapid\", \"Oral insulin\", \"Insulin zinc susp purified pork\", \"Human mixtard\", \"Insulin zinc susp extended beef\", \"Insulin zinc susp extended purified beef\", \"Insulin release\", \"Insulin zinc susp purified beef\", \"Actrapid\", \"Insulin glargine recombinant\", \"Insulin zinc susp prompt purified pork\", \"Insulin pork\", \"Iletin i (beef-pork)\", \"Iletin II\", \"Insulin zinc susp beef\", \"Mixtard\", \"Insulin, porcine\", \"Insulin\"]", "[\"Nashian\", \"John Forbes Nash Junior\", \"John Forbes Nash Jr\", \"John Forbes Nash\", \"John Forbes Nash Jr.\", \"John Forbes Nash, Jr\", \"John F. Nash, Jr.\", \"John Forbes Nash Jr. (mathematician)\", \"John Nash (Mathematician)\", \"John Forbes Nash, Jr.\", \"John Charles Martin Nash\", \"John Nash (mathematician)\", \"John F. Nash\", \"John F. Nash Jr.\"]", "[\"Keratin\", \"Keretin\", \"Keratin wax\", \"Keratinized\", \"Keratinopathy\", \"Cornification\", \"Kerotin\", \"Keratins\", \"Ceratin\", \"Keratinous tissue\", \"Cornified\", \"KERATIN\", \"Hornification\", \"Keratine\", \"Keratinization\", \"Neurokeratin\", \"Kereton\", \"Keratinisation\", \"Keratinous\"]", "[\"Lancelot du Lac\", \"Chevalier mal fet\", \"Evaine\", \"Lancelot of the Lake\", \"Sir launcelot du lake\", \"Aroundight\", \"Arondight\", \"Sir Lancelot\", \"Sir Lancelot Du Lac\", \"Lancelot\", \"Llenlleawg\", \"Joyousgard\", \"Sir Launcelot\", \"Sir lancealot\", \"'LANCELOT'\", \"Joyous Gard\", \"Llwch Llenlleawg\", \"Launcelot\", \"Joyous Guard\", \"Launcelot du Lac\", \"Joyous Garde\"]", "[\"Babylon (city)\", \"Babalyon\", \"Babilu\", \"Bablyon\", \"Babylon (Iraq)\", \"Ka Dingir\", \"Babylon, Iraq\", \"History of Babylon\", \"Ancient Babylon\", \"City of Babylon\", \"Babylon\"]", "[\"Frankinsense\", \"Frankincence\", \"Frankinsence\", \"Franckincense\", \"Resina olibanum\", \"Frankincense\", \"Olibanum Oil\", \"Frakensense\", \"Olibanum\", \"Francincense\"]", "[\"Wright's Green\", \"Essex lion\", \"County of Essex\", \"Essex calf\", \"Essex\", \"Willow Green\", \"Wimbish Green\", \"Fawbert and Barnard's School\", \"Essex, England\", \"Essex (England)\", \"Willows Green\", \"Essex, United Kingdom\"]", "[\"Tanzanian\", \"United Republic of Tanzania\", \"Tanzania, United Republic of\", \"Jamhuri ya Muungano wa Tanzania\", \"Tanzania\", \"Tansania\", \"Tanzanie\", \"United Republic of Tanganyika and Zanzibar\", \"ISO 3166-1:TZ\", \"Republic of Tanzania\", \"Tanganyika and Zanzibar\", \"The United Republic of Tanzania\", \"TNZ\", \"Tanznia\"]" ]
[ "Who in 1968 founded the electronics company Amstrad?", "Famous for one best-selling novel, which American writer also wrote a series of novels featuring the Glass family?", "What is the most populous urban area in Africa?", "'Lager' beer is named from German meaning?", "According to the Bible, which ‘A’ was the last battle between good and evil before the Day of Judgement?", "The German word ahnentafel is a term for a numbering system used in what particular field? (hint: using it eliminates the need to draw a tree)", "Which chemical element is named after the old name for Copenhagen?", "In the human body, what is produced by the islets of langerhans in the pancreas?", "\"Who along with Mel Hausner, Lloyd S. Shapley and Martin Shubik invented a board game called \"\"So Long Sucker\"\" in 1950 which involves game theory strategies?\"", "What substance are feathers, fingernails and hair made of?", "\"\"\"She has a lovely face; God in his mercy lend her grace, The Lady of Shalot\"\" is spoken by which Arthurian Knight at the end of Tennyson's poem?\"", "According to the Bible, Nebuchadnezzar was the King of which region or empire?", "Olibanum is the medieval Latin alternative English word for which Biblical aromatic resin?", "In which English county would you find the towns of Saffron Walden, Great Dunmow and Waltham Abbey?", "Julius Nyerere was the first president of which African country?" ]
15
[ 7950, 7951, 7952, 7953, 7954, 7955, 7956, 7957, 7958, 7959, 7960, 7961, 7962, 7963, 7964 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Who was the father of English monarch King Edward I?\nQuestion 2: Which famous brewery is situated in Banbury, Oxfordshire?\nQuestion 3: What is the MKSA or SI unit of electric charge?\nQuestion 4: In which decade of the 20th century was Billy Crystal born?\nQuestion 5: What name is given to the tall slim, stemmed glasses in which sparkling wine should be served?\nQuestion 6: What is the art of preparing, stuffing and mounting the skins of animals for display called?\nQuestion 7: \"What language does the modern English \"\"cat\"\" come from originally?\"\nQuestion 8: What Olympic event was won by Kim Kardashian's step-father, Bruce Jenner?\nQuestion 9: Tamino, Sarastro, Pamina and Papageno are all characters from which opera by Mozart?\nQuestion 10: If I've made a Faustian bargain, who have I made a deal with?\nQuestion 11: What formal two-word term refers to the investigation before completing a business investment or acquisition?\nQuestion 12: What was the original title of the book on which the film Schindler's List was based?\nQuestion 13: ‘Dog and Bone’ is Cockney rhyming slang for what?\nQuestion 14: Who connects the BBC news, ‘Crimewatch’, and ‘Antiques Roadshow’?\nQuestion 15: Who was the first socialist President of France?", "role": "user" } ]
["[\"Henry III\", \"Enrique III\", \"Heinrich III\", \"Hendrik III\", \"Henry iii\", \"Henry the Third\", \"Henry 3\", \"Henry III (disambiguation)\", \"Enrico III\", \"King Henry III\"]", "[\"(Hook Norton)\", \"Hook Norton\", \"Hook norton\", \"Hogg-Norton\"]", "[\"Nanocoulomb\", \"COULOMB\", \"Kilocoulomb\", \"Attocoulomb\", \"Columb\", \"Millicoulomb\", \"Ampere-second\", \"Exacoulomb\", \"Femtocoulomb\", \"Gigacoulomb\", \"Megacoulomb\", \"Coulomb\", \"Microcoulomb\", \"Zettacoulomb\", \"Picocoulomb\", \"Yoctocoulomb\", \"Coloumb\", \"Coulomb (unit)\", \"Petacoulomb\", \"Teracoulomb\", \"Yottacoulomb\", \"Picocoulombs\", \"Q=it\", \"Zeptocoulomb\"]", "[\"The Forties\", \"1940\\u20131949\", \"%6040s\", \"1940s\", \"Nineteen-forties\", \"1940s literature\", \"'40s\", \"1940-1949\", \"1940's\", \"1940s (decade)\"]", "[\"Fl\\u00f6te\", \"Floutist\", \"Edge-blown aerophone\", \"Flautista\", \"Fluteplayer\", \"The Flute\", \"Flutist\", \"Flute\", \"Flautist\", \"Floete\", \"Fluteplaying\", \"Flute player\", \"Classical flautist\", \"Wooden flute\", \"Flute playing\", \"Flute-playing\", \"Flute-player\", \"Fluter\", \"Flutes\"]", "[\"Stuffer\", \"Crypto-taxidermy\", \"Taxodermy\", \"Taxidermist\", \"Taxidermy\", \"Cryptotaxidermy\", \"Taxadermy\", \"Taxidermists\", \"Rogue taxidermy\", \"Taxidermied\", \"Taxidermic\", \"Taxedermy\", \"Stuffing and mounting\", \"Rogue Taxidermy\", \"Digital Taxidermy\"]", "[\"Unknown (disambiguation)\", \"The Unknown (disambiguation)\", \"Unknown\", \"Unknown (film)\", \"Unknown (movie)\", \"The Unknown (movie)\", \"Unknowns\", \"Unknown Album\", \"The Unknown\", \"The Unknown (film)\", \"Uknown\"]", "[\"Decathlon best\", \"Decathalon\", \"Decathlon\", \"Men's decathlon\", \"Men's Decathlon\", \"Decathlete\"]", "[\"Pamina\", \"Die Zauberflote\", \"Der Konigin der Nacht\", \"March of the priests\", \"Sarastro\", \"K\\u00f6nigin der nacht\", \"Die K\\u00f6nigin der Nacht\", \"Arctic Magic Flute\", \"The three boys (opera)\", \"Ach, ich f\\u00fchl's\", \"Zauberflote\", \"KV. 620\", \"Magic flute\", \"Die Zauberfl\\u00f5te\", \"Konigin der Nacht\", \"K\\u00f6nigin der Nacht\", \"Magic Flute Overture\", \"K. 620\", \"KV 620\", \"THE THREE BOYS\", \"Zauberfloete\", \"TROLLFLOYT\", \"Magic Flute\", \"Konigin der nacht\", \"Der Koenigin der Nacht\", \"Die Koenigin der Nacht\", \"Die Zauberfloete\", \"Il Flauto Magico\", \"Die Zauberfloten\", \"Zauberfl\\u00f6te\", \"The Magic Flute\", \"The three boys (opera characters)\", \"March of the Priests\", \"Queen of Night\", \"Der K\\u00f6nigin der Nacht\", \"K 620\", \"Papageno\", \"Die Konigin der Nacht\", \"The magic flute\", \"Die Zauberfl\\u00f6te\"]", "[\"\\u05e9\\u05b8\\u05c2\\u05d8\\u05b8\\u05df\", \"Prince of the Devils\", \"Prince of Evil\", \"Devil\", \"Lord of Darkness\", \"Devilish\", \"Archdevil\", \"List of named devils\", \"The Devil and his names\", \"Dark Lord (theism)\", \"Unjust devil\", \"Diuils\", \"Diabolus\", \"The devil\", \"Dark Lord (religious)\", \"The Devil\", \"Djabelek\", \"Prince of the power of the air\", \"Diuil\", \"Unjust Devil\", \"Prince of the air\"]", "[\"Due Care\", \"Due care\", \"Due dilligence\", \"Due diligence\", \"Due Diligence\"]", "[\"Schindler's Ark\", \"Shindler's Arc\", \"Schindlers Ark\", \"Schindler's Arc\", \"Shindler's Ark\"]", "[\"\\u2121\", \"Fixed telephony\", \"\\u2706\", \"Telephone receiver\", \"Fone\", \"Telpehone\", \"Telephone and Telephone System\", \"Telephone\", \"\\u260f\", \"\\u260e\", \"Phone\", \"\\ud83d\\udcde\", \"\\u2315\", \"Telephones\", \"A phone\", \"Phones\", \"Telephone set\", \"Telephone bell\", \"Station set\", \"Telephone cord\", \"Telephone communication\"]", "[\"FIONA BRUCE\", \"Fiona Bruce\"]", "[\"Francois Maurice Adrien Marie Mitterrand\", \"Mitterand\", \"Francois Mitterrand\", \"Fran\\u00e7ois Miterrand\", \"Francois Maurice Mitterrand\", \"Fran\\u00e7ois Mitterand\", \"President Mitterand\", \"Fran\\u00e7ois Mitterrand\", \"Miterand\", \"President Mitterrand\", \"Mitterrand, Fran\\u00e7ois Maurice\", \"Francois Maurice Marie Mitterrand\", \"Francios Miterand\", \"Francois Mitterand\", \"Observatory Affair\", \"Francois Miterrand\", \"Fran\\u00e7ois Maurice Mitterrand\", \"Mitterrand\", \"Francois miterand\", \"Fran\\u00e7ois Maurice Adrien Marie Mitterrand\", \"Mitterrand, Francois Maurice\", \"Mitterrandian\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Henry III\", \"Enrique III\", \"Heinrich III\", \"Hendrik III\", \"Henry iii\", \"Henry the Third\", \"Henry 3\", \"Henry III (disambiguation)\", \"Enrico III\", \"King Henry III\"]", "[\"(Hook Norton)\", \"Hook Norton\", \"Hook norton\", \"Hogg-Norton\"]", "[\"Nanocoulomb\", \"COULOMB\", \"Kilocoulomb\", \"Attocoulomb\", \"Columb\", \"Millicoulomb\", \"Ampere-second\", \"Exacoulomb\", \"Femtocoulomb\", \"Gigacoulomb\", \"Megacoulomb\", \"Coulomb\", \"Microcoulomb\", \"Zettacoulomb\", \"Picocoulomb\", \"Yoctocoulomb\", \"Coloumb\", \"Coulomb (unit)\", \"Petacoulomb\", \"Teracoulomb\", \"Yottacoulomb\", \"Picocoulombs\", \"Q=it\", \"Zeptocoulomb\"]", "[\"The Forties\", \"1940\\u20131949\", \"%6040s\", \"1940s\", \"Nineteen-forties\", \"1940s literature\", \"'40s\", \"1940-1949\", \"1940's\", \"1940s (decade)\"]", "[\"Fl\\u00f6te\", \"Floutist\", \"Edge-blown aerophone\", \"Flautista\", \"Fluteplayer\", \"The Flute\", \"Flutist\", \"Flute\", \"Flautist\", \"Floete\", \"Fluteplaying\", \"Flute player\", \"Classical flautist\", \"Wooden flute\", \"Flute playing\", \"Flute-playing\", \"Flute-player\", \"Fluter\", \"Flutes\"]", "[\"Stuffer\", \"Crypto-taxidermy\", \"Taxodermy\", \"Taxidermist\", \"Taxidermy\", \"Cryptotaxidermy\", \"Taxadermy\", \"Taxidermists\", \"Rogue taxidermy\", \"Taxidermied\", \"Taxidermic\", \"Taxedermy\", \"Stuffing and mounting\", \"Rogue Taxidermy\", \"Digital Taxidermy\"]", "[\"Unknown (disambiguation)\", \"The Unknown (disambiguation)\", \"Unknown\", \"Unknown (film)\", \"Unknown (movie)\", \"The Unknown (movie)\", \"Unknowns\", \"Unknown Album\", \"The Unknown\", \"The Unknown (film)\", \"Uknown\"]", "[\"Decathlon best\", \"Decathalon\", \"Decathlon\", \"Men's decathlon\", \"Men's Decathlon\", \"Decathlete\"]", "[\"Pamina\", \"Die Zauberflote\", \"Der Konigin der Nacht\", \"March of the priests\", \"Sarastro\", \"K\\u00f6nigin der nacht\", \"Die K\\u00f6nigin der Nacht\", \"Arctic Magic Flute\", \"The three boys (opera)\", \"Ach, ich f\\u00fchl's\", \"Zauberflote\", \"KV. 620\", \"Magic flute\", \"Die Zauberfl\\u00f5te\", \"Konigin der Nacht\", \"K\\u00f6nigin der Nacht\", \"Magic Flute Overture\", \"K. 620\", \"KV 620\", \"THE THREE BOYS\", \"Zauberfloete\", \"TROLLFLOYT\", \"Magic Flute\", \"Konigin der nacht\", \"Der Koenigin der Nacht\", \"Die Koenigin der Nacht\", \"Die Zauberfloete\", \"Il Flauto Magico\", \"Die Zauberfloten\", \"Zauberfl\\u00f6te\", \"The Magic Flute\", \"The three boys (opera characters)\", \"March of the Priests\", \"Queen of Night\", \"Der K\\u00f6nigin der Nacht\", \"K 620\", \"Papageno\", \"Die Konigin der Nacht\", \"The magic flute\", \"Die Zauberfl\\u00f6te\"]", "[\"\\u05e9\\u05b8\\u05c2\\u05d8\\u05b8\\u05df\", \"Prince of the Devils\", \"Prince of Evil\", \"Devil\", \"Lord of Darkness\", \"Devilish\", \"Archdevil\", \"List of named devils\", \"The Devil and his names\", \"Dark Lord (theism)\", \"Unjust devil\", \"Diuils\", \"Diabolus\", \"The devil\", \"Dark Lord (religious)\", \"The Devil\", \"Djabelek\", \"Prince of the power of the air\", \"Diuil\", \"Unjust Devil\", \"Prince of the air\"]", "[\"Due Care\", \"Due care\", \"Due dilligence\", \"Due diligence\", \"Due Diligence\"]", "[\"Schindler's Ark\", \"Shindler's Arc\", \"Schindlers Ark\", \"Schindler's Arc\", \"Shindler's Ark\"]", "[\"\\u2121\", \"Fixed telephony\", \"\\u2706\", \"Telephone receiver\", \"Fone\", \"Telpehone\", \"Telephone and Telephone System\", \"Telephone\", \"\\u260f\", \"\\u260e\", \"Phone\", \"\\ud83d\\udcde\", \"\\u2315\", \"Telephones\", \"A phone\", \"Phones\", \"Telephone set\", \"Telephone bell\", \"Station set\", \"Telephone cord\", \"Telephone communication\"]", "[\"FIONA BRUCE\", \"Fiona Bruce\"]", "[\"Francois Maurice Adrien Marie Mitterrand\", \"Mitterand\", \"Francois Mitterrand\", \"Fran\\u00e7ois Miterrand\", \"Francois Maurice Mitterrand\", \"Fran\\u00e7ois Mitterand\", \"President Mitterand\", \"Fran\\u00e7ois Mitterrand\", \"Miterand\", \"President Mitterrand\", \"Mitterrand, Fran\\u00e7ois Maurice\", \"Francois Maurice Marie Mitterrand\", \"Francios Miterand\", \"Francois Mitterand\", \"Observatory Affair\", \"Francois Miterrand\", \"Fran\\u00e7ois Maurice Mitterrand\", \"Mitterrand\", \"Francois miterand\", \"Fran\\u00e7ois Maurice Adrien Marie Mitterrand\", \"Mitterrand, Francois Maurice\", \"Mitterrandian\"]" ]
[ "Who was the father of English monarch King Edward I?", "Which famous brewery is situated in Banbury, Oxfordshire?", "What is the MKSA or SI unit of electric charge?", "In which decade of the 20th century was Billy Crystal born?", "What name is given to the tall slim, stemmed glasses in which sparkling wine should be served?", "What is the art of preparing, stuffing and mounting the skins of animals for display called?", "\"What language does the modern English \"\"cat\"\" come from originally?\"", "What Olympic event was won by Kim Kardashian's step-father, Bruce Jenner?", "Tamino, Sarastro, Pamina and Papageno are all characters from which opera by Mozart?", "If I've made a Faustian bargain, who have I made a deal with?", "What formal two-word term refers to the investigation before completing a business investment or acquisition?", "What was the original title of the book on which the film Schindler's List was based?", "‘Dog and Bone’ is Cockney rhyming slang for what?", "Who connects the BBC news, ‘Crimewatch’, and ‘Antiques Roadshow’?", "Who was the first socialist President of France?" ]
15
[ 35205, 35206, 35207, 35208, 35209, 35210, 35211, 35212, 35213, 35214, 35215, 35216, 35217, 35218, 35219 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which jockey won the 2010 Aintree Grand National on 'Don't Push It', at his fifteenth attempt?\nQuestion 2: The coypu, or nutria, was originally native to which continent?\nQuestion 3: Which constituency did George Galloway win in 2012?\nQuestion 4: Whose first novel published in 1985 was Oranges Are Not the Only Fruit?\nQuestion 5: Which is the brightest star in the constellation Virgo?\nQuestion 6: What is the name of Atticus Finch's daughter, the narrator of To Kill a Mockingbird?\nQuestion 7: In flowering plants, what name is given to the terminal part of a stamen, where pollen is produced?\nQuestion 8: Which Irish folk band had UK 'top twenty' hits in 1967 with 'Seven Drunken Nights' and 'Black Velvet Band'?\nQuestion 9: The first income tax in the US, 3% of all incomes over US $800, was levied to pay for what war?\nQuestion 10: Which Biblical king was the son of David and Bathsheba?\nQuestion 11: The German 'dachshund' means '(What?) dog'?\nQuestion 12: \"On whose life is Somerset Maugham's \"\"The Moon and Sixpence\"\" based on?\"\nQuestion 13: In what movie did Sinatra sing My Kind of Town?\nQuestion 14: Who was King of England at the Battle of Bannockburn?\nQuestion 15: Which British author wrote the 1996 Booker winning novel “Last Orders”?", "role": "user" } ]
["[\"Anthony Peter McCoy\", \"TONY MCCOY\", \"AP McCoy\", \"Tony mccoy\", \"Tony McCoy\", \"A. P. McCoy\"]", "[\"South amerika\", \"South america\", \"Prehistory of South America\", \"South American capital cities\", \"Southamericans\", \"S. America\", \"South American continent\", \"America do Sul\", \"SOUTH AMERICA\", \"South America (region)\", \"South America (continent)\", \"South american capital cities\", \"South Americas\", \"Aouth america\", \"South Americans\", \"Southamerica\", \"Southern America\", \"South American\", \"Am\\u00e9rica do Sul\", \"List of national capitals in South America\", \"Tourism in South America\", \"South Amerika\", \"Southamerican\", \"South-America\", \"South-American\", \"South America\"]", "[\"Bradford West\", \"BRADFORD WEST\", \"Bradford West seat\", \"Bradford West (UK Parliament constituency)\"]", "[\"Written on the Body\", \"Written on the Body (novel)\", \"Winterson\", \"Jeanette Winterson\"]", "[\"SPICA\"]", "[\"Scout\", \"Scout (disambiguation)\"]", "[\"Stamen\", \"Staminal\", \"Androecium\", \"Anthers\", \"Staminal column\", \"Stamens\", \"THE ANTHER\", \"Epipetal\", \"Filament (botany)\", \"Didynamous\", \"Androphore\", \"Anthere\", \"Staminally\", \"Antheral\", \"Anther\", \"Stamenal\", \"Staminate\"]", "[\"'THE DUBLINERS'\", \"The dubliners\", \"The Dubliners\", \"The Dublin Legends\", \"Thedubliners\"]", "[\"Civil War (disambiguation)\", \"The civil war\", \"Civil War\", \"Car Civil War\", \"The Civil War\", \"Civil war (disambiguation)\"]", "[\"King Solomon\", \"Biblical account of King Solomon\", \"Solomon (ancient)\", \"\\u05e9\\u05b0\\u05c1\\u05dc\\u05b9\\u05de\\u05b9\\u05d4\", \"SOLOMON\", \"Shelomo\", \"Solomon\", \"\\u0633\\u0644\\u064a\\u0645\\u0627\\u0646\", \"Suleiman bin Daoud\", \"Solomon the wise\", \"Shelomoh\", \"Soloman\", \"Solomon the Great\", \"Schlomo\"]", "[\"Badger (animal)\", \"Melinae\", \"Badger\", \"Brock (animal)\", \"Badgers\"]", "[\"Paul Gaugin\", \"Eug\\u010dne Henri Paul Gauguin\", \"Paul Gauguin\", \"Eugcne Henri Paul Gauguin\", \"Eug\\u00e8ne Henri Paul Gauguin\", \"Gauguin\", \"Eugene Henri Paul Gauguin\", \"Gaugin\"]", "[\"Robin and the 7 hoods\", \"Robin and the Seven Hoods\", \"Robin and the 7 Hoods\", \"Robin And the 7 Hoods\"]", "[\"Edward II, King of the English\", \"King Edward II of England\", \"Edward ii\", \"Edward II (England)\", \"Edward ii of england\", \"EDWARD II\", \"Edward the Second\", \"Edward II of Caernarfon\", \"Edward 2\", \"King who died with a hot poker up the ass\", \"King Edward II\", \"Edward II of England\", \"Edward of Caernarfon\", \"Edward II of Carnarvon\", \"Edward of Caernarvon\", \"Edward II, King of England\", \"Edward II\", \"Edward of Carnarvon\"]", "[\"GRAHAM SWIFT\", \"Graham Swift\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Anthony Peter McCoy\", \"TONY MCCOY\", \"AP McCoy\", \"Tony mccoy\", \"Tony McCoy\", \"A. P. McCoy\"]", "[\"South amerika\", \"South america\", \"Prehistory of South America\", \"South American capital cities\", \"Southamericans\", \"S. America\", \"South American continent\", \"America do Sul\", \"SOUTH AMERICA\", \"South America (region)\", \"South America (continent)\", \"South american capital cities\", \"South Americas\", \"Aouth america\", \"South Americans\", \"Southamerica\", \"Southern America\", \"South American\", \"Am\\u00e9rica do Sul\", \"List of national capitals in South America\", \"Tourism in South America\", \"South Amerika\", \"Southamerican\", \"South-America\", \"South-American\", \"South America\"]", "[\"Bradford West\", \"BRADFORD WEST\", \"Bradford West seat\", \"Bradford West (UK Parliament constituency)\"]", "[\"Written on the Body\", \"Written on the Body (novel)\", \"Winterson\", \"Jeanette Winterson\"]", "[\"SPICA\"]", "[\"Scout\", \"Scout (disambiguation)\"]", "[\"Stamen\", \"Staminal\", \"Androecium\", \"Anthers\", \"Staminal column\", \"Stamens\", \"THE ANTHER\", \"Epipetal\", \"Filament (botany)\", \"Didynamous\", \"Androphore\", \"Anthere\", \"Staminally\", \"Antheral\", \"Anther\", \"Stamenal\", \"Staminate\"]", "[\"'THE DUBLINERS'\", \"The dubliners\", \"The Dubliners\", \"The Dublin Legends\", \"Thedubliners\"]", "[\"Civil War (disambiguation)\", \"The civil war\", \"Civil War\", \"Car Civil War\", \"The Civil War\", \"Civil war (disambiguation)\"]", "[\"King Solomon\", \"Biblical account of King Solomon\", \"Solomon (ancient)\", \"\\u05e9\\u05b0\\u05c1\\u05dc\\u05b9\\u05de\\u05b9\\u05d4\", \"SOLOMON\", \"Shelomo\", \"Solomon\", \"\\u0633\\u0644\\u064a\\u0645\\u0627\\u0646\", \"Suleiman bin Daoud\", \"Solomon the wise\", \"Shelomoh\", \"Soloman\", \"Solomon the Great\", \"Schlomo\"]", "[\"Badger (animal)\", \"Melinae\", \"Badger\", \"Brock (animal)\", \"Badgers\"]", "[\"Paul Gaugin\", \"Eug\\u010dne Henri Paul Gauguin\", \"Paul Gauguin\", \"Eugcne Henri Paul Gauguin\", \"Eug\\u00e8ne Henri Paul Gauguin\", \"Gauguin\", \"Eugene Henri Paul Gauguin\", \"Gaugin\"]", "[\"Robin and the 7 hoods\", \"Robin and the Seven Hoods\", \"Robin and the 7 Hoods\", \"Robin And the 7 Hoods\"]", "[\"Edward II, King of the English\", \"King Edward II of England\", \"Edward ii\", \"Edward II (England)\", \"Edward ii of england\", \"EDWARD II\", \"Edward the Second\", \"Edward II of Caernarfon\", \"Edward 2\", \"King who died with a hot poker up the ass\", \"King Edward II\", \"Edward II of England\", \"Edward of Caernarfon\", \"Edward II of Carnarvon\", \"Edward of Caernarvon\", \"Edward II, King of England\", \"Edward II\", \"Edward of Carnarvon\"]", "[\"GRAHAM SWIFT\", \"Graham Swift\"]" ]
[ "Which jockey won the 2010 Aintree Grand National on 'Don't Push It', at his fifteenth attempt?", "The coypu, or nutria, was originally native to which continent?", "Which constituency did George Galloway win in 2012?", "Whose first novel published in 1985 was Oranges Are Not the Only Fruit?", "Which is the brightest star in the constellation Virgo?", "What is the name of Atticus Finch's daughter, the narrator of To Kill a Mockingbird?", "In flowering plants, what name is given to the terminal part of a stamen, where pollen is produced?", "Which Irish folk band had UK 'top twenty' hits in 1967 with 'Seven Drunken Nights' and 'Black Velvet Band'?", "The first income tax in the US, 3% of all incomes over US $800, was levied to pay for what war?", "Which Biblical king was the son of David and Bathsheba?", "The German 'dachshund' means '(What?) dog'?", "\"On whose life is Somerset Maugham's \"\"The Moon and Sixpence\"\" based on?\"", "In what movie did Sinatra sing My Kind of Town?", "Who was King of England at the Battle of Bannockburn?", "Which British author wrote the 1996 Booker winning novel “Last Orders”?" ]
15
[ 26445, 26446, 26447, 26448, 26449, 26450, 26451, 26452, 26453, 26454, 26455, 26456, 26457, 26458, 26459 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Three generations of which family have won Oscars?\nQuestion 2: In Western films, what is a bar regularly called?\nQuestion 3: \"Nicknamed \"\"Little Mo\"\" who was the first player to win the Grand Slam in women's tennis?\"\nQuestion 4: In China, in a restaurant, what are you ordering if you ask for 'fragrant meat'?\nQuestion 5: In 2010, Neil Robertson became the second Australian to win the World Snooker Championship title. Who was the first, who won the 1952 championship?\nQuestion 6: Buckland Abbey in Devon was the home of which famous 16th century English seaman?\nQuestion 7: Who was the East German leader tried for high treason in 1993?\nQuestion 8: In Greek Mythology who is the Greek god of wine?\nQuestion 9: Whose experiential learning theory comprises the learning styles named?\nQuestion 10: What 2002 film, an adaptation of stage musical that explores the themes of 'celebrity' and 'scandal', starred Catherine Zeta-Jones, Rene Zellweger, and Richard Gere?\nQuestion 11: In World War 11 R.A.F. slang what were cookies\nQuestion 12: What, according to Monty Python, does nobody expect?\nQuestion 13: What was the name of John Cabot's ship in which he set off in 1497 to reach Asia, finishing up in Newfoundland?\nQuestion 14: Which great modernist architect designed the Seagram Building in New York in collaboration with Philip Johnson?\nQuestion 15: 'Masala Chai' is an Indian tea flavoured with which sweet spice?", "role": "user" } ]
["[\"Huston (disambiguation)\", \"Huston\"]", "[\"Saloons\", \"Saloon\", \"Saloon (disambiguation)\"]", "[\"Maureen Connolly Brinker\", \"Mo Connolly\", \"Maureen Brinker\", \"Little Mo Connolly\", \"MAUREEN CONNOLLY\", \"Maureen Catherine Connolly\", \"%22Little Mo%22 Connolly\", \"Maureen Connolly\"]", "[\"Domestic dogs\", \"Female dogs\", \"Canis familiaris\", \"Canis Familaris\", \"Canis familiaris domesticus\", \"Dogs (Animals)\", \"\\ud83d\\udc15\", \"She dog\", \"She-dog\", \"Dogs\", \"Doggy\", \"Canis familiarus domesticus\", \"Domestic dog\", \"Dogs as pets\", \"Dog (pet)\", \"Dog (Domestic)\", \"Pet dog\", \"She dogs\", \"Canis lupus familiaris\", \"Canine lupus\", \"Dog hood\", \"Shedog\", \"\\ud83d\\udc36\", \"The domestic dog clade\", \"A dog\", \"Canis domesticus\", \"Dogs as our pets\", \"Canis Canis\", \"Domestic Dog\", \"Canis Lupus Familiaris\", \"Doggie\", \"Dog\", \"C.l. familiaris\", \"Doggies\", \"A man's best friend\", \"Doghood\", \"Shedogs\", \"Bitch (female dog)\", \"She-dogs\", \"Dogness\", \"Bitch (dog)\", \"Female dog\", \"C. l. familiaris\", \"Shelter dog\"]", "[\"Horace Lindrum\"]", "[\"Francis Drake, the Voyages of\", \"Sir Francis Drake\", \"Draque\", \"Sir. Francis Drake\", \"El Draque\", \"Francisco Draco\", \"SIR FRANCIS DRAKE\", \"Francis Drake\", \"Drake, the Voyages of Francis\", \"Drake, the Voyages of Sir Francis\"]", "[\"Eric Honecker\", \"Erich Honnecker\", \"Erich Honecker\", \"Honecker, Erich\", \"Erik Honecker\", \"Erich HONECKER\", \"Honecker\"]", "[\"God of wine\", \"Di-wo-ni-so-jo\", \"Lyaeus\", \"Di\\u00f3nysos\", \"Layios\", \"Dyonysus\", \"Dionysiac cult\", \"Dionysos\", \"Acratophorus\", \"Father Bacchus\", \"Liknites\", \"Aegobolus\", \"Dionysis\", \"\\u0394\\u03b9\\u03cc\\u03bd\\u03c5\\u03c3\\u03bf\\u03c2\", \"\\u0394\\u03b9\\u03ce\\u03bd\\u03c5\\u03c3\\u03bf\\u03c2\", \"Bacchus (god)\", \"Lyoeus\", \"Bacchus\", \"Bacchino\", \"Dionysus,\", \"Bachus\", \"Dionysus\", \"God of Wine\", \"Dyonisos\", \"Dionysos Dendrites\", \"Bacchus (mythology)\", \"Dionysus Dendrites\", \"Bacchic\"]", "[\"David Kolb\", \"David kolb\"]", "[\"Chi-Beria\", \"Sayre language academy\", \"Chicago\", \"Chicago, Illinois\", \"Hog Butcher for the World\", \"Land of smelly onions\", \"Ariel Community Academy\", \"The weather in Chicago\", \"Chicago, Illinois, U.S.A.\", \"Chicago, Illionis\", \"Near North Montessori\", \"Religion in Chicago\", \"Chicago Finance Committee\", \"The Paris of America\", \"The city of Chicago\", \"City of Chicago\", \"List of sister cities of Chicago\", \"UN/LOCODE:USCHI\", \"Chicago theatre scene\", \"Chicago, WI\", \"The City of Broad Shoulders\", \"City of Broad Shoulders\", \"Sister Cities of Chicago\", \"Chicago il\", \"Chicago, Illinois, USA\", \"Performing arts in Chicago\", \"Chicago Transportation Committee\", \"Chicago, Wisconsin\", \"City of chicago\", \"Chicago theater scene\", \"Chicago, Il\", \"Chicago, IL.\", \"Chicago, Ill.\", \"City of Chicago, Illinois\", \"Chi town\", \"Chicago, United States\", \"Chicago (Ill.)\", \"Transport in Chicago\", \"Chicago, Illinois, United States\", \"Chicago (IL)\", \"USCHI\", \"Chichago\", \"Chcago\", \"Chicago, Illinois, U.S.\", \"Sister Cities Chicago\", \"Chicago, USA\", \"Chi City\", \"Chicago, IL\", \"Chi-Town\", \"Chicago theatre\", \"Paris of America\", \"Chicago, Illinois, US\", \"Chicago Illinois\", \"The city of Chicago, Illinois\", \"Sister cities of Chicago\"]", "[\"Bombed-out\", \"Bomb holes\", \"BOMB\", \"Seat of explosion\", \"Superbombs\", \"Bombed out\", \"Bombings\", \"Exploding bomb\", \"Bombs\", \"\\ud83d\\udca3\", \"Bomb\", \"Blast seat\", \"Bombing\"]", "[\"The Spanish Inquisition\", \"Spanish inquisition\", \"Spanish Casual Q&A\", \"Future of carla\", \"Spanish Inquisition\", \"The spanish inquisition\", \"Spanish Inqusition\", \"Spanish Inquistion\", \"Spanish Inquisiton\", \"Grand Inquisitor of Spain\"]", "[\"Matthew\", \"Matthew (disambiguation)\", \"Matay\", \"Matt.\", \"Mattheus\"]", "[\"Miesian\", \"LUDWIG MIES VAN DER ROHE\", \"Mies van der Rohe\", \"Ludwig Mies van der Rohe\", \"Ludwig Mies Van Der Rohe\", \"Mies Van der Rohe\", \"Van der Rohe\", \"Mies van de Rohe\", \"Van der rohe\", \"Mies Van De Rohe\", \"Maria Ludwig Michael Mies\", \"Mies Van Der Rohe\", \"Ludwig Mies Van der Rohe\", \"Mies van der rohe\"]", "[\"Kurundu\", \"M00 000 special\", \"Dalchini\", \"Cinnammin\", \"Cinnimon\", \"Cinimon\", \"Cinnemon\", \"M000000\", \"Cinnamin\", \"Cinammin\", \"Cinnamon plant\", \"CINNAMON\", \"M0000\", \"Cinammon\", \"Cinnaman\", \"\\u05e7\\u05b4\\u05e0\\u05b8\\u05bc\\u05de\\u05d5\\u05b9\\u05df\", \"Cinamon\", \"Cinamin\", \"Kayu manis\", \"Cinnamon\", \"\\u0d9a\\u0dd4\\u0dbb\\u0dd4\\u0db3\\u0dd4\", \"Cinnamon tree\", \"Cinnammon\", \"Cinnamon stick\", \"Cinemon\", \"Kinn\\u00e1m\\u014dmon\", \"Korunda\", \"Cinnamon bark\", \"Qinn\\u0101m\\u00f4n\", \"Cinnamon sticks\", \"Cannelle de Ceylan\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Huston (disambiguation)\", \"Huston\"]", "[\"Saloons\", \"Saloon\", \"Saloon (disambiguation)\"]", "[\"Maureen Connolly Brinker\", \"Mo Connolly\", \"Maureen Brinker\", \"Little Mo Connolly\", \"MAUREEN CONNOLLY\", \"Maureen Catherine Connolly\", \"%22Little Mo%22 Connolly\", \"Maureen Connolly\"]", "[\"Domestic dogs\", \"Female dogs\", \"Canis familiaris\", \"Canis Familaris\", \"Canis familiaris domesticus\", \"Dogs (Animals)\", \"\\ud83d\\udc15\", \"She dog\", \"She-dog\", \"Dogs\", \"Doggy\", \"Canis familiarus domesticus\", \"Domestic dog\", \"Dogs as pets\", \"Dog (pet)\", \"Dog (Domestic)\", \"Pet dog\", \"She dogs\", \"Canis lupus familiaris\", \"Canine lupus\", \"Dog hood\", \"Shedog\", \"\\ud83d\\udc36\", \"The domestic dog clade\", \"A dog\", \"Canis domesticus\", \"Dogs as our pets\", \"Canis Canis\", \"Domestic Dog\", \"Canis Lupus Familiaris\", \"Doggie\", \"Dog\", \"C.l. familiaris\", \"Doggies\", \"A man's best friend\", \"Doghood\", \"Shedogs\", \"Bitch (female dog)\", \"She-dogs\", \"Dogness\", \"Bitch (dog)\", \"Female dog\", \"C. l. familiaris\", \"Shelter dog\"]", "[\"Horace Lindrum\"]", "[\"Francis Drake, the Voyages of\", \"Sir Francis Drake\", \"Draque\", \"Sir. Francis Drake\", \"El Draque\", \"Francisco Draco\", \"SIR FRANCIS DRAKE\", \"Francis Drake\", \"Drake, the Voyages of Francis\", \"Drake, the Voyages of Sir Francis\"]", "[\"Eric Honecker\", \"Erich Honnecker\", \"Erich Honecker\", \"Honecker, Erich\", \"Erik Honecker\", \"Erich HONECKER\", \"Honecker\"]", "[\"God of wine\", \"Di-wo-ni-so-jo\", \"Lyaeus\", \"Di\\u00f3nysos\", \"Layios\", \"Dyonysus\", \"Dionysiac cult\", \"Dionysos\", \"Acratophorus\", \"Father Bacchus\", \"Liknites\", \"Aegobolus\", \"Dionysis\", \"\\u0394\\u03b9\\u03cc\\u03bd\\u03c5\\u03c3\\u03bf\\u03c2\", \"\\u0394\\u03b9\\u03ce\\u03bd\\u03c5\\u03c3\\u03bf\\u03c2\", \"Bacchus (god)\", \"Lyoeus\", \"Bacchus\", \"Bacchino\", \"Dionysus,\", \"Bachus\", \"Dionysus\", \"God of Wine\", \"Dyonisos\", \"Dionysos Dendrites\", \"Bacchus (mythology)\", \"Dionysus Dendrites\", \"Bacchic\"]", "[\"David Kolb\", \"David kolb\"]", "[\"Chi-Beria\", \"Sayre language academy\", \"Chicago\", \"Chicago, Illinois\", \"Hog Butcher for the World\", \"Land of smelly onions\", \"Ariel Community Academy\", \"The weather in Chicago\", \"Chicago, Illinois, U.S.A.\", \"Chicago, Illionis\", \"Near North Montessori\", \"Religion in Chicago\", \"Chicago Finance Committee\", \"The Paris of America\", \"The city of Chicago\", \"City of Chicago\", \"List of sister cities of Chicago\", \"UN/LOCODE:USCHI\", \"Chicago theatre scene\", \"Chicago, WI\", \"The City of Broad Shoulders\", \"City of Broad Shoulders\", \"Sister Cities of Chicago\", \"Chicago il\", \"Chicago, Illinois, USA\", \"Performing arts in Chicago\", \"Chicago Transportation Committee\", \"Chicago, Wisconsin\", \"City of chicago\", \"Chicago theater scene\", \"Chicago, Il\", \"Chicago, IL.\", \"Chicago, Ill.\", \"City of Chicago, Illinois\", \"Chi town\", \"Chicago, United States\", \"Chicago (Ill.)\", \"Transport in Chicago\", \"Chicago, Illinois, United States\", \"Chicago (IL)\", \"USCHI\", \"Chichago\", \"Chcago\", \"Chicago, Illinois, U.S.\", \"Sister Cities Chicago\", \"Chicago, USA\", \"Chi City\", \"Chicago, IL\", \"Chi-Town\", \"Chicago theatre\", \"Paris of America\", \"Chicago, Illinois, US\", \"Chicago Illinois\", \"The city of Chicago, Illinois\", \"Sister cities of Chicago\"]", "[\"Bombed-out\", \"Bomb holes\", \"BOMB\", \"Seat of explosion\", \"Superbombs\", \"Bombed out\", \"Bombings\", \"Exploding bomb\", \"Bombs\", \"\\ud83d\\udca3\", \"Bomb\", \"Blast seat\", \"Bombing\"]", "[\"The Spanish Inquisition\", \"Spanish inquisition\", \"Spanish Casual Q&A\", \"Future of carla\", \"Spanish Inquisition\", \"The spanish inquisition\", \"Spanish Inqusition\", \"Spanish Inquistion\", \"Spanish Inquisiton\", \"Grand Inquisitor of Spain\"]", "[\"Matthew\", \"Matthew (disambiguation)\", \"Matay\", \"Matt.\", \"Mattheus\"]", "[\"Miesian\", \"LUDWIG MIES VAN DER ROHE\", \"Mies van der Rohe\", \"Ludwig Mies van der Rohe\", \"Ludwig Mies Van Der Rohe\", \"Mies Van der Rohe\", \"Van der Rohe\", \"Mies van de Rohe\", \"Van der rohe\", \"Mies Van De Rohe\", \"Maria Ludwig Michael Mies\", \"Mies Van Der Rohe\", \"Ludwig Mies Van der Rohe\", \"Mies van der rohe\"]", "[\"Kurundu\", \"M00 000 special\", \"Dalchini\", \"Cinnammin\", \"Cinnimon\", \"Cinimon\", \"Cinnemon\", \"M000000\", \"Cinnamin\", \"Cinammin\", \"Cinnamon plant\", \"CINNAMON\", \"M0000\", \"Cinammon\", \"Cinnaman\", \"\\u05e7\\u05b4\\u05e0\\u05b8\\u05bc\\u05de\\u05d5\\u05b9\\u05df\", \"Cinamon\", \"Cinamin\", \"Kayu manis\", \"Cinnamon\", \"\\u0d9a\\u0dd4\\u0dbb\\u0dd4\\u0db3\\u0dd4\", \"Cinnamon tree\", \"Cinnammon\", \"Cinnamon stick\", \"Cinemon\", \"Kinn\\u00e1m\\u014dmon\", \"Korunda\", \"Cinnamon bark\", \"Qinn\\u0101m\\u00f4n\", \"Cinnamon sticks\", \"Cannelle de Ceylan\"]" ]
[ "Three generations of which family have won Oscars?", "In Western films, what is a bar regularly called?", "\"Nicknamed \"\"Little Mo\"\" who was the first player to win the Grand Slam in women's tennis?\"", "In China, in a restaurant, what are you ordering if you ask for 'fragrant meat'?", "In 2010, Neil Robertson became the second Australian to win the World Snooker Championship title. Who was the first, who won the 1952 championship?", "Buckland Abbey in Devon was the home of which famous 16th century English seaman?", "Who was the East German leader tried for high treason in 1993?", "In Greek Mythology who is the Greek god of wine?", "Whose experiential learning theory comprises the learning styles named?", "What 2002 film, an adaptation of stage musical that explores the themes of 'celebrity' and 'scandal', starred Catherine Zeta-Jones, Rene Zellweger, and Richard Gere?", "In World War 11 R.A.F. slang what were cookies", "What, according to Monty Python, does nobody expect?", "What was the name of John Cabot's ship in which he set off in 1497 to reach Asia, finishing up in Newfoundland?", "Which great modernist architect designed the Seagram Building in New York in collaboration with Philip Johnson?", "'Masala Chai' is an Indian tea flavoured with which sweet spice?" ]
15
[ 71280, 71281, 71282, 71283, 71284, 71285, 71286, 71287, 71288, 71289, 71290, 71291, 71292, 71293, 71294 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which warship is permanently moored opposite the Tower of London\nQuestion 2: Who had a summer hit in 2008 with Sweet About Me?\nQuestion 3: What is the name of the leader of the British UKIP Party?\nQuestion 4: \"About which bird did Wordsworth write \"\"Is it a bird, or but a wandering voice?\"\nQuestion 5: What was the name of the German Chancellor, the primary force behind the unification of Germany 1871, who also had a famous battleship named after him?\nQuestion 6: Which 1985 romantic comedy starring Alexandra Pigg and Margi Clarke was set in Liverpool?\nQuestion 7: What was the name of George Washington's house where he is buried\nQuestion 8: The first what in the UK took place on the night of Nov. 19th, 1994?\nQuestion 9: What is golfer Tiger Woods first name?\nQuestion 10: What was the title of the 2001 film that was a sequel to The Silence of the Lambs?\nQuestion 11: What is the Beverley Hills Diet developed by Judy Mazel based on\nQuestion 12: What is removed during an operation called an orchidectomy\nQuestion 13: The Scottish-American industrialist and philanthropist Andrew Carnegie (1835-1919) pioneered and made his vast fortune in which industry in late 1800s USA?\nQuestion 14: Which US State has the smallest population?\nQuestion 15: For a point each, name the 2 countries surrounding the Oriental Republic of Uruguay.", "role": "user" } ]
["[\"Hms belfast\", \"HMS Belfast (C35)\", \"HMS Belfast\", \"H.M.S. Belfast\"]", "[\"Gabrielle Cilmi\", \"Gabriella Chillme\", \"Gabrielle cilmi\", \"Gabriella Climi\", \"Gabriella Chilmi\", \"Gabriella Chill Me\", \"Gabriella Cilmi\", \"Cilmi\", \"Gabriella Cilme\"]", "[\"Nigel Faraje\", \"NIGEL FARAGE\", \"Nigel farage\", \"Nigel Paul Farage\", \"Faragista\", \"2010 UKIP PZL-104 Wilga crash\", \"Nigel Farage\", \"Nigel Farrage\", \"Farage\"]", "[\"The cuckoo\", \"CUCKOO\", \"Kukushka\", \"The Cuckoo (disambiguation)\", \"Cuckoo (movie)\", \"The Cuckoo\"]", "[\"Count von Bismarck-Schoenausen\", \"Iron Chancellor (disambiguation)\", \"Otto van Bismark\", \"Otto Von Bismarck\", \"Prince Otto Eduard Leopold von Bismarck\", \"Otto von Bismark\", \"Otto von bismarck\", \"Accident Insurance Bill of 1884\", \"Otto vanBismark\", \"Otto Eduard Leopold, Furst von Bismarck\", \"Otto von Blotto\", \"Bismarckian\", \"Otto F\\u00fcrst von Bismarck\", \"Otto van Bismarck\", \"Otto Eduard Leopold Bismarck\", \"Otto Von Bismark\", \"Otto Fuerst von Bismarck\", \"Otto Eduard Leopold von Bismarck\", \"Economy of Germany under Bismarck\", \"Otto Eduard Leopold von Bismarck, Count of Bismarck-Sch\\u00f6nhausen, Duke of Lauenburg, Prince of Bismarck\", \"Otto Eduard Leopold, Fuerst von Bismarck\", \"Count Otto von Bismarck\", \"Health Insurance Bill of 1883\", \"Iron Chancellor\", \"Otto Furst von Bismarck\", \"Otto Bismarck\", \"Prince Bismarck\", \"Kaizer Bismark\", \"Otto Eduard Leopold Von, Prince Bismarck\", \"Kaiser Bismark\", \"Otto of Bismarck\", \"Old Age and Disability Insurance Bill of 1889\", \"Otto Eduard Leopold von Bismarck, Prince Bismarck\", \"Von Bismarck\", \"Prince Otto Edward Leopold von Bismarck\", \"Otto Eduard Leopold, F\\u00fcrst von Bismarck\", \"The Iron Chancellor\", \"Otto von Bismarck\", \"Otto Van Bismarck\", \"Von bismark\"]", "[\"Letter to Brezhnev\", \"Letter To Brezhnev\"]", "[\"Mount Vernon (plantation)\", \"Mt Vernon\", \"Historic Mount Vernon\", \"George Washington's House\", \"Mount Vernon Estate and Gardens\", \"Mt. Vernon\", \"Mount Vernon Plantation\", \"Mt vernon\", \"Mount Vernon\"]", "[\"NATIONAL LOTTERY DRAW\"]", "[\"Eldrick Tont Woods\", \"TigerWoods.com\", \"Tiger woods\", \"Al Ruwaya\", \"Cablinasian\", \"Tiger Woods Mistress\", \"Cheetah Woods\", \"Eldrick T. %22Tiger%22 Woods\", \"Jamie Jungers\", \"Tigerwoods.com\", \"Tiger Woods\", \"Mindy Lawton\", \"Eldrick Woods\", \"How I Play Golf\", \"Tigre Woods\", \"T woods\", \"Eldrick\", \"Woods, Tiger\", \"Eldrick Tont %22Tiger%22 Woods\", \"Jaimee Grubbs\", \"Eldrick %22Tiger%22 Woods\", \"Cablin Asian\", \"Tont\", \"Tiger Wood\"]", "[\"Carthaginian general Hannibal\", \"Hannibal (Barcid)\", \"Hannibal the Great\", \"Conquests of Hannibal\", \"Conquests of hannibal\", \"Hanibal\", \"Hannibal\", \"Hanniball\", \"Hannibal Barca\", \"Hannibal of Carthage\"]", "[\"Fruiting\", \"Friut\", \"Fruiting Shrubs\", \"Prutas\", \"Bacca\", \"Nutritious fruits\", \"Simple fruit\", \"Culture of fruits\", \"Fruits\", \"Fleshy fruit\", \"Seed pod\", \"Pod types\", \"Fruit\", \"Fruity\"]", "[\"Testical cyst\", \"Testis\", \"Testicles\", \"Testes\", \"Balls (slang)\", \"Testicular size\", \"Testicals\", \"Testicular hormones\", \"Testicular disorder\", \"Testicle size\", \"Low hangers\", \"Testical\", \"Testicular\", \"Testicular diseases\", \"Teste\", \"Testicle\", \"Orchitic\"]", "[\"Steel\", \"Steel workers\", \"Steel plate\", \"Steel truss\", \"Steelworker\", \"Steel (alloy)\", \"Steel industry\", \"Steel (metal)\", \"Steels\", \"Titanic steel\", \"Steelworkers\", \"Steel in Africa\", \"Steel sheeting\", \"Crude steel\", \"Steel worker\", \"Unwrapped steel\", \"Long steel products\", \"Steel Construction\", \"Steel manufacture\"]", "[\"State of Wyoming\", \"Wyoming state symbols\", \"Wyoming (state)\", \"Wyoming\", \"Cowboy State\", \"Geography of Wyoming\", \"Education in Wyoming\", \"Transport in Wyoming\", \"Forty-Fourth State\", \"Law and government of Wyoming\", \"Constitution of the State of Wyoming\", \"Symbols of the State of Wyoming\", \"Wyoming metropolitan areas\", \"Wyoming economy\", \"Constitution of Wyoming\", \"Demographics of Wyoming\", \"Big Wonderful Wyoming\", \"Wyoming counties\", \"Sports in Wyoming\", \"Equality State\", \"Wyoming state nickname\", \"The Equality State\", \"WYOMING\", \"Religion in Wyoming\", \"44th State\", \"Wyomingite\", \"US-WY\", \"Wioming\", \"Wyoming State Constitution\", \"Economy of Wyoming\", \"Wyoming factsheet\", \"Transportation in Wyoming\", \"Government of Wyoming\", \"The Cowboy State\", \"Politics of Wyoming\", \"Wyomingites\", \"Wyoming (U.S. state)\", \"Wyoming, United States\", \"Forty-fourth State\", \"Wyo.\", \"Climate of Wyoming\"]", "[\"Argentina, Brazil\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Hms belfast\", \"HMS Belfast (C35)\", \"HMS Belfast\", \"H.M.S. Belfast\"]", "[\"Gabrielle Cilmi\", \"Gabriella Chillme\", \"Gabrielle cilmi\", \"Gabriella Climi\", \"Gabriella Chilmi\", \"Gabriella Chill Me\", \"Gabriella Cilmi\", \"Cilmi\", \"Gabriella Cilme\"]", "[\"Nigel Faraje\", \"NIGEL FARAGE\", \"Nigel farage\", \"Nigel Paul Farage\", \"Faragista\", \"2010 UKIP PZL-104 Wilga crash\", \"Nigel Farage\", \"Nigel Farrage\", \"Farage\"]", "[\"The cuckoo\", \"CUCKOO\", \"Kukushka\", \"The Cuckoo (disambiguation)\", \"Cuckoo (movie)\", \"The Cuckoo\"]", "[\"Count von Bismarck-Schoenausen\", \"Iron Chancellor (disambiguation)\", \"Otto van Bismark\", \"Otto Von Bismarck\", \"Prince Otto Eduard Leopold von Bismarck\", \"Otto von Bismark\", \"Otto von bismarck\", \"Accident Insurance Bill of 1884\", \"Otto vanBismark\", \"Otto Eduard Leopold, Furst von Bismarck\", \"Otto von Blotto\", \"Bismarckian\", \"Otto F\\u00fcrst von Bismarck\", \"Otto van Bismarck\", \"Otto Eduard Leopold Bismarck\", \"Otto Von Bismark\", \"Otto Fuerst von Bismarck\", \"Otto Eduard Leopold von Bismarck\", \"Economy of Germany under Bismarck\", \"Otto Eduard Leopold von Bismarck, Count of Bismarck-Sch\\u00f6nhausen, Duke of Lauenburg, Prince of Bismarck\", \"Otto Eduard Leopold, Fuerst von Bismarck\", \"Count Otto von Bismarck\", \"Health Insurance Bill of 1883\", \"Iron Chancellor\", \"Otto Furst von Bismarck\", \"Otto Bismarck\", \"Prince Bismarck\", \"Kaizer Bismark\", \"Otto Eduard Leopold Von, Prince Bismarck\", \"Kaiser Bismark\", \"Otto of Bismarck\", \"Old Age and Disability Insurance Bill of 1889\", \"Otto Eduard Leopold von Bismarck, Prince Bismarck\", \"Von Bismarck\", \"Prince Otto Edward Leopold von Bismarck\", \"Otto Eduard Leopold, F\\u00fcrst von Bismarck\", \"The Iron Chancellor\", \"Otto von Bismarck\", \"Otto Van Bismarck\", \"Von bismark\"]", "[\"Letter to Brezhnev\", \"Letter To Brezhnev\"]", "[\"Mount Vernon (plantation)\", \"Mt Vernon\", \"Historic Mount Vernon\", \"George Washington's House\", \"Mount Vernon Estate and Gardens\", \"Mt. Vernon\", \"Mount Vernon Plantation\", \"Mt vernon\", \"Mount Vernon\"]", "[\"NATIONAL LOTTERY DRAW\"]", "[\"Eldrick Tont Woods\", \"TigerWoods.com\", \"Tiger woods\", \"Al Ruwaya\", \"Cablinasian\", \"Tiger Woods Mistress\", \"Cheetah Woods\", \"Eldrick T. %22Tiger%22 Woods\", \"Jamie Jungers\", \"Tigerwoods.com\", \"Tiger Woods\", \"Mindy Lawton\", \"Eldrick Woods\", \"How I Play Golf\", \"Tigre Woods\", \"T woods\", \"Eldrick\", \"Woods, Tiger\", \"Eldrick Tont %22Tiger%22 Woods\", \"Jaimee Grubbs\", \"Eldrick %22Tiger%22 Woods\", \"Cablin Asian\", \"Tont\", \"Tiger Wood\"]", "[\"Carthaginian general Hannibal\", \"Hannibal (Barcid)\", \"Hannibal the Great\", \"Conquests of Hannibal\", \"Conquests of hannibal\", \"Hanibal\", \"Hannibal\", \"Hanniball\", \"Hannibal Barca\", \"Hannibal of Carthage\"]", "[\"Fruiting\", \"Friut\", \"Fruiting Shrubs\", \"Prutas\", \"Bacca\", \"Nutritious fruits\", \"Simple fruit\", \"Culture of fruits\", \"Fruits\", \"Fleshy fruit\", \"Seed pod\", \"Pod types\", \"Fruit\", \"Fruity\"]", "[\"Testical cyst\", \"Testis\", \"Testicles\", \"Testes\", \"Balls (slang)\", \"Testicular size\", \"Testicals\", \"Testicular hormones\", \"Testicular disorder\", \"Testicle size\", \"Low hangers\", \"Testical\", \"Testicular\", \"Testicular diseases\", \"Teste\", \"Testicle\", \"Orchitic\"]", "[\"Steel\", \"Steel workers\", \"Steel plate\", \"Steel truss\", \"Steelworker\", \"Steel (alloy)\", \"Steel industry\", \"Steel (metal)\", \"Steels\", \"Titanic steel\", \"Steelworkers\", \"Steel in Africa\", \"Steel sheeting\", \"Crude steel\", \"Steel worker\", \"Unwrapped steel\", \"Long steel products\", \"Steel Construction\", \"Steel manufacture\"]", "[\"State of Wyoming\", \"Wyoming state symbols\", \"Wyoming (state)\", \"Wyoming\", \"Cowboy State\", \"Geography of Wyoming\", \"Education in Wyoming\", \"Transport in Wyoming\", \"Forty-Fourth State\", \"Law and government of Wyoming\", \"Constitution of the State of Wyoming\", \"Symbols of the State of Wyoming\", \"Wyoming metropolitan areas\", \"Wyoming economy\", \"Constitution of Wyoming\", \"Demographics of Wyoming\", \"Big Wonderful Wyoming\", \"Wyoming counties\", \"Sports in Wyoming\", \"Equality State\", \"Wyoming state nickname\", \"The Equality State\", \"WYOMING\", \"Religion in Wyoming\", \"44th State\", \"Wyomingite\", \"US-WY\", \"Wioming\", \"Wyoming State Constitution\", \"Economy of Wyoming\", \"Wyoming factsheet\", \"Transportation in Wyoming\", \"Government of Wyoming\", \"The Cowboy State\", \"Politics of Wyoming\", \"Wyomingites\", \"Wyoming (U.S. state)\", \"Wyoming, United States\", \"Forty-fourth State\", \"Wyo.\", \"Climate of Wyoming\"]", "[\"Argentina, Brazil\"]" ]
[ "Which warship is permanently moored opposite the Tower of London", "Who had a summer hit in 2008 with Sweet About Me?", "What is the name of the leader of the British UKIP Party?", "\"About which bird did Wordsworth write \"\"Is it a bird, or but a wandering voice?\"", "What was the name of the German Chancellor, the primary force behind the unification of Germany 1871, who also had a famous battleship named after him?", "Which 1985 romantic comedy starring Alexandra Pigg and Margi Clarke was set in Liverpool?", "What was the name of George Washington's house where he is buried", "The first what in the UK took place on the night of Nov. 19th, 1994?", "What is golfer Tiger Woods first name?", "What was the title of the 2001 film that was a sequel to The Silence of the Lambs?", "What is the Beverley Hills Diet developed by Judy Mazel based on", "What is removed during an operation called an orchidectomy", "The Scottish-American industrialist and philanthropist Andrew Carnegie (1835-1919) pioneered and made his vast fortune in which industry in late 1800s USA?", "Which US State has the smallest population?", "For a point each, name the 2 countries surrounding the Oriental Republic of Uruguay." ]
15
[ 124560, 124561, 124562, 124563, 124564, 124565, 124566, 124567, 124568, 124569, 124570, 124571, 124572, 124573, 124574 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: Which food dish is named after one of Napoleons famous victories?\nQuestion 2: Which colour features in the title of number one hits by Tom Jones and Shakin Stevens?\nQuestion 3: Which country does footballer Michael Essien represent at international level?\nQuestion 4: Which Roman orator was slain by Mark Anthony's soldiers in 43 B.C.?\nQuestion 5: In which year did the following happen - Microsoft was registered as a trade name, Brotherhood of Man won Eurovision and Mao Zedong died?\nQuestion 6: What name is given to the long tongue or feeding tube of a butterfly?\nQuestion 7: Which chemical element has the symbol Fe?\nQuestion 8: In 1961 Marilyn Monroe and Clarke Gable both made their final movie. What was the name of the film?\nQuestion 9: How was the London hospital 'St Mary Bethlehem' better known?\nQuestion 10: What name is given to the particle in an atom which carries a negative charge?\nQuestion 11: To which family do Max and his daughters Lauren, and Abi belong in EastEnders?\nQuestion 12: Anthony Trollope's character, Plantagenet Palliser, sits in the House of Lords under what title?\nQuestion 13: 'Olfactophobia' is the morbid fear of what?\nQuestion 14: In the world of antiques what is majolica?\nQuestion 15: Who was the most notorious member of the Ba'ath Party?", "role": "user" } ]
["[\"Chicken Marengo\"]", "[\"Greenishly\", \"Avacado (color)\", \"Green (color)\", \"Rgb(0, 255, 0)\", \"Greenishness\", \"The colour green\", \"Greenest\", \"List of terms associated with the color green\", \"The color green\", \"Green\", \"Pastel green\", \"(0, 255, 0)\", \"Green (colour)\", \"Greenness\"]", "[\"Ghana\", \"GHANA\", \"Ghanian\", \"Ghanaian Republic\", \"Etymology of Ghana\", \"Ghanan\", \"The Democradic Republic of Ghana\", \"The country Ghana\", \"Black Star of Africa\", \"Republic of Ghana\", \"Ghana homeland\", \"State of Ghana\", \"ISO 3166-1:GH\", \"Republic Of Ghana\", \"Ghanaian\", \"The Republic Of Ghana\", \"Republic Ghana\"]", "[\"Ciceronian\", \"Marcus Tullius Cicero\", \"Cicero, Marcus Tullius\", \"Cicero and the Roman Republic\", \"M. Tullius Cicero\", \"Cicero\", \"Tullian\", \"CICERO\", \"Kickero\", \"Cicero (Marcus Tullius)\", \"Tullius Cicero\", \"Sissero\", \"Marcus Cicero\", \"Cisero\", \"Roman orator Cicero\", \"Cissero\", \"Ciciero\"]", "[\"1976\", \"one thousand, nine hundred and seventy-six\"]", "[\"Proboscis (Lepidoptera)\", \"Proboscis\", \"Probiscis\", \"Probosces\"]", "[\"Iron (element)\", \"Iron rope\", \"Iron truss\", \"Ed-In-Sol\", \"Reduced iron\", \"Feostat\", \"Feratab\", \"Iron production\", \"Nephro-Fer\", \"Slow Fe\", \"Iron Essay\", \"Element 26\", \"Extraction of iron\", \"Mol-Iron\", \"Feronate\", \"Ferro-Time\", \"Ferric compounds\", \"Ferrousal\", \"Ferretts\", \"Fer-In-Sol\", \"Ferrum (element)\", \"Ferro-Caps\", \"Iron\", \"7439-89-6\", \"Iorn\", \"Siderol\", \"Iron compounds\", \"Vitedyn-Slo\", \"Fe-40\", \"Symbol of iron\", \"Yieronia\", \"Ferryl\", \"Ferrous compounds\"]", "[\"Misfits (disambiguation)\", \"The Misfits\", \"Misfits (album)\", \"Misfits\"]", "[\"Bedlam (novel)\", \"Bedlam (TV Series)\", \"Bedlam (disambiguation)\", \"Bedlam\", \"Bedlam game\", \"Bedlam (TV series)\"]", "[\"Mass of an electron\", \"Electron lepton\", \"Electron theory\", \"Beta minus particle\", \"Mass of the electron\", \"Electron\", \"Negative electron\", \"Antipositron\", \"Electron Mass\", \"Electrons\", \"Negaton\", \"Electron movement\", \"AN ELECTRON\", \"Mass of electron\"]", "[\"The Branning\", \"Branning\"]", "[\"Plantagenet Palliser\", \"List of minor Palliser characters\", \"Palliser novels\", \"The Palliser Novels\", \"Pallisers\", \"Duke of Omnium\", \"Lord Drummond (Pallisers)\", \"List of minor characters from the Palliser novels\"]", "[\"Smell (disambiguation)\", \"Smell\", \"SMELLS\", \"Smells\"]", "[\"(GLAZED) POTTERY\"]", "[\"Sadaam\", \"Saddam Hussein Al-Takriti\", \"Saddam Hosseyn\", \"Sodamn Hussein\", \"HVD-1\", \"Sadamm Hussain\", \"\\u0635\\u062f\\u0627\\u0645 \\u062d\\u0633\\u064a\\u0646 \\u0639\\u0628\\u062f \\u0627\\u0644\\u0645\\u062c\\u064a\\u062f \\u0627\\u0644\\u062a\\u0643\\u0631\\u064a\\u062a\\u064a\", \"Saddam Hussayn\", \"Sodom Hussein\", \"Saddam Husayn Al Tikriti\", \"Saddam Hussein Al Majid Al Tikriti\", \"Hussein, Saddam\", \"Sadam Hussein\", \"Saddam Husein\", \"The butcher of baghdad\", \"Hussein 'Abd al-Majid\", \"Saddam Hussein Al-Tikriti\", \"Saddam Husayn al Tikriti\", \"Hussein 'Abid al-Majid\", \"Saddam Huessain\", \"Saddam Husayn al-Tikriti\", \"Saddam Huisein\", \"Sodam Hussein\", \"Subha Tulfah al-Mussallat\", \"Saddam Huseyin\", \"Saddam\", \"Saadam Hussein\", \"\\u1e62add\\u0101m \\u1e24usayn \\u02bfAbd al-Maj\\u012bd al-Tikr\\u012bt\\u012b\", \"Sadamm\", \"Saddam Hueseyin\", \"Saddam Husayn\", \"Saddam Hussein al-Tikrit\", \"Saddam heusein\", \"Saddam Hussein Abd al-Majid al-Tikriti\", \"Hussein Saddam\", \"\\u0635\\u062f\\u0627\\u0645 \\u062d\\u0633\\u064a\\u0646 \\u0627\\u0644\\u062a\\u0643\\u0631\\u064a\\u062a\\u064a\", \"\\u1e62add\\u0101m \\u1e24usayn Abd al-Ma\\u0177\\u012bd al-Takr\\u012bt\\u012b\", \"Saddam Husayn Al-Tikriti\", \"Saddam hussein\", \"Sadam Husein\", \"Hala Hussein\", \"Saddam Hossain\", \"Sadd\\u0101m hussayn\", \"Saddam Hussein al-Majid al-Tikriti\", \"Sedam Husey\\u00een\", \"Sadamm Husien\", \"Sudam Hussein\", \"Suddom hussain\", \"Sedam Huseyin\", \"Saddam Husayn Abd al-Mayid al-Takriti\", \"Butcher of Baghdad\", \"Sadam Hussain\", \"Saddam Hussien\", \"Saddam H\\u00fcseyin\", \"Saddam Hussein\", \"Butcher of baghdad\", \"High Value Detainee One\", \"Saddam Hussein Takriti\", \"Sadd\\u0101m Hussayn\", \"Saddam Houssein\", \"Saddam Tiqriti\", \"Saddam Husseins\", \"Sadaam Hussein\", \"Saddam Hossein\", \"Saddam huissen\", \"Images of Saddam Hussein\", \"Saddam al-Tikriti\", \"\\u1e62add\\u0101m \\u1e24usayn\", \"Saddam Hussain\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"Chicken Marengo\"]", "[\"Greenishly\", \"Avacado (color)\", \"Green (color)\", \"Rgb(0, 255, 0)\", \"Greenishness\", \"The colour green\", \"Greenest\", \"List of terms associated with the color green\", \"The color green\", \"Green\", \"Pastel green\", \"(0, 255, 0)\", \"Green (colour)\", \"Greenness\"]", "[\"Ghana\", \"GHANA\", \"Ghanian\", \"Ghanaian Republic\", \"Etymology of Ghana\", \"Ghanan\", \"The Democradic Republic of Ghana\", \"The country Ghana\", \"Black Star of Africa\", \"Republic of Ghana\", \"Ghana homeland\", \"State of Ghana\", \"ISO 3166-1:GH\", \"Republic Of Ghana\", \"Ghanaian\", \"The Republic Of Ghana\", \"Republic Ghana\"]", "[\"Ciceronian\", \"Marcus Tullius Cicero\", \"Cicero, Marcus Tullius\", \"Cicero and the Roman Republic\", \"M. Tullius Cicero\", \"Cicero\", \"Tullian\", \"CICERO\", \"Kickero\", \"Cicero (Marcus Tullius)\", \"Tullius Cicero\", \"Sissero\", \"Marcus Cicero\", \"Cisero\", \"Roman orator Cicero\", \"Cissero\", \"Ciciero\"]", "[\"1976\", \"one thousand, nine hundred and seventy-six\"]", "[\"Proboscis (Lepidoptera)\", \"Proboscis\", \"Probiscis\", \"Probosces\"]", "[\"Iron (element)\", \"Iron rope\", \"Iron truss\", \"Ed-In-Sol\", \"Reduced iron\", \"Feostat\", \"Feratab\", \"Iron production\", \"Nephro-Fer\", \"Slow Fe\", \"Iron Essay\", \"Element 26\", \"Extraction of iron\", \"Mol-Iron\", \"Feronate\", \"Ferro-Time\", \"Ferric compounds\", \"Ferrousal\", \"Ferretts\", \"Fer-In-Sol\", \"Ferrum (element)\", \"Ferro-Caps\", \"Iron\", \"7439-89-6\", \"Iorn\", \"Siderol\", \"Iron compounds\", \"Vitedyn-Slo\", \"Fe-40\", \"Symbol of iron\", \"Yieronia\", \"Ferryl\", \"Ferrous compounds\"]", "[\"Misfits (disambiguation)\", \"The Misfits\", \"Misfits (album)\", \"Misfits\"]", "[\"Bedlam (novel)\", \"Bedlam (TV Series)\", \"Bedlam (disambiguation)\", \"Bedlam\", \"Bedlam game\", \"Bedlam (TV series)\"]", "[\"Mass of an electron\", \"Electron lepton\", \"Electron theory\", \"Beta minus particle\", \"Mass of the electron\", \"Electron\", \"Negative electron\", \"Antipositron\", \"Electron Mass\", \"Electrons\", \"Negaton\", \"Electron movement\", \"AN ELECTRON\", \"Mass of electron\"]", "[\"The Branning\", \"Branning\"]", "[\"Plantagenet Palliser\", \"List of minor Palliser characters\", \"Palliser novels\", \"The Palliser Novels\", \"Pallisers\", \"Duke of Omnium\", \"Lord Drummond (Pallisers)\", \"List of minor characters from the Palliser novels\"]", "[\"Smell (disambiguation)\", \"Smell\", \"SMELLS\", \"Smells\"]", "[\"(GLAZED) POTTERY\"]", "[\"Sadaam\", \"Saddam Hussein Al-Takriti\", \"Saddam Hosseyn\", \"Sodamn Hussein\", \"HVD-1\", \"Sadamm Hussain\", \"\\u0635\\u062f\\u0627\\u0645 \\u062d\\u0633\\u064a\\u0646 \\u0639\\u0628\\u062f \\u0627\\u0644\\u0645\\u062c\\u064a\\u062f \\u0627\\u0644\\u062a\\u0643\\u0631\\u064a\\u062a\\u064a\", \"Saddam Hussayn\", \"Sodom Hussein\", \"Saddam Husayn Al Tikriti\", \"Saddam Hussein Al Majid Al Tikriti\", \"Hussein, Saddam\", \"Sadam Hussein\", \"Saddam Husein\", \"The butcher of baghdad\", \"Hussein 'Abd al-Majid\", \"Saddam Hussein Al-Tikriti\", \"Saddam Husayn al Tikriti\", \"Hussein 'Abid al-Majid\", \"Saddam Huessain\", \"Saddam Husayn al-Tikriti\", \"Saddam Huisein\", \"Sodam Hussein\", \"Subha Tulfah al-Mussallat\", \"Saddam Huseyin\", \"Saddam\", \"Saadam Hussein\", \"\\u1e62add\\u0101m \\u1e24usayn \\u02bfAbd al-Maj\\u012bd al-Tikr\\u012bt\\u012b\", \"Sadamm\", \"Saddam Hueseyin\", \"Saddam Husayn\", \"Saddam Hussein al-Tikrit\", \"Saddam heusein\", \"Saddam Hussein Abd al-Majid al-Tikriti\", \"Hussein Saddam\", \"\\u0635\\u062f\\u0627\\u0645 \\u062d\\u0633\\u064a\\u0646 \\u0627\\u0644\\u062a\\u0643\\u0631\\u064a\\u062a\\u064a\", \"\\u1e62add\\u0101m \\u1e24usayn Abd al-Ma\\u0177\\u012bd al-Takr\\u012bt\\u012b\", \"Saddam Husayn Al-Tikriti\", \"Saddam hussein\", \"Sadam Husein\", \"Hala Hussein\", \"Saddam Hossain\", \"Sadd\\u0101m hussayn\", \"Saddam Hussein al-Majid al-Tikriti\", \"Sedam Husey\\u00een\", \"Sadamm Husien\", \"Sudam Hussein\", \"Suddom hussain\", \"Sedam Huseyin\", \"Saddam Husayn Abd al-Mayid al-Takriti\", \"Butcher of Baghdad\", \"Sadam Hussain\", \"Saddam Hussien\", \"Saddam H\\u00fcseyin\", \"Saddam Hussein\", \"Butcher of baghdad\", \"High Value Detainee One\", \"Saddam Hussein Takriti\", \"Sadd\\u0101m Hussayn\", \"Saddam Houssein\", \"Saddam Tiqriti\", \"Saddam Husseins\", \"Sadaam Hussein\", \"Saddam Hossein\", \"Saddam huissen\", \"Images of Saddam Hussein\", \"Saddam al-Tikriti\", \"\\u1e62add\\u0101m \\u1e24usayn\", \"Saddam Hussain\"]" ]
[ "Which food dish is named after one of Napoleons famous victories?", "Which colour features in the title of number one hits by Tom Jones and Shakin Stevens?", "Which country does footballer Michael Essien represent at international level?", "Which Roman orator was slain by Mark Anthony's soldiers in 43 B.C.?", "In which year did the following happen - Microsoft was registered as a trade name, Brotherhood of Man won Eurovision and Mao Zedong died?", "What name is given to the long tongue or feeding tube of a butterfly?", "Which chemical element has the symbol Fe?", "In 1961 Marilyn Monroe and Clarke Gable both made their final movie. What was the name of the film?", "How was the London hospital 'St Mary Bethlehem' better known?", "What name is given to the particle in an atom which carries a negative charge?", "To which family do Max and his daughters Lauren, and Abi belong in EastEnders?", "Anthony Trollope's character, Plantagenet Palliser, sits in the House of Lords under what title?", "'Olfactophobia' is the morbid fear of what?", "In the world of antiques what is majolica?", "Who was the most notorious member of the Ba'ath Party?" ]
15
[ 62175, 62176, 62177, 62178, 62179, 62180, 62181, 62182, 62183, 62184, 62185, 62186, 62187, 62188, 62189 ]
[ { "content": "You are a research assistant that answers multiple questions through iterative reasoning and research.\n\nPROCESS:\n- Use <think></think> tags to show your reasoning at any point\n- Use <search>query</search> tags when you need information\n- You can alternate between thinking and searching multiple times\n- Answer each question sequentially, one at a time\n\nSEARCH RESULTS:\n- Results appear as: <snippet id=UNIQUE_ID>content</snippet>\n\nMULTI-QUESTION ANSWERING FORMAT:\n- You will be given 15 questions to answer\n- Answer each question completely in sequence (1 through 15)\n- For the first question: Use <answer1>\\boxed{{your_answer}}</answer1>\n- For question 2: Use <answer2>\\boxed{{your_answer}}</answer2>\n- For question 3: Use <answer3>\\boxed{{your_answer}}</answer3>\n- For question 4: Use <answer4>\\boxed{{your_answer}}</answer4>\n- For question 5: Use <answer5>\\boxed{{your_answer}}</answer5>\n- For question 6: Use <answer6>\\boxed{{your_answer}}</answer6>\n- For question 7: Use <answer7>\\boxed{{your_answer}}</answer7>\n- For question 8: Use <answer8>\\boxed{{your_answer}}</answer8>\n- For question 9: Use <answer9>\\boxed{{your_answer}}</answer9>\n- For question 10: Use <answer10>\\boxed{{your_answer}}</answer10>\n- For question 11: Use <answer11>\\boxed{{your_answer}}</answer11>\n- For question 12: Use <answer12>\\boxed{{your_answer}}</answer12>\n- For question 13: Use <answer13>\\boxed{{your_answer}}</answer13>\n- For question 14: Use <answer14>\\boxed{{your_answer}}</answer14>\n- For the final question: Use <answer15>\\boxed{{your_answer}}</answer15>\n- Each answer should be concise and placed within the \\boxed{} format\n- All 15 answers must be correct for the response to be considered successful\n\nWORKFLOW EXAMPLE:\n<think>I need to research question 1</think>\n<search>relevant query for question 1</search>\n[results provided]\n<answer1>\\boxed{{example_answer_1}}</answer1>\n\n<think>I need to research question 2</think>\n<search>relevant query for question 2</search>\n[results provided]\n<answer2>\\boxed{{example_answer_2}}</answer2>\n\n<think>I need to research question 3</think>\n<search>relevant query for question 3</search>\n[results provided]\n<answer3>\\boxed{{example_answer_3}}</answer3>\n\n<think>I need to research question 4</think>\n<search>relevant query for question 4</search>\n[results provided]\n<answer4>\\boxed{{example_answer_4}}</answer4>\n\n<think>I need to research question 5</think>\n<search>relevant query for question 5</search>\n[results provided]\n<answer5>\\boxed{{example_answer_5}}</answer5>\n\n<think>I need to research question 6</think>\n<search>relevant query for question 6</search>\n[results provided]\n<answer6>\\boxed{{example_answer_6}}</answer6>\n\n<think>I need to research question 7</think>\n<search>relevant query for question 7</search>\n[results provided]\n<answer7>\\boxed{{example_answer_7}}</answer7>\n\n<think>I need to research question 8</think>\n<search>relevant query for question 8</search>\n[results provided]\n<answer8>\\boxed{{example_answer_8}}</answer8>\n\n<think>I need to research question 9</think>\n<search>relevant query for question 9</search>\n[results provided]\n<answer9>\\boxed{{example_answer_9}}</answer9>\n\n<think>I need to research question 10</think>\n<search>relevant query for question 10</search>\n[results provided]\n<answer10>\\boxed{{example_answer_10}}</answer10>\n\n<think>I need to research question 11</think>\n<search>relevant query for question 11</search>\n[results provided]\n<answer11>\\boxed{{example_answer_11}}</answer11>\n\n<think>I need to research question 12</think>\n<search>relevant query for question 12</search>\n[results provided]\n<answer12>\\boxed{{example_answer_12}}</answer12>\n\n<think>I need to research question 13</think>\n<search>relevant query for question 13</search>\n[results provided]\n<answer13>\\boxed{{example_answer_13}}</answer13>\n\n<think>I need to research question 14</think>\n<search>relevant query for question 14</search>\n[results provided]\n<answer14>\\boxed{{example_answer_14}}</answer14>\n\n<think>I need to research question 15</think>\n<search>relevant query for question 15</search>\n[results provided]\n<answer15>\\boxed{{example_answer_15}}</answer15>\n\nREQUIREMENTS:\n- Answer each question in sequence (Question 1, then Question 2, ..., then Question 15)\n- Use <answer1>\\boxed{{answer}}</answer1> for question 1\n- Use <answer2>\\boxed{{answer}}</answer2> for question 2\n- Use <answer3>\\boxed{{answer}}</answer3> for question 3\n- Use <answer4>\\boxed{{answer}}</answer4> for question 4\n- Use <answer5>\\boxed{{answer}}</answer5> for question 5\n- Use <answer6>\\boxed{{answer}}</answer6> for question 6\n- Use <answer7>\\boxed{{answer}}</answer7> for question 7\n- Use <answer8>\\boxed{{answer}}</answer8> for question 8\n- Use <answer9>\\boxed{{answer}}</answer9> for question 9\n- Use <answer10>\\boxed{{answer}}</answer10> for question 10\n- Use <answer11>\\boxed{{answer}}</answer11> for question 11\n- Use <answer12>\\boxed{{answer}}</answer12> for question 12\n- Use <answer13>\\boxed{{answer}}</answer13> for question 13\n- Use <answer14>\\boxed{{answer}}</answer14> for question 14\n- Use <answer15>\\boxed{{answer}}</answer15> for question 15\n- Think and search as needed for each question before providing its answer\n- Ensure all answers are complete and correct\n\nQuestion 1: In which year was the Butler Education Act passed ?\nQuestion 2: What is the capital city of the American state of Wyoming?\nQuestion 3: What is the title of Geri Halliwell's autobiography, published in 1999?\nQuestion 4: Jeff Bridges won this years 'Oscar' for Best Actor for his role as 'Otis Blake', in which film?\nQuestion 5: What is the palace and fortress complex of the Moorish rulers of Granada in southern Spain constructed during the mid 14th century that occupies a hilly terrace on the southeastern border of the city of Granada, Spain?\nQuestion 6: What 3-word Latin phrase means an indispensable condition or action?\nQuestion 7: Which soccer team was disbanded in 2008 for financial reasons after only one season in the Scottish Premier League?\nQuestion 8: Which principality joined the United Nations in 1993?\nQuestion 9: Which politician married barrister Justine Thornton in May 2011 in Nottingham?\nQuestion 10: On Feb 21, 1953 British scientist Francis Crick and American James D. Watson unlocked the structure of what?\nQuestion 11: Which of his marshals did Napoleon call 'the bravest of the brave'?\nQuestion 12: Which US President had a new one-lane bowling alley installed at The Whitehouse in the 1960’s?\nQuestion 13: According to the Book of Revelations, which city in modern-day Israel will be the site of 'Armageddon'?\nQuestion 14: Who was Emperor of Rome when Boudicca, queen of the Iceni, led her famous revolt?\nQuestion 15: What will be made at the Tesla Gigafactory?", "role": "user" } ]
["[\"one thousand, nine hundred and forty-four\", \"1944\"]", "[\"Little red talker\", \"Notameohmesehese\", \"Northern Eaters\", \"Cheyenne Nation\", \"Tsehestano\", \"Ohm\\u00e9s\\u00eahese\", \"Cheyenne\", \"S\\u00f3taae\", \"Sotaae\", \"Sahiyena\", \"Masikota\", \"Little red-talker\", \"S\\u00f3'taa'e\", \"So'taa'e\", \"Suhtai\", \"Tse tsehestahese\", \"Little red-talkers\", \"CHEYENNE\", \"Little red talkers\", \"Tse-tsehestahese\", \"Cheyenne (people)\", \"Roped People\", \"\\u0160ah\\u00edyena\", \"Notameohm\\u00e9s\\u00eahese\", \"Cheyenne (ethnic group)\", \"He\\u00e9v\\u00e2hetane\", \"Roped Person\", \"Cheyenne people\", \"Ts\\u00e9 ts\\u00eah\\u00e9st\\u00e2hese\", \"Sutai\", \"Like Hearted People\", \"Cheyanne\", \"Northern Eater\", \"Cheyennes\", \"Heevahetane\", \"Tsitsistas\", \"Ohmesehese\", \"Ts\\u00e9-ts\\u00eah\\u00e9st\\u00e2hese\", \"Ts\\u00eah\\u00e9st\\u00e1no\", \"Cheyenne Indians\"]", "[\"If Only (song)\", \"If Only\", \"If only\", \"If Only (disambiguation)\"]", "[\"Crazy Heart (film)\", \"Jack Nation\", \"Crazy Heart\", \"Crazy heart\", \"'CRAZY HEART'\", \"Bad blake\", \"Crazyheart\"]", "[\"Al-\\u0126amr\\u0101\", \"Al Hambra\", \"Red fortress\", \"Alhambra of Granada\", \"Alhambra Palace\", \"Alhambra\", \"Al-Hambra\", \"Calat Alhambra\", \"Alhambra palace\", \"The red fortress\", \"The Alhambra\", \"Qal'at al-Hambra\", \"\\u0627\\u0644\\u062d\\u0645\\u0631\\u0627\\u0621\", \"Allhambra\"]", "[\"Sine Qua Non\", \"Sine qua non (disambiguation)\"]", "[\"Gretna\", \"GRETNA\", \"Gretna (disambiguation)\"]", "[\"Principaut\\u00e9 de Monaco\", \"ISO 3166-1:MC\", \"Princedom of Monaco\", \"Principat de M\\u00f3negue\", \"Extreme points of monaco\", \"Munegu\", \"Geography of monaco\", \"Monaco, Principality and Diocese of\", \"Extreme points of Monaco\", \"Monegasques\", \"Climate of Monaco\", \"Monocco\", \"Sports in Monaco\", \"Religion in Monaco\", \"Subdivisions of Monaco\", \"Monaco/Geography\", \"Europe/Monaco\", \"Geography of Monaco\", \"Culture of Monaco\", \"Protestantism in Monaco\", \"Monaco/Military\", \"Mon\\u00e9gasques\", \"Capital of Monaco\", \"Principaut de Monaco\", \"Administrative divisions (Monaco)\", \"List of cities in Monaco\", \"Monaco\", \"Principatu de M\\u00fanegu\", \"Islam in Monaco\", \"The weather in Monaco\", \"Principality of Monaco\", \"Principato di Monaco\", \"Principality and Diocese of Monaco\", \"Wards of Monaco\", \"Administrative divisions of Monaco\", \"M\\u00f3negue\", \"Quarters of Monaco\", \"Monaco/Transnational issues\", \"MONACO\", \"Monacco\", \"Sport in Monaco\"]", "[\"Red Ed\", \"Tom Baldwin (journalist)\", \"Ed Miliband\", \"Ed miliband\", \"Ed Milliband\", \"Edward Miliband\"]", "[\"D-na\", \"Dna\", \"Dublex DNA\", \"Deoxyribose nucleic acid\", \"Dsdna\", \"Protein-DNA complex\", \"DNAp\", \"Deoxiribose nucleic acid\", \"DNA\", \"Doexyribonucleic acid\", \"DNA strand\", \"Desoxyribonucleic acid\", \"DNA helices\", \"Ssdna\", \"Double-stranded DNA\", \"The blueprint of life\", \"Accessory genome\", \"Deoxyribonucleic\", \"Phosphodiester backbone\", \"Dioxyribonucleic Acid\", \"Structure of DNA\", \"Deoxiribonewcleic\", \"Single-stranded DNA\", \"History of science and technology/Discovery of DNA\", \"Deoxyribonucleic Acid\", \"DNA world\", \"D.n.a.\", \"SsDNA\", \"Deoxyribonucleic acids\", \"Deoxyribose Nucleic Acid\", \"DNA molecule\", \"Deoxyribonucleic Acids\", \"Deoxyribonucleic acid\", \"Deroxiribonueclec acid\", \"Sense and Antisense\", \"Dehydroxyribonucleic acid\", \"Sense and antisense\", \"DsDNA\", \"SDNA\", \"Deoxyribionucleic acid\", \"DNA gene\", \"Dna.\"]", "[\"Ney flute\", \"Karghy tuiduk\", \"Ney (musique)\", \"Neyzen\", \"Ney\", \"N\\u0101y\"]", "[\"I'm not a crook\", \"Richard nixon\", \"Nixson\", \"Richard Milhouse Nixon\", \"Richard Milhous Nixon\", \"Nixonian\", \"Richard Nixon\", \"Dick Nixon\", \"Nixonite\", \"Nixon, Richard\", \"37th President of the United States\", \"Resignation of Richard Nixon\", \"Richard Nickson\", \"Tricky Dick Nixon\", \"Nixon's\", \"Arthur Burdg Nixon\", \"Richard M. Nixon\", \"Tricky Dick\", \"Arthur Nixon\", \"Nixon\", \"Harold Samuel Nixon\", \"Richard M Nixon\", \"Harold Nixon\", \"Nixon, Richard Milhous\", \"Nixon, Richard M.\", \"Nichard rixon\"]", "[\"MEGIDDO\", \"Mageddo\", \"Megido\", \"Meggido\", \"Megiddo\", \"Megiddo (disambiguation)\", \"Megiddo (album)\"]", "[\"Nero (album)\", \"Nero (disambiguation)\", \"NERO\", \"Nero (comic)\"]", "[\"The Battery (film)\", \"Battery\", \"Battery (disambiguation)\", \"Batteries\", \"The Battery\", \"Batery\"]"]
rl_rag_toy_case_multi_dataset_single_source_tqa
[ "tqa" ]
[ "[\"one thousand, nine hundred and forty-four\", \"1944\"]", "[\"Little red talker\", \"Notameohmesehese\", \"Northern Eaters\", \"Cheyenne Nation\", \"Tsehestano\", \"Ohm\\u00e9s\\u00eahese\", \"Cheyenne\", \"S\\u00f3taae\", \"Sotaae\", \"Sahiyena\", \"Masikota\", \"Little red-talker\", \"S\\u00f3'taa'e\", \"So'taa'e\", \"Suhtai\", \"Tse tsehestahese\", \"Little red-talkers\", \"CHEYENNE\", \"Little red talkers\", \"Tse-tsehestahese\", \"Cheyenne (people)\", \"Roped People\", \"\\u0160ah\\u00edyena\", \"Notameohm\\u00e9s\\u00eahese\", \"Cheyenne (ethnic group)\", \"He\\u00e9v\\u00e2hetane\", \"Roped Person\", \"Cheyenne people\", \"Ts\\u00e9 ts\\u00eah\\u00e9st\\u00e2hese\", \"Sutai\", \"Like Hearted People\", \"Cheyanne\", \"Northern Eater\", \"Cheyennes\", \"Heevahetane\", \"Tsitsistas\", \"Ohmesehese\", \"Ts\\u00e9-ts\\u00eah\\u00e9st\\u00e2hese\", \"Ts\\u00eah\\u00e9st\\u00e1no\", \"Cheyenne Indians\"]", "[\"If Only (song)\", \"If Only\", \"If only\", \"If Only (disambiguation)\"]", "[\"Crazy Heart (film)\", \"Jack Nation\", \"Crazy Heart\", \"Crazy heart\", \"'CRAZY HEART'\", \"Bad blake\", \"Crazyheart\"]", "[\"Al-\\u0126amr\\u0101\", \"Al Hambra\", \"Red fortress\", \"Alhambra of Granada\", \"Alhambra Palace\", \"Alhambra\", \"Al-Hambra\", \"Calat Alhambra\", \"Alhambra palace\", \"The red fortress\", \"The Alhambra\", \"Qal'at al-Hambra\", \"\\u0627\\u0644\\u062d\\u0645\\u0631\\u0627\\u0621\", \"Allhambra\"]", "[\"Sine Qua Non\", \"Sine qua non (disambiguation)\"]", "[\"Gretna\", \"GRETNA\", \"Gretna (disambiguation)\"]", "[\"Principaut\\u00e9 de Monaco\", \"ISO 3166-1:MC\", \"Princedom of Monaco\", \"Principat de M\\u00f3negue\", \"Extreme points of monaco\", \"Munegu\", \"Geography of monaco\", \"Monaco, Principality and Diocese of\", \"Extreme points of Monaco\", \"Monegasques\", \"Climate of Monaco\", \"Monocco\", \"Sports in Monaco\", \"Religion in Monaco\", \"Subdivisions of Monaco\", \"Monaco/Geography\", \"Europe/Monaco\", \"Geography of Monaco\", \"Culture of Monaco\", \"Protestantism in Monaco\", \"Monaco/Military\", \"Mon\\u00e9gasques\", \"Capital of Monaco\", \"Principaut de Monaco\", \"Administrative divisions (Monaco)\", \"List of cities in Monaco\", \"Monaco\", \"Principatu de M\\u00fanegu\", \"Islam in Monaco\", \"The weather in Monaco\", \"Principality of Monaco\", \"Principato di Monaco\", \"Principality and Diocese of Monaco\", \"Wards of Monaco\", \"Administrative divisions of Monaco\", \"M\\u00f3negue\", \"Quarters of Monaco\", \"Monaco/Transnational issues\", \"MONACO\", \"Monacco\", \"Sport in Monaco\"]", "[\"Red Ed\", \"Tom Baldwin (journalist)\", \"Ed Miliband\", \"Ed miliband\", \"Ed Milliband\", \"Edward Miliband\"]", "[\"D-na\", \"Dna\", \"Dublex DNA\", \"Deoxyribose nucleic acid\", \"Dsdna\", \"Protein-DNA complex\", \"DNAp\", \"Deoxiribose nucleic acid\", \"DNA\", \"Doexyribonucleic acid\", \"DNA strand\", \"Desoxyribonucleic acid\", \"DNA helices\", \"Ssdna\", \"Double-stranded DNA\", \"The blueprint of life\", \"Accessory genome\", \"Deoxyribonucleic\", \"Phosphodiester backbone\", \"Dioxyribonucleic Acid\", \"Structure of DNA\", \"Deoxiribonewcleic\", \"Single-stranded DNA\", \"History of science and technology/Discovery of DNA\", \"Deoxyribonucleic Acid\", \"DNA world\", \"D.n.a.\", \"SsDNA\", \"Deoxyribonucleic acids\", \"Deoxyribose Nucleic Acid\", \"DNA molecule\", \"Deoxyribonucleic Acids\", \"Deoxyribonucleic acid\", \"Deroxiribonueclec acid\", \"Sense and Antisense\", \"Dehydroxyribonucleic acid\", \"Sense and antisense\", \"DsDNA\", \"SDNA\", \"Deoxyribionucleic acid\", \"DNA gene\", \"Dna.\"]", "[\"Ney flute\", \"Karghy tuiduk\", \"Ney (musique)\", \"Neyzen\", \"Ney\", \"N\\u0101y\"]", "[\"I'm not a crook\", \"Richard nixon\", \"Nixson\", \"Richard Milhouse Nixon\", \"Richard Milhous Nixon\", \"Nixonian\", \"Richard Nixon\", \"Dick Nixon\", \"Nixonite\", \"Nixon, Richard\", \"37th President of the United States\", \"Resignation of Richard Nixon\", \"Richard Nickson\", \"Tricky Dick Nixon\", \"Nixon's\", \"Arthur Burdg Nixon\", \"Richard M. Nixon\", \"Tricky Dick\", \"Arthur Nixon\", \"Nixon\", \"Harold Samuel Nixon\", \"Richard M Nixon\", \"Harold Nixon\", \"Nixon, Richard Milhous\", \"Nixon, Richard M.\", \"Nichard rixon\"]", "[\"MEGIDDO\", \"Mageddo\", \"Megido\", \"Meggido\", \"Megiddo\", \"Megiddo (disambiguation)\", \"Megiddo (album)\"]", "[\"Nero (album)\", \"Nero (disambiguation)\", \"NERO\", \"Nero (comic)\"]", "[\"The Battery (film)\", \"Battery\", \"Battery (disambiguation)\", \"Batteries\", \"The Battery\", \"Batery\"]" ]
[ "In which year was the Butler Education Act passed ?", "What is the capital city of the American state of Wyoming?", "What is the title of Geri Halliwell's autobiography, published in 1999?", "Jeff Bridges won this years 'Oscar' for Best Actor for his role as 'Otis Blake', in which film?", "What is the palace and fortress complex of the Moorish rulers of Granada in southern Spain constructed during the mid 14th century that occupies a hilly terrace on the southeastern border of the city of Granada, Spain?", "What 3-word Latin phrase means an indispensable condition or action?", "Which soccer team was disbanded in 2008 for financial reasons after only one season in the Scottish Premier League?", "Which principality joined the United Nations in 1993?", "Which politician married barrister Justine Thornton in May 2011 in Nottingham?", "On Feb 21, 1953 British scientist Francis Crick and American James D. Watson unlocked the structure of what?", "Which of his marshals did Napoleon call 'the bravest of the brave'?", "Which US President had a new one-lane bowling alley installed at The Whitehouse in the 1960’s?", "According to the Book of Revelations, which city in modern-day Israel will be the site of 'Armageddon'?", "Who was Emperor of Rome when Boudicca, queen of the Iceni, led her famous revolt?", "What will be made at the Tesla Gigafactory?" ]
15
[ 41370, 41371, 41372, 41373, 41374, 41375, 41376, 41377, 41378, 41379, 41380, 41381, 41382, 41383, 41384 ]